LOCUS       CP053346             5252057 bp    DNA     circular BCT 18-MAY-2020
DEFINITION  Sphingomonas sp. AP4-R1 chromosome, complete genome.
ACCESSION   CP053346
VERSION     CP053346.1
DBLINK      BioProject: PRJNA631068
            BioSample: SAMN14851439
KEYWORDS    .
SOURCE      Sphingomonas sp. AP4-R1
  ORGANISM  Sphingomonas sp. AP4-R1
            Bacteria; Proteobacteria; Alphaproteobacteria; Sphingomonadales;
            Sphingomonadaceae; Sphingomonas.
REFERENCE   1  (bases 1 to 5252057)
  AUTHORS   Heo,J., Kim,S.-J., Kim,J.-S., Hong,S.-B. and Kwon,S.-W.
  TITLE     Genome sequencing of strain KACC 21605
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 5252057)
  AUTHORS   Heo,J., Kim,S.-J., Kim,J.-S., Hong,S.-B. and Kwon,S.-W.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-MAY-2020) Agricultural Mircrobiology Division,
            National Institute of Agricultural Sciences, 166
            Nongsaengmyeong-ro, Iseo-myeon, Wanju-gun, Jeollabuk-do 55365,
            South Korea
COMMENT     The annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (PGAP). Information about PGAP can be found here:
            https://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            This genome has a base modification file available.
            
            ##Genome-Assembly-Data-START##
            Assembly Date          :: APR-2020
            Assembly Method        :: RS HGAP Assembly v. 3.0
            Genome Representation  :: Full
            Expected Final Version :: Yes
            Genome Coverage        :: 99.0x
            Sequencing Technology  :: PacBio RSII
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider               :: NCBI
            Annotation Date                   :: 05/11/2020 21:04:38
            Annotation Pipeline               :: NCBI Prokaryotic Genome
                                                 Annotation Pipeline (PGAP)
            Annotation Method                 :: Best-placed reference protein
                                                 set; GeneMarkS-2+
            Annotation Software revision      :: 4.11
            Features Annotated                :: Gene; CDS; rRNA; tRNA; ncRNA;
                                                 repeat_region
            Genes (total)                     :: 4,788
            CDSs (total)                      :: 4,729
            Genes (coding)                    :: 4,613
            CDSs (with protein)               :: 4,613
            Genes (RNA)                       :: 59
            rRNAs                             :: 2, 2, 2 (5S, 16S, 23S)
            complete rRNAs                    :: 2, 2, 2 (5S, 16S, 23S)
            tRNAs                             :: 50
            ncRNAs                            :: 3
            Pseudo Genes (total)              :: 116
            CDSs (without protein)            :: 116
            Pseudo Genes (ambiguous residues) :: 0 of 116
            Pseudo Genes (frameshifted)       :: 56 of 116
            Pseudo Genes (incomplete)         :: 58 of 116
            Pseudo Genes (internal stop)      :: 26 of 116
            Pseudo Genes (multiple problems)  :: 22 of 116
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..5252057
                     /organism="Sphingomonas sp. AP4-R1"
                     /mol_type="genomic DNA"
                     /strain="AP4-R1"
                     /host="Malus prunifolia (crab apple)"
                     /culture_collection="KACC:21605"
                     /db_xref="taxon:2735134"
                     /country="South Korea: Naju-si"
                     /collection_date="23-Oct-2019"
                     /collected_by="Jun Heo, Soon-Wo Kwon"
                     /identified_by="Jun Heo, Soon-Wo Kwon"
     gene            join(5251597..5252057,1..55)
                     /gene="ilvN"
                     /locus_tag="HL653_00005"
     CDS             join(5251597..5252057,1..55)
                     /gene="ilvN"
                     /locus_tag="HL653_00005"
                     /EC_number="2.2.1.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011951458.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetolactate synthase small subunit"
                     /protein_id="QJU60356.1"
                     /translation="MHIRTATAERHTLSVTVANEPGILARIAGMFAGRGYNIESLTVA
                     DVTEDEAVSRITVVTKGAPAMIEQIIAQLDRLPPVIKVIDLTALGPHVERELALVKVV
                     GSGDHRIEALRLAEVYRARVVDATISSFVFEVTGGTEKIDKFLELMREVGLVEVARTG
                     IAAIARGREAI"
     gene            199..1218
                     /gene="ilvC"
                     /locus_tag="HL653_00010"
     CDS             199..1218
                     /gene="ilvC"
                     /locus_tag="HL653_00010"
                     /EC_number="1.1.1.86"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017664036.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ketol-acid reductoisomerase"
                     /protein_id="QJU56376.1"
                     /translation="MRVYYDSDADIGLIKTKKVAIVGYGSQGHAHAQNLKDSGVPEVA
                     IALRPGSATAAKAEAAGFKVMTGAEAAAWADIVMILAPDEHQAAIWENDLKGNMKPGA
                     AIAFAHGLNVHFGLIEPPKDIDVFMIAPKGPGHTVRSEYQRGGGVPCLIAIHQDASGN
                     AHDVALSYASAIGGGRSGVIETTFKEECETDLFGEQAVLCGGITHLIQAGFETLVEAG
                     YAPEMAYFECLHETKLIVDLLYEGGIANMRYSISNTAEYGDIHTGPRIITAETKAEMK
                     RVLADIQSGRFVSRFVLDNRAGQPELKAARKQAEAHQIEKVGSELRAMMPWIAKNKLV
                     DKTKN"
     gene            complement(1297..2352)
                     /locus_tag="HL653_00015"
     CDS             complement(1297..2352)
                     /locus_tag="HL653_00015"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007678777.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MBL fold metallo-hydrolase"
                     /protein_id="QJU56377.1"
                     /translation="MLTRRAVIGSALAASLPWRGVLAATPVVPELDRLQLTILADGTV
                     SSFAQAVEKPGFRILAPARAASSYRLTLRGEWGYSVLADATAGGTSHRLLIDFGYTPE
                     GLAGNMAILGVDPATIEAMVLSHGHYDHFGGMPAIIGRVKRGTPLYVGGEEIFCARLR
                     GVDRDGADFGQIDRHDLLAAGIDVRIATAPATIAGSALTTGRIPFVSPERPRVPTAML
                     PGQGCRRDALDPDRRDLDFFVDDAVHELGTAFHLKGKGLVVIGSCSHRGIINTVRAAQ
                     AASGVERVHAIVGGFHLVPPQTPAQALETLALMRALKPDYILPGHCTGEAFMAAAIAQ
                     MPDQVFRTVVGSRIVFG"
     gene            complement(2388..4934)
                     /locus_tag="HL653_00020"
     CDS             complement(2388..4934)
                     /locus_tag="HL653_00020"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56378.1"
                     /translation="MAGGMQWRETPPEETEEAQTALPLGDSDWLEEAAAEPERRSRWK
                     DVTLVVAMLVLAVAWVAVLILLVVTTMPAGRLDLSRAAAWIGVGSGPLTLIGLLALVM
                     LRTGRTEATRYARAARDLRMESLRLAELLTLVDRRITTARQGLAKHGAELAAMGEETS
                     ERLGRAGEALRSDMGLVAETAAKLDDATATARTDLGVLLTDLPTLESRAGALGERLRF
                     IGQDVDEKAQALAGTLGGIETLARSADQSSVAAARRLAIELERIEGSAAAADRRIMEA
                     AGKLGEAADGALVHAAGTLDLVRRGVSEQGNALTALVTQARELLGRSGDESARMLATR
                     LDQLSGRIEETSVRIAQHESAARALLGQLEQALGAIEGRFERLGDTGAERVADLAETL
                     AMLAEHGDQIGTLLGKSGETAETALGQIVALRQQAASANEQLDADLPETLARLRAQAD
                     DAIALLRAAAPRADDLVRAAEDLQGKLAESGALIEIGGERILRFAADAGVRIATVRDQ
                     MTAVVDGGDARLARFSEQADQTIAAVRDGIAATVDGGGEHLARFSADADQRIDAVRAG
                     IEAMAAGGGESVARFTAQSDEKLAALRDQIASFDGLVARTDQEISGLAETASVKLVDA
                     LLRVRETAAQAAAHARETLAGAIPSAAQQLASASAEAMAKALDGVGQAEIDKVEAASA
                     KATDAATAASERLTRQLVTLTETTRSVEARIAEHQAAASATDEQSFARQVSLLIEALN
                     STAIDVAKIFSNEATDAEWSAYLKGDRSVFTRRATRLIDPGDTKAIAARYNDDGEFRA
                     QVNRYVHDFEAMLRRVLAVREGSAMGVTLLSSDMGKLYVVLAQAIERLRR"
     gene            5058..6245
                     /locus_tag="HL653_00025"
     CDS             5058..6245
                     /locus_tag="HL653_00025"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56379.1"
                     /translation="MTLAALVAAFDVEAGVPRAALPLAGATLVEHQIRRLATAGAERP
                     ILLVEQMAPALAAPLARLRADGIAVKVATSIAAAADLLAAEPRVLILADACLPDRALI
                     DRIATAPVPALAVLDDIPVHAAFERIDAQHRWAGIAILDGRRIAEVAQMVGDWDPIST
                     MLRAAVQEHAARIEAGRDIPVLAGSADAVHTAEARLITASREASRSWSDRFVEAPITE
                     ALLPQLFARAIQPSLPATLSALLAVGGALAALAGYRWFALLPLLLAGPLARMGQRLSL
                     IQARRVRSDATLQAIRLGSRALAALGLGWWLMRNSGQWGWLLAALLLVVAMAGLSAAR
                     RIVAWLGDGEDPIWYATPPALGWVILPFAALGLWTWGLSAITLYAGATFGWTMIRALR
                     LAR"
     gene            complement(6306..7832)
                     /locus_tag="HL653_00030"
     CDS             complement(6306..7832)
                     /locus_tag="HL653_00030"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012050845.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate hydratase"
                     /protein_id="QJU56380.1"
                     /translation="MATIIKAADLIESVADALQYISYYHPMDYIRALGAAYEVEQGPA
                     AKDAIAQILTNSRMCAEGHRPICQDTGIVTVFIKWGMGCTLDDPEGRSLQDVVDEGVR
                     RAYLNPENRLRASILKDPAFGRVNTKDNTPCVLNVEMVPGHHVDVQVAAKGGGSENKS
                     KFKMMNPSDSIVDWVLEMIPQMGAGWCPPGMLGIGIGGTAEKAMTLAKESLMGDIDMA
                     QLKARGPQTKIEELRIEIFDKVNALGIGAQGLGGLATILDVKIMDYPTHAASKPIAMI
                     PNCAATRHAHFHLDGSGPAYLETPDLNDWPKVEWAPSKESIRVDLDTLTPEVVASWQP
                     GDRLLLNGKMLTGRDAAHKRIQDMLAKGEDLPVEFKGRVIYYVGPVDPVRDEVVGPAG
                     PTTATRMDKFTKMMLDQGLLAMVGKAERGAIAIEAIKEAKSAYLMAVGGAAYLVARAI
                     KAAKVVGFADLGMEAIYEFDVKDMPVTVAVDATGTSVHNTGPLVWREKIAREKLLENA
                     "
     gene            8069..8830
                     /locus_tag="HL653_00035"
     CDS             8069..8830
                     /locus_tag="HL653_00035"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="porin family protein"
                     /protein_id="QJU56381.1"
                     /translation="MYKLMFFGVAAMTAAGAASAQTADAPTWSGPYAGLHAGYGIDGD
                     AHMDISGTSTATNNAIASGTRPRAIGQDREGFVGGGQVGWNFQRGNWVFGPEGDFSYM
                     RTRGTNSVYTNATGGGVQETLARSRMEWMGSARLRAGHTLGNGLVYATGGYAFGKVKG
                     SATFNTPTGVQNYAGRNSYTAQGWTAGGGAEFRPFHEGNLSKVSFGLEATYYDLGRSH
                     IYNGGTNAATINSGAYVIGRDTRGYNGVVKVNYAF"
     gene            complement(8977..9828)
                     /locus_tag="HL653_00040"
     CDS             complement(8977..9828)
                     /locus_tag="HL653_00040"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017980114.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="QJU56382.1"
                     /translation="MDFPALPFALDSYLARIALPERPAADAVGLAAVQRAHRLTIPFE
                     NLDIALGRPIGIDSTSVFAKLVSMKRGGYCFEHGQLFLDALEALGFQARPLLARVWIG
                     KPESVPALTHTFALVTIDGQDWIADTGFGGSYTPPMPLAEGEEVEAPDGARFRLARDP
                     EFGWMLSRNGHLGMTDGRSAGEGWHDQYSFTLDPVFPADLAVSNFWVNNAPESRFVKG
                     LIVSIPLPHGFATLNGRHYRRNTRDQSAEGEIADPRVYRMRLSLMFGIDFTADEVATL
                     GLFGDAG"
     gene            complement(9971..11260)
                     /locus_tag="HL653_00045"
     CDS             complement(9971..11260)
                     /locus_tag="HL653_00045"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008964670.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase"
                     /protein_id="QJU56383.1"
                     /translation="MRGPASCPAAAESRHGSRGRAGSARRRAGAMRLTIVQYAGDYRE
                     AFERFASGGKATYQAQRYSVDFVGSLAARLEQVSVVCALGDTPSDVVLANGVRAVNVG
                     LGEPLDVDRLLQAVAATRPDRLCIVTPVAGLIRWGIAQRLPMLLTLADSFKTAGLREK
                     LRAWRLARLLAHDRVEWIGNHGLNACLSLLSIGASPRKVIPWDWPPSFNPHDRAAKAR
                     AAGPARIVYVGAIEEAKGVGDVLEAVALLRGEGVAAEATFYGAVKAPDLPAMAERLGL
                     GGVVRFAGLVANEDVPGIMAAADYVVVPSRHEYPEGLPLTIYEALASRTPLVASDHPM
                     FRGALVDGRSARIFAAGSPRALADALAGLERAPALYAALSEGGAAAWDALQLPVTWGA
                     LVEHWLEGEAGWLADHAVASGRYDARLAERRAALRGA"
     gene            11345..13549
                     /gene="uvrB"
                     /locus_tag="HL653_00050"
     CDS             11345..13549
                     /gene="uvrB"
                     /locus_tag="HL653_00050"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019831423.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="excinuclease ABC subunit UvrB"
                     /protein_id="QJU56384.1"
                     /translation="MAIQIRTSLDEPDTGQSFIPHRPARPEKSEGGRPFVLKSDYAPA
                     GDQPAAIAELVAQAEAGERDQVLLGVTGSGKTFTMAKVVEQMQRPALVLAPNKILAAQ
                     LYGEFKSFFPDNAVEFFVSYYDYYQPEAYVARTDTYIEKESSINEAIDRMRHSATRSL
                     LERDDVLIVASVSCLYGIGSVETYSAMIFDLKKGQTVDQREIIRKLVALQYKRNDQAF
                     QRGNFRVRGDNLELFPSHYDDSAWRISFFGDEIEQITEFDPLTGKTSATLKEVRVYAN
                     SHYVTPGPTLKQASEAIRFELTERLKELQAEGKLIEAQRIEQRTNFDLEMIAATGSCA
                     GIENYSRFLTGRLPGEPPPTLFEYLPENALLFVDESHQTIGQINGMSRGDHRRKITLA
                     EYGFRLPSCIDNRPLRFNEWDAMRPQTVCVSATPGPWEMEQTGGVFTEQVIRPTGLID
                     PPVEIRPIESQVDDLVHEAMETAKKGYRSLVTTLTKRMAEDLTEYLHEAGLKVRYMHS
                     DVETLERIELIRDLRLGVYDVLVGINLLREGLDIPECGLVAILDADKEGFLRSETSLI
                     QTIGRAARNVDGKVILYADRITGSMERAMAETERRREKQMAYNTEHGITPETVRRSVT
                     DIVAHLSSKDQVTVDTGIEERPHMVGHNLRAYIEELEGRMRAAAADLEFEEAGRLRDE
                     IRKLENDELGLPNEPSKAPMRGNSTLGKPGTRQTRYGKAKAARAEKRGRGQH"
     gene            13641..15080
                     /locus_tag="HL653_00055"
     CDS             13641..15080
                     /locus_tag="HL653_00055"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012384029.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UbiA family prenyltransferase"
                     /protein_id="QJU56385.1"
                     /translation="MLGLTDAVRSQVLVVDLDGTLIRSDLLIETAFSALGHNPRSILP
                     ILSAFGRGKAQLKQCIADEVKNFDPATLPYDPAVLTLIRDEKAAGRRVYLASASNERL
                     VKAVADHLQLFDGWFGSSATENLSGSAKSRLLVERFGEQGFDYVGNDAVDLKVWPQAS
                     RAISIRAPGAVRRELDARHTSAVHLEHEKTGLKPWLKLLRIHQYAKNALVFLALGTSH
                     SFNPQSALLCLLAFVAFSLCASAVYVLNDLVDIGSDRLHPSKKRRPLASGTVSLARAI
                     MAIPILLVAGFGVALTVSPLFAGVVLGYLALTTAYSFSLKRKMMLDVVVLASLYTARV
                     LGGAVAIQVPVSQWLIAFAMFIFTALALVKRYIEMTARLDASLPDASNRNYRNDDIDV
                     VMAMAAAAGFNAVTVLALYINSDAVGPLYKRPELLWLVCPLLMYWIGRLLILAHRRMV
                     DDDPIVFALRDPISRWVILSILIVAAVAI"
     gene            15080..15523
                     /locus_tag="HL653_00060"
     CDS             15080..15523
                     /locus_tag="HL653_00060"
                     /inference="COORDINATES: protein motif:HMM:NF016060.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GtrA family protein"
                     /protein_id="QJU56386.1"
                     /translation="MALADTLRTLWGSGLARQFRSFAAIGLLAVATHYSVFLALLTWG
                     GMPPVAATTIGFLSGGVVSYAFNQWLTFTDRPHLLRGLATFFALISIGAVFNALIFGG
                     LVRIGVHYLLAQAAATGLVLFWNFFVSRTFVFKARSPSPTPVAPS"
     gene            complement(15559..16146)
                     /locus_tag="HL653_00065"
     CDS             complement(15559..16146)
                     /locus_tag="HL653_00065"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010215747.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PEPxxWA-CTERM sorting domain-containing protein"
                     /protein_id="QJU60357.1"
                     /translation="MMALAPFAAQATVVTFDGGIPGGTDPLGGTYVTGPSGGGLVQFQ
                     ETAGHQADDTQQVLFDPTGSGLANATSFTLTITGSTDMILPLDRNFGNYFETFAADGS
                     ILSVWNASVNAAGTAITYTADAGSELLAGERFATITTFSQGNDLPADFSYTLSWTGDA
                     AAAVPEAATWMMMILGFGLVGLSYRRKPAAVRFAA"
     gene            complement(16317..17009)
                     /locus_tag="HL653_00070"
     CDS             complement(16317..17009)
                     /locus_tag="HL653_00070"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017501823.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="QJU56387.1"
                     /translation="MSEVLGTTGLARSFTQGGKTIHVLRGVDLSVQAGEIVALLGPSG
                     SGKSTMLQAVGLLEGGFEGSIRIGGVEAASLDDKGRTRLRRDTLGFVYQFHHLLPDFT
                     ATENVVLPQLVRGTAKDAAETRANDLLSTLGLAERLDHRPAALSGGEQQRVAVARALA
                     NRPLLVLADEPTGNLDEATADRVLAEFVRLVRGEGAAALIATHNERLAAQMDRVVRLH
                     EGTLQQHMVNNS"
     gene            complement(17002..18249)
                     /locus_tag="HL653_00075"
     CDS             complement(17002..18249)
                     /locus_tag="HL653_00075"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010337348.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein-releasing ABC transporter permease
                     subunit"
                     /protein_id="QJU56388.1"
                     /translation="MFLNPYERMIARRYLWPGKGEGIIAVVVGFALTGVMLGVAALVV
                     VMSVMNGFRAELFDKTTALNGHAVIQGYDGKLPDWRRIVDVAQKTPGVTSAVPLIEQP
                     LMASAAGRVEGVLVRGMREPDIQGPQIGGKVVAGDIRQVVPGSGTVAIGARLAEQLGV
                     GVGGDISLISPAGEASPFGTVPRIVSYRVAAVFEVGIYDYDNAFVVMPIADAQTLLML
                     GDAVGMVEVQTVDADRVEQILKPVAVAAKGVAEVRDWRQMNASLFEALQVERVTMFIV
                     LSIIIVVAAFNILSSLIMLVRAKTRDIAILRTVGADRSSMVRIFVTVGLTIGALGTIG
                     GLILAAIFLYYRQGVVNLVQLLTGQNLWDPSIRFLTELPSRTDPFEVVAVIVLTMVMS
                     LLFTLYPALRAARTDPVQVLRYE"
     gene            complement(18383..19696)
                     /locus_tag="HL653_00080"
     CDS             complement(18383..19696)
                     /locus_tag="HL653_00080"
                     /EC_number="6.1.1.15"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012048563.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="proline--tRNA ligase"
                     /protein_id="QJU56389.1"
                     /translation="MRLSRYFLPVMKESPAEAQIVSHKLMLRAGLVRQTAAGIYAWLP
                     LGNRVLQKIANIVREEQDRAGAIELLMPTLQSADLWRESGRYDAYGPEMLRITDRHDR
                     EILYGPTNEEMITSIFRDAARSYRDLPRTLYHIQWKFRDEVRPRFGVMRGREFLMKDA
                     YSFDLDEAGARHSYNRMFVAYLRTYKRMGLRAIPMQADTGPIGGDLSHEFIVLAPTGE
                     SEVFYHTAWEQDRVLDVDADDAVALQNFVSSLTADYAATDEKRDEGREREAGEDLCTS
                     RGIEVGHIFYFGTKYSAAMGLKVQGPEGTEVVPQMGSYGIGVSRLMGAIIEASHDDKG
                     IIWPDAVAPYAVGLINMRADDPACAAAADDLYARLQAAGVEVLYDDRDERGGAKFATM
                     DLIGLPWQIVIGPKGLASGVVELKRRATGEKVELSPEDALAKVSG"
     gene            20482..20658
                     /locus_tag="HL653_00085"
     CDS             20482..20658
                     /locus_tag="HL653_00085"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56390.1"
                     /translation="MIPLRWIFRSRWAALVWAGGICFSAVQFAGGDHAKVDAGQSADS
                     AKAIASALNAEDPE"
     gene            complement(20681..21052)
                     /locus_tag="HL653_00090"
     CDS             complement(20681..21052)
                     /locus_tag="HL653_00090"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003597287.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="QJU56391.1"
                     /translation="MRPLFHPSVEDVRPEAILHALSDPVRAGIFAGIAGGTCIQNCSS
                     FAMVGDRLIPKSSLSQHFKVLREAGLIRSERHGVEIRNASRLCEVEKRFPGLIPAILD
                     SYARDKACAPDGGTVGEASAG"
     gene            21161..21907
                     /locus_tag="HL653_00095"
     CDS             21161..21907
                     /locus_tag="HL653_00095"
                     /EC_number="1.1.1.47"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017990654.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucose 1-dehydrogenase"
                     /protein_id="QJU56392.1"
                     /translation="MSKLAGKVAVVTGASKGIGAGIAKALGAAGAAVVVNYASSKDGA
                     DAVVQEIVAGGGKAVAVQGDVADAAQSQAIIDAAIENFGRLDVLVNNSGVYGFAPIEE
                     ITVDQYRQMFDVNVLGVLLTTQAAARHLGEGGSIINISSAVTSVMMPSSAVYTGTKGA
                     VDMITGVLAKELGPRRIRVNAINPGVVETEGTHTAGVIGSEMEDAFISQTPLGRTGRP
                     DDIADVAVFLASDDARWVTGEKIVVSGGLR"
     gene            complement(21974..23764)
                     /locus_tag="HL653_00100"
     CDS             complement(21974..23764)
                     /locus_tag="HL653_00100"
                     /inference="COORDINATES: protein motif:HMM:TIGR00229.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PAS domain-containing methyl-accepting
                     chemotaxis protein"
                     /protein_id="QJU56393.1"
                     /translation="MHERDTQRRSDAAWAAICRTQAVIEFDAAGQVLWANDLFLHLMG
                     YRLDQVVGQHHRLFCAPDLAASPEYEAFWRKLAAGECHSGQYARCTRDGATVYLQATY
                     TPLLDGDGRPERILKIASDISDSQRRGAELQAMSAAIERSQIVIEFALDGTILDANDN
                     FLEAMGYARAEIIGRHHSIFCGGEEVASADYQAFWRALGRGDYTSGVYKRLAKGGREV
                     WLRATYNPILDPEGRPLKVVKFASDVTDVKLQHAEYAARSTAMDRSQAVVEFALDGTV
                     LHANANFLRAVGYSLEEVVGRHHRMFCAPETARSADYAAFWVKLAGGAFDAGLYRRID
                     KEGRDVWLQASYNPILDPEGRPVKIVKFATDITATRERDAEYAGRLDAIDRSQAVIEF
                     DLDGRITKANRNFLAVFGYEKADILGQHHSLLCDEAETRSAAYADFWRRLSRGEFNAG
                     RYRRIGRGGREIWIQASYNPILDAEGRPRKVVKIATDVTRQVKLEREVQSRLEEGQRF
                     QAELQRGKERLEGTMAELATIVTAIGGIAVQTRLLALNATIEAARAGEAGRGFAVVAN
                     EVKKLAGDTRHATERATGMMRRGADLKIVH"
     gene            complement(23882..25516)
                     /locus_tag="HL653_00105"
     CDS             complement(23882..25516)
                     /locus_tag="HL653_00105"
                     /EC_number="6.3.4.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010163781.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CTP synthase"
                     /protein_id="QJU56394.1"
                     /translation="MTRFIFITGGVVSSLGKGLMAASLAALLQARGYLVRIRKFDPYL
                     NVDPGTMSPYQHGEVYVTDDGAETDLDLGHYERFTGVSARQSDNVTSGRIYRDIIAKE
                     RRGDYLGATVQVIPHVTNEIKAFAQDDIEGLDFVLCEIGGTVGDIESLPFMEALRQLR
                     NDLGRDNTCFVHLTLVPYIAAAGELKTKPTQHSVRDLTSLGIQPDVLVCRSEHPLPDN
                     ERAKIALFCNVPKDAVIPALDASSIYAVPIQYSAAGLDEAVLRSFRLDTGVAPDMRRW
                     DDIVDRVTNPEGEVTIGVVGKYVGLADAYKSLSEALVHGGIANRVKVNIRWLDAEMFE
                     HDSEELAAKLEPCHAILVPGGFGERGSEGKIASVRFARERKVPYFGICLGMQMACIEG
                     ARNTAGIANASTTEFGPTDEPVVGMITEWMTAEGLQKREEGGDLGGTMRLGAYEATLA
                     GNSHVASIYEATTISERHRHRYEVNVHYKDALEKGGLRFSGMSPDGTLPEIVERPDHP
                     WFIGVQFHPELKSKPFEPHPLFASFIEAAVRQSRLV"
     gene            complement(25927..26265)
                     /gene="secG"
                     /locus_tag="HL653_00110"
     CDS             complement(25927..26265)
                     /gene="secG"
                     /locus_tag="HL653_00110"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017979015.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecG"
                     /protein_id="QJU56395.1"
                     /translation="MFTFLLVVHALIAASLVGVILIQRSEGGGLTSGGNPGGLMSARG
                     AADFLTRATSILGTIFIVMSIGLAALATMQSGPRTIDTSLARKQAAPAPAAAPAPQAP
                     ADNGAVPLAK"
     gene            complement(26346..26975)
                     /locus_tag="HL653_00115"
     CDS             complement(26346..26975)
                     /locus_tag="HL653_00115"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56396.1"
                     /translation="MHDLSVLARSGLAALVALSGGAIASAQAPAQSPAVIVTAPVSRA
                     DAKALALGKVSAAFFLGLQELPAFTPEEMAARHQGATGDPEALAADQALNDWKLCALE
                     SITHWADLKPGRGEIVDGAMGRCVDVEHAYRGHLLKITQDGRLLFDLSFARQMAKSLE
                     DAWRPRILAAALDHDLEAVHAEKEKPVGTRRRSGSEPRAETSAETTPKN"
     gene            complement(27047..27793)
                     /locus_tag="HL653_00120"
     CDS             complement(27047..27793)
                     /locus_tag="HL653_00120"
                     /EC_number="5.3.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007404000.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="triose-phosphate isomerase"
                     /protein_id="QJU56397.1"
                     /translation="MALRKLVAGNWKMNGTRAKLAELDGIVSAADAAPGVDVAICPPF
                     TLIDAAVAAAPSLPIGAQDCHHAVQGAHTGCVSAEMIVDLGARYVILGHSERRTDQHE
                     TDRDARGKALAAFAAGLTAIICVGETGAQRDAGRAGIVVAGQLEGSIPATGTAANLVI
                     AYEPVWAIGSGRTPSLAEVKEMHGLIRAKLEAILGIEGAGVRILYGGSVNPGNAAELL
                     AVPDVDGALVGGASLTAAQFVPIIEAAAAL"
     gene            27992..29914
                     /locus_tag="HL653_00125"
     CDS             27992..29914
                     /locus_tag="HL653_00125"
                     /inference="COORDINATES: protein
                     motif:HMM:NF024545.1,HMM:NF025010.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56398.1"
                     /translation="MLAFFRRALGSWIVIALLGVIMIAFIVTGVSSPSGLSGLTGPGA
                     DSVATVDGKSIPTADVQRRAQNQLQQARQQQPDLDMPKFIAAVGGAGQLVDQYLNGRT
                     LEAWATRHGIVASDRLIDGEIASISAFQGTTGRFDEKTMRAVLAQQRISESSLRDGIR
                     GDMLRRQLLIPISSGVHPTPSMIAPYADVLVANRTGLVGLVPAKPDAVKPPTDAEIAA
                     WYKSHIALYSLPERRVLRYAALAQTVAAPTDAEIAAQYKADAAKYAPSQARTLSQVVL
                     PTEAAAKALAAKIAAGTPFPKAAADAGFAAADISLGEQQRDMFETITSKAIADAAFSA
                     AAGATTAPMKSVLGWHVVHVDAINDKPGRTLEQAKADVAADLVKKKQAEGMSTLATKI
                     EDAIGDGATFDEVVKANKLAVVTTPALTSTGVVPADAAYKPDATVTALLKPGFLAGVD
                     DEPTLERTAPDAAAVLDVVRVDAAAPLPLAQVKDRIVQAMIVDRAQATARATAQSLLD
                     KINKGADIAATFATAGLPAPNPISASQMELSRLQQPPAAARTLFQIPPGKATLAPAPN
                     GWFVIKVTKIDPPAPQMRTAIAQQMRAELGRAMGDEMLDQFARAASKDVTVKRNGKAI
                     ADLGRQLSGQAPADGQ"
     gene            29925..31433
                     /gene="trpE"
                     /locus_tag="HL653_00130"
     CDS             29925..31433
                     /gene="trpE"
                     /locus_tag="HL653_00130"
                     /EC_number="4.1.3.27"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014076904.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anthranilate synthase component I"
                     /protein_id="QJU56399.1"
                     /translation="MTGGDDAAARATLAGGRPALVWRRQLADTDTPVAAALKLIEPGR
                     GDFLLESVEDGATRGRYSLLGLAPDLLFRARGREAEINRDWLTDREAFTPVSSDPVDA
                     LRALVAECRMDVPEGLPPALAFLVGYFGYETIGLIEKLPRPAPNPLDLPDMLFARPTL
                     LLVFDRLADMLYLVSPVWPGAADPDAAVPAAIERIETAAARLAAPLPAAARTPEALPD
                     IAPMPALPAGRYGEMVASAKEYIAAGDIFQVVLAQRFTAPFPLPPFDLYRALRRINPS
                     PFLYHLDLPGFAVTGSSPEILVRVRDGEVTIRPIAGTRPRGKTTEEDAANRESLLADP
                     KERAEHLMLLDLGRNDVGRVAKAGTVHVTESYAVELYSHVMHIVSNVAGRLDPAKDAL
                     DALFAGFPAGTVSGAPKVRACEIIAELESETRGAYAGCVGYFAPDGNMDSCIVLRTAV
                     VKDGVMHVQAGAGIVADSDPAAEQRECEHKSGALFAAAREAVAQAGEARFGQ"
     gene            31535..31891
                     /locus_tag="HL653_00135"
     CDS             31535..31891
                     /locus_tag="HL653_00135"
                     /inference="COORDINATES: protein motif:HMM:NF017935.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF983 domain-containing protein"
                     /protein_id="QJU56400.1"
                     /translation="MDRIGFGEGIKRGLKRHCPQCDSPTLFDGYLRVRPICPVCGTDN
                     GRHRVDDIASYFTVLLMGHLVIAPALAIPFFWYIPLWAAMAILLGALTAATLAALPFI
                     KGGVIGALAATSQPAA"
     gene            complement(31912..33912)
                     /locus_tag="HL653_00140"
     CDS             complement(31912..33912)
                     /locus_tag="HL653_00140"
                     /inference="COORDINATES: protein motif:HMM:NF012546.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S9 family peptidase"
                     /protein_id="QJU56401.1"
                     /translation="MQRFLVFGGAAALLWVAVSAQAELPPLQDTARKFGAREHILDAS
                     LSPDGAHVVYIIPGKGKGTIALVTGADGKDPKLAAMAAGDPLNLRWCNWSAADRIVCI
                     YYGITDWAKVPASHTRTVSFDLDGKNVQYLGRRPTHDELRVSQYDGEVIDWLSGGDGK
                     ILMARDYVPQDVSQSGSAGGTSADGIGVDLIDTRTGISKTVEPPVRGRADYISDGRGV
                     VRIMSTDRARGAQSILSGTTINSYRLANERAWRPFSTVESGSSGALRPLAVDGEANVA
                     YALKTLDGRDALYRVALDGSMKADLAYANPVVDVRGTIMVGRSGRVIGASYITDSRQV
                     EYFDPAYRKLQSALARAIPNLPVIRFISASADEQKLLIWAGSDVDPGQYLYFDKATRH
                     LDRLTAARPELEGTKLSAQKSISYPASDGKMVPAYLTLPPGSDGKHLPTIVMPHGGPA
                     SRDDGGFDWLAQFFAQRGFAVLQPEFRGSAGYGDAWFVDNGFKSWKAAIGDIADGAHW
                     LVKEGVADPGQMAIVGWSYGGYAALQSAAVDPALFKAVVAIAPIADLGQFKAEHAAYT
                     NGAVVARYVGDGAHIADGSPARHADRFQAPVLMFHGDQDINVDVAQSRTMDRALRAAG
                     KRSELVIETGLDHQIEDGDVRAGLLMKTDTFLRANLKMPPAD"
     gene            34125..35189
                     /locus_tag="HL653_00145"
     CDS             34125..35189
                     /locus_tag="HL653_00145"
                     /inference="COORDINATES: protein motif:HMM:NF021508.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2235 domain-containing protein"
                     /protein_id="QJU56402.1"
                     /translation="MAKALAVCCDGTWNTADQAGGPTNVTKMARAILPVAADGSPQIV
                     YYDEGVGVGNFIERAVGGALGSGLSEKVQQAYRFCCLNYEPGDSILLFGFSRGAFTVR
                     SLAGLIGLVGLLRKGDLEYLPDIWKLYRTVPAKRSGLPDPQWKEARQPNIDLVGVWDT
                     VGSLGIPGNFLGGLGRQRHAFHDVRLTAKTLRAYHALAIDERRKNFAPTIWDTNNLAK
                     GQIVEQRWFAGVHSNIGGGYVDRVLSDIAFLWMCDKIGSLLALDQGYLQSRVRHVADG
                     MAEGELVDSSAGLKWRLLGKLDRILGMDRSEDVHPTAIARYRVGRARHDAAPYAPFPY
                     DPANMRAFLDRVRPGWDSAP"
     gene            35290..35883
                     /locus_tag="HL653_00150"
     CDS             35290..35883
                     /locus_tag="HL653_00150"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014076908.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminodeoxychorismate/anthranilate synthase
                     component II"
                     /protein_id="QJU56403.1"
                     /translation="MILVVDNYDSFTWNLVHYLQELGAEVEVVRNDAIGVGQAMSSGA
                     EAFLISPGPCTPNEAGISLDLVAACAEAKRPLLGVCLGHQAIGQNFGGTVVRAGELMH
                     GKTCPVLHDGTGLYEGLPSPFTATRYHSLIVREEDMPASLIVNARAPDGTVMGFRHES
                     LPIHGVQFHPESIATEHGHAMLANFMRIAGMKVLERA"
     gene            35937..36893
                     /gene="trpD"
                     /locus_tag="HL653_00155"
     CDS             35937..36893
                     /gene="trpD"
                     /locus_tag="HL653_00155"
                     /EC_number="2.4.2.18"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019371022.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anthranilate phosphoribosyltransferase"
                     /protein_id="QJU60358.1"
                     /translation="MDGATAEQAFNDILDGKVTDEAVARFLTDMAVRDETSVEIAAAA
                     RALRQRMVPVAAPADAIDVCGTGGDGAHSLNISTAVSIVVAACGVPVAKHGNRAASSK
                     SGAADVLEALGLDLDRATAQAEASLAEIGIAFLFAQKHHPALGRLAPIRRAIGRRTIF
                     NIVGPLCSPARVTRQLMGVARVDYLRTVSEALALLGIEASMIVSGEESLDELSIAGPS
                     RIVATGLTGFSESVVTPESAGLVRHPLDAIRGGDPAYNAAALAALLDGAPGAYRDAVL
                     LNAAAALIVAGKADGWQDGAGIAADAIDSGAARKLFDAWIAF"
     gene            37151..37459
                     /locus_tag="HL653_00160"
     CDS             37151..37459
                     /locus_tag="HL653_00160"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010218094.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56404.1"
                     /translation="MKMFPPITPPQTEPDIRLIDNTFAPELLVTGVSGMSLMNGIVTT
                     TLESLHCDHSKSPPPMERVVVARMGMPVAAAQALLVGLHQFLGQHGLSPLTAGTETRQ
                     "
     gene            37751..38539
                     /gene="trpC"
                     /locus_tag="HL653_00165"
     CDS             37751..38539
                     /gene="trpC"
                     /locus_tag="HL653_00165"
                     /EC_number="4.1.1.48"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019053651.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="indole-3-glycerol phosphate synthase TrpC"
                     /protein_id="QJU56405.1"
                     /translation="MSNRLTAILETKRTHVTERKAAVTLTALEAQAANQSPPRGFRAA
                     LQAKARTGYGLIAEIKRASPSKGLIRADFDPPAHARAYEAGGAACLSVLTDVPYFQGS
                     DDFLVVARAACSLPCLRKDFMIDPWQVLEARALGADAILIIVAALDDGQMAEIEDAAL
                     GLGMDALIEVHDAAEMERAMALKSRLIGVNNRDLRDFSVDFARTYELVGRAPEGCTFV
                     AESGLTSSADLAAMAEHDVRCFLVGESLMRQADVEAATRALLAA"
     gene            38539..39006
                     /gene="moaC"
                     /locus_tag="HL653_00170"
     CDS             38539..39006
                     /gene="moaC"
                     /locus_tag="HL653_00170"
                     /EC_number="4.6.1.17"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017979152.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cyclic pyranopterin monophosphate synthase MoaC"
                     /protein_id="QJU56406.1"
                     /translation="MNRLTHLDEAGAAHMVDVSAKAATKREATASGRIAMSAEALSAI
                     RDGALAKGDALAVARIAGIMAAKRTPELIPLCHPIAISKVSVDLTIEADGIACAATVA
                     TTGPTGVEMEALTAVSVALLTLYDMAKAIDRGMRIEGIGLLAKSGGRSGDWRA"
     gene            39006..40190
                     /locus_tag="HL653_00175"
     CDS             39006..40190
                     /locus_tag="HL653_00175"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006962168.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin molybdotransferase MoeA"
                     /protein_id="QJU56407.1"
                     /translation="MAMLSVAEAQARLLALTEPLPIETVPLRNAAGRWAAADVIARRH
                     QPAADLSAMDGYAIRYADLPGPWTVVGESAAGGGLDRAIGAGEAARIFTGAPVPEGAD
                     TILIQENGARNGDRLTLTGDAPKRPGYHVRPRGSDFDAGATLIAAGALLNAARIALAA
                     IGGHGSLPVRARPRVAILSTGDELVAPGTPTEGVMLPASNGPMLAALIGGTAEVLDGG
                     IVRDDLHALTAALRDAAATSDILVTTGGASVGDRDLVRPALSQAGAELDFWKVAMRPG
                     KPIMAGRLGHTLVLGLPGNPVSAFVTATLFLAPLVARLAGAADPLPRVRALPLAHDLP
                     TNGPRAHYLRATIRDGALDTLPDQDSALLAALASADGLVIRAPHEPAAKAGDMAMFLP
                     LA"
     gene            40251..40925
                     /gene="lexA"
                     /locus_tag="HL653_00180"
     CDS             40251..40925
                     /gene="lexA"
                     /locus_tag="HL653_00180"
                     /EC_number="3.4.21.88"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012049407.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional repressor LexA"
                     /protein_id="QJU56408.1"
                     /translation="MLTAKQHELLCFINDRLNETGVSPSFEEMKEALDLKSKSGVHRL
                     ISALEERSFIRRLPNRARALEIVKLPDAVKTRPPAAKTPSASKSAPVSAPSAANDVLE
                     IPLHGRIAAGLPIEAMESQSMLSVPAALLGPGEHYALEVSGDSMVEAGILDGDYALVR
                     KVDTARDGEIVVALVDEAEATLKFFRREGSMVRLDPANRAYDPQRYKPNQIRIQGKLA
                     GLLRRY"
     gene            40949..41290
                     /locus_tag="HL653_00185"
     CDS             40949..41290
                     /locus_tag="HL653_00185"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007806655.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="VOC family protein"
                     /protein_id="QJU56409.1"
                     /translation="MSRGRIDFIELACADVGEMQDFYSAVFGWEFERFGPTYACTMTG
                     DVDLGFQADMPEQTVAPLTVIQVPDLEEALASVEAVGGVVTRPIFAFPGGRRFHFRDP
                     AGNELAAHKPD"
     gene            41936..42331
                     /locus_tag="HL653_00190"
     CDS             41936..42331
                     /locus_tag="HL653_00190"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010218099.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56410.1"
                     /translation="MAYMDLSQAFAGGVALPHAEPAAATMQTGFSAIEWSVIALAARD
                     KLSSLGEPGRLSRALGSLFGLGGTSKLADPRLEALRQTAVQAWHHGYLLPASEIGRFI
                     TAGFSLDQFETLLASIATRRNAARQRIAA"
     gene            42328..43590
                     /locus_tag="HL653_00195"
     CDS             42328..43590
                     /locus_tag="HL653_00195"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019831925.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="efflux RND transporter periplasmic adaptor
                     subunit"
                     /protein_id="QJU56411.1"
                     /translation="MNMVTRIATTDAGTIDAGQRGRWKRNGALGIAAAAVAFGGYSLL
                     HHSAGADAAPPPPNVSVSQPLVRDVSQWDDYIGRFAPSRTVEMRPRVSGEVTGVHFKD
                     GDIVRTGQLLFTIDQRPFAAALAEARANQASAASTLALARADLGRVNRLAGDEAVSAG
                     EIDAIKARVQAAEAGLAAAAARVRSRSLDLEFTQVRAPISGRISDRRVDAGNLVAGGD
                     NGSGTLLTTINALDPIYFSFDGSEALFLKAQRDRKAGAVAQPVEIQLQDETGYRWKGK
                     LDFTDNRLDNRSGTIRGRAVIANPDYFLTPGLFGNMRLGHSGTVKALLVPDSAIQTDQ
                     ARKILLVVGKDGEVSAKGVTLGPVVDGLRIIRSGIEPGDRIVISGAQVAIPGAKVTPQ
                     PGTITPDKATEAVADAGTPAAAEATFAR"
     gene            43743..46916
                     /locus_tag="HL653_00200"
     CDS             43743..46916
                     /locus_tag="HL653_00200"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004208476.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug efflux RND transporter permease
                     subunit"
                     /protein_id="QJU56412.1"
                     /translation="MRFSRFFITRPIFAAVIAVLITIVGAIAYFALPISQYPDIVPPT
                     VTVTASYPGASAETVAETVATPIEQEINGVDNMLYQTSQSTADGKLTITVTFKIGTDL
                     DAAQVLVQNRVAIAVPRLPEDVQRLGVVTKKTSPDFLMVVNLVSPDDSLDRGYISNYA
                     LSRVRDRLARIDGVGDVQLFGSRDYSMRVWIDPGRAAALDLTAGEIVAALRAQNVQVA
                     SGTLGSPPYDQKNAFQLNVETQGRLTDPKQFADVVIRTDPDGRQVRVSDVARVELGAQ
                     DYGSNTYLSGKPTVIVAVFQRPGSNALAAAQGVSAEMKAMSAKFPKGLAYSVIYNPTE
                     FIAESIDAVKHTLIEAMVLVVLVILVFLQKWRAAIIPIVAIPVSLIGTFTMLAAVGYS
                     LNNLSLFGLVLAIGIVVDDAIVVVENVERNLERGLSPLEAARTSMDEVSAALVAIVLV
                     LCAVFIPTLFLSGLSGAFYRQFAVTISTATIISLVLSLTLSPALAAILLRKHEQHDDA
                     PRWQRLLQSAGDRFNHGFERLSESYGRLTLAFVTRPKRVMTAYAGLIAATVAIFYATP
                     VGFIPAQDQGYFLTVIQLPPGSSIERTDAVMQKVAKRILPLKGVKGSVMLAGFDGPSQ
                     TLAPNSAAAYVPLLSFEERKKLGVTIGSIMAEAAKATADINEARLLIVPPPLIQGIGS
                     AGGYRMMVQDQGSHGYADLGKTSFGLIGQANQTKGLQQIYTFYDPTVPRIFADIDRAK
                     ADLLGVPPERVFEALQVYLGSSFVNDFNLLGRTYHVTAQADARFRNTTADIANLKTRS
                     DLGGMVPIGSIATFTDKAGPYRVTRYNLFPAVEVDGDTAPGYSSGQSLDTMDRLADSQ
                     LGTGYAHEWTGIAFQQKLAGSSSAIVFGMAVVFVFLVLAAQYESLTLPLSIILIVPMC
                     LLAAMAGVNLRGMDNNVLTQIGLVVLIALAAKNAILVVEFAKQAEELDGLSPVEAAVR
                     AARDRLRPILMTSFAFILGAVPLVIAKGAGSELRQALGTAVFFGMLGVTGFGLLFTPT
                     FYVVCRALAQRFAKPKPEAPLALQPAE"
     gene            47074..48495
                     /locus_tag="HL653_00205"
     CDS             47074..48495
                     /locus_tag="HL653_00205"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010186650.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TolC family protein"
                     /protein_id="QJU60359.1"
                     /translation="MRWLAPVSMLALAACAAGPDYVPPVASASQHAPLIAAGAPVTDT
                     ETPDRWWQLYNDPVLDRLIADALAANTDLRVAVARLDKARAGLREARNDRLPQTDLSA
                     QPQYGRFPANRRPIGADREDWNVSLGLNVAYELDLSGRVKREIEAARGDVGAAAADAQ
                     AVRIGVVAEVTRAYVEAAAAAQQQAVAEHVLELLDRSLGVTDKRFQAGRAERLDVARL
                     ASLRDQRRAEIPPLIAQRQAALYRLAMLLGRTPGELPAEASARTAPPTIAQPIPIGDG
                     GALLARRPDVRAAERRLAADTARIGVATAELYPQITLGGSVSSNSNGFSNIFGAGPLG
                     WLLGPLIRWNFPNQEGIRARIAGSKADAQASLATFDGTVLRAIQETDTALSNYARLID
                     RRRALASARDEAATAVKITRARQREGVVDFLAVLDSERTYADTETALAEADAALSLAQ
                     VDVFKALGGGWQTPDAPVTVAAK"
     gene            48685..50034
                     /locus_tag="HL653_00210"
     CDS             48685..50034
                     /locus_tag="HL653_00210"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012253803.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid permease"
                     /protein_id="QJU60360.1"
                     /translation="MAAEHRLARTLSWPHLIALGVGAIVGTGILTLIGVGADKAGPAV
                     ILSFAIAGAICACAALAYAEMATMIPASGSAYTYTYVVIGELVAWVIGWSLILEYSLV
                     VSAVAVGWSGYAAPLLQAGLGVPMSVMQGPELGGLINLPAIFIITVVAGLLIFGTRES
                     ATLNAILVLVKIVALAVFVAVALPYFNAAHMEPFAPYGFAKSVAADGAERGVMAAAAI
                     IFFAFYGFDAIATAAEETKKPERDLPIGIVGSMIVCILIYVGVAAAAVGAIPFTGFAK
                     SPEPLALILRELHQPKAATFLAASAVIALPTVILAFFYGQSRIFFVMARDGLLPGALA
                     KVSARGTPVRITLFTAVIVGAIAGLFPLDEIAALANAGTLAAFVAVCACMLIMRRRAP
                     DAPRTFRTPAAWFVGGFGILGCFYLFLSLPSKTQLYFLIWNAIGLAVYAVTAARRRV"
     gene            complement(50081..50497)
                     /locus_tag="HL653_00215"
     CDS             complement(50081..50497)
                     /locus_tag="HL653_00215"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019371023.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56413.1"
                     /translation="MRYALSALLAAALIASGAAARDAKPPKTNLKGEAALAKVLEGRV
                     PGKPVSCISVTDSQQSRIFDGTAIVYQSTGRTLYVNRPTAGADALDNDDILVTQIWGS
                     QLCNLDQVRTVDRLSRFPRGFVSLGEFVPYTKPKKS"
     gene            50689..51378
                     /locus_tag="HL653_00220"
     CDS             50689..51378
                     /locus_tag="HL653_00220"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004615084.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAAT family transporter"
                     /protein_id="QJU56414.1"
                     /translation="MDLSPLPVESVVGAFLLAFPALFSIVNPVGAALIFNEVMTGRTR
                     AERHRMAARIGIYSTIVLLVSLWLGSYVLNFFGVSLEALRIAGGLVVAIRAWTLLMQP
                     GTHEERKASAAAPAQDAGEDVAFFPLTMPFTTGPGTIAVAIALSSQRPASGIGTLPFF
                     GGMSLAAVAIAIIIWLAYRWADRVVALLGNAGARVFSRLVAFLLLCVGVQIIVTGAIG
                     VAHIMFTQTPR"
     gene            51439..52746
                     /locus_tag="HL653_00225"
     CDS             51439..52746
                     /locus_tag="HL653_00225"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010219313.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="QJU60361.1"
                     /translation="MLASSLAFIDGSVTNVALPAIGHDLQARGEALPWVINAYLLPLS
                     ALLLIGGAAGDHFGRRRVLTWGILLFAAASVACALAADLHVLLAGRVLQGIGAALLMP
                     NSLGILGSSFEGEARGRAVGTWAAAGAIASAIGPPLGGWMVDAIGWRVIFYINIPVAA
                     AAILIARAYVAESASEEGRLDWLGALLATGALGALTWALTLWSAHHQASPASWTGLSA
                     GIALLILFVVTEHRLGERAMMPLSLFGSRPFVGLTLLTFLLYGALGGLIVMLPYLLIV
                     GGGYSPAQAGLALLPFSIVIGTASRLAGRLTERIGPRWPLTIGPIVTAIGFALLLRAD
                     PHGSYWTAILPGMAVIALGMAGTVAPLTTAVLSSVDDRHTGTASGFNSAIARTGGLIA
                     TALGGAVLSRTGVALVDAFHVAAIVGSALALASGIAAFATLES"
     gene            52907..54199
                     /locus_tag="HL653_00230"
     CDS             52907..54199
                     /locus_tag="HL653_00230"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008070776.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Hsp70 family protein"
                     /protein_id="QJU56415.1"
                     /translation="MSASPLQTLGLDFGTTNSVVALTHDGTTDPVLLDAPGGKTTSFR
                     SALCFWEDEGGRGKLASEAGPWAIAEYAEFPQGSRFIQSFKSVAANAAFEHATIFEKR
                     FRFEELGRLFLDKLAARAGGVFKTADRIVIGRPVEYAGHRPDDALARQRYAAMFAAIG
                     AEIHYVYEPVGAAFSYASRISDPATILVADFGGGTSDFSVVSIDRPGSAHRCVPLGHA
                     GVGIAGDRFDYRLIDHLVLPLLGKGGTYRSFDKLLEIPGGYFADVGDWSRLALMRNRR
                     TLAELEKLQKSATDPDSIGRMIALIEQELGFRLYEAVDRVKRDLSANESAHFHFAGGG
                     LSIEAPVTRAEFEAWIAPDVARMEAAVDRALATAGTPADRIDRVFLTGGSSLTPRIRR
                     LFADRFGEDRIASGNELSSIAHGLALIGQEEDLAPWAA"
     gene            54278..55303
                     /locus_tag="HL653_00235"
     CDS             54278..55303
                     /locus_tag="HL653_00235"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013837116.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="QJU56416.1"
                     /translation="MQEIGVGLIGYGLAGRAFHAPYVAVTPGMTLHAVVSRDAAKVHA
                     GLPGMDVVPDVAALVARDDVDLVIVASPDELHAEHALAALAAGKHVLIDKPFATTLAD
                     ARRIAAEGEARGRIVTVFQNRRWDADFRTLQRLIAGGELGEIVELESRFDRFRPTFTD
                     TWKDARTAGPWLDLGPHLIDQALTLFGRPIGVTTDLATQRAGAPAADYVHATLRYETV
                     RVHLHASKLVAAHGLRFAAHGTRGSWMKQGLDVQEGKAVAGQAPAGEDWGLDPVPGLL
                     FRPEDGPEPVAFVNEKGDYRLFWQALAEAIRGDGPSPVPASAGVAVLEVIDAGLRSAA
                     ERREILL"
     gene            complement(55336..56976)
                     /locus_tag="HL653_00240"
     CDS             complement(55336..56976)
                     /locus_tag="HL653_00240"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012049201.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease J"
                     /protein_id="QJU56417.1"
                     /translation="MTKPGNELLFLALGGSGEIGMNVNLYGTQGKWVMVDLGLTFADP
                     AYPGIDLILPDLEFIEKHAKDLLGIVLTHGHEDHIGAIPYLAADLGVPLYATPFTAGL
                     IKGKLEEEGITKQVKLNIIPRDSSFDLGPFSFTYVPLAHSIPEGNALLIDTPYGRIFH
                     TGDWKLDDEPLLGTPATAEELTAIGDKGVLALVCDSTNVFNESASGSEAAVREGLDAV
                     IREAKGRVLVTTFASNAARLQTLGQVARDTNRQLCVAGRSLDRILKVAKSVGYMDDFP
                     PVIDFDTAMSLPPRDVMIIATGGQGESRAALARIAFDSHQLKLSKGDTVVFSSKQIPG
                     NEMAIGRIQNALAAKDIIMITDRQAHVHVSGHPGRPELELMYRWIQPEIVLPVHGEMR
                     HMAEQARLADSLGVPKSIVQMNGDVIRLAPDGPKKIGTERSGRLILDGDVILPADGTT
                     MNERRKISLHGVIAVAVALDQAGRLKGKPAISFQGVPVEEDRADFIQEASEAAAKAVQ
                     AGGKDEAKLRESIRLAVRRKATEWTGKKPVVDVSLIRL"
     gene            57733..59079
                     /gene="miaB"
                     /locus_tag="HL653_00245"
     CDS             57733..59079
                     /gene="miaB"
                     /locus_tag="HL653_00245"
                     /EC_number="2.8.4.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013831932.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA (N6-isopentenyl
                     adenosine(37)-C2)-methylthiotransferase MiaB"
                     /protein_id="QJU56418.1"
                     /translation="MTSPSTRPPSRPLPKTFSVKSFGCQMNAYDGARMAELLEEQGLV
                     AVETDEADLVLLNTCHIREKAAEKVYSDIGRLTKTAQGKGRAKPMIAVAGCVAQAEGA
                     EIPRRAPAVDLVVGPQAYHRLPDLIAEAASGKKALDTDMPAASKFDALPKRRRQGPGA
                     FLTVQEGCDKFCTYCVVPYTRGAEISRPWGQVVDEAKALVDAGAREITLLGQNVNAWT
                     HEGRGLHDLIEELARLPRLARIRYTTSHPNDMADGLIAAHRDIDKLMPFLHLPVQAGS
                     DRILKAMNRSHDVASYLKLIDRVRAVRPDIAISGDFIVGFPGETDAEFEETLSAVRAI
                     GHAQAFSFKYSPRPGTPAATMGDAVPAAVMDERLQRLQALIAEQQYAFNRATLGKTCA
                     VLIERDGKLPGQRLGKSPWLQSVLIDGGAIGDLVDVTITQAGPNSLQGEAKVLAAA"
     gene            59840..61561
                     /locus_tag="HL653_00250"
     CDS             59840..61561
                     /locus_tag="HL653_00250"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011543049.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase Y family protein"
                     /protein_id="QJU56419.1"
                     /translation="MHPAPRPSRWISSAGAAARPRPAGDWSGIVTPDASPLTAGPRRY
                     LAIWLPMLAADAWRVSQPILPGKRAEHSAAQAGGRASHPRGASPPPAPPASGRGEADP
                     VIVFTETHANATRLTALTRMAMAAGLTPGLTLADARARLPDLVAIPRDQGAEARLLAR
                     AVDACRAYSPVVAPQPPDGIALDIAGCTHPYGDESRLAADLARRLARLGLTLRLGLGD
                     TPEAARARARFGADAEADLLALPVEALEASAETTLALRRAGLKRIMDLACRPRRMLAA
                     RFGDLALHLGRLLGEEDRRITADRPLDPVFALRRFAEPIARVEDGLACLDQLLAEAAV
                     TLLERHEGGRRFVARFFRSDGAVPGLAVETGRPVRDPAIVMRLFRERLEALSDPIDPG
                     FGFDCIRLDIPVTEPLAPAQDGLDGSERTAEPLAELVDRLVARLGADRIARLAPLDSH
                     IPECAVARVPATTAPDWPAPSPEDPPLRPLRLLDPPQPIEVTYGLPEGPPRRFVWRAH
                     AHEVARWEGPERIAAEWWRRRDRGGLTRDYYRVEDKAGHRFWLFRHGLAGGETERPDW
                     YVHGLFA"
     gene            61694..65473
                     /locus_tag="HL653_00255"
     CDS             61694..65473
                     /locus_tag="HL653_00255"
                     /EC_number="2.7.7.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013845998.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="error-prone DNA polymerase"
                     /protein_id="QJU56420.1"
                     /translation="MPLSPPPFVELVAASHFSFLHGASHGSDLVATALALKHPGLGLA
                     DRNTVAGVVRAWKALKDAREDAAALGAPLAPFKLATGARLVFADGTPDIVAYPEDRRG
                     WGRLTRLLSDGNLRSDKGDCLLRLDDLLGYSESLLLIVLPESSRRDGEGIARKTPTIL
                     PEDEDDSLPAQASIQPLEAGRGSRRDAETQREKEEKEAAPGDEAHASLSAPLRLRVNT
                     PSPRPRGNDDSKHGNVVPFPSRLREEIEGRTAPAEGRKTANVGSPPPAPPASGSGALR
                     RTLETLRAACPDRVWLALPATASGTDVRRRARLLALAREAGVPPLATTDALYATREER
                     PLQDVLTCIRLGVTIAQAGRRLEANAERHLKSAAEMAHLYRDCPQAIAETTRLLARIA
                     FDLAQLKYEYPHEPVPEGWKPQKWLQHLVVTAARTLWGAGKTPPKALRMLREEFRLIR
                     KMGYAYYFLTVHDVVQFAREQDPPILCQGRGSAANSMVCYLLGVTPIDPAANNLLFSR
                     FLSEERSEPPDIDVDFEHERREEVMQYIYRRYGRHRAGIVATVIHYRSRSAVREVGKA
                     LGLTDDVTSRLVSTVWGSYSSRMEEERFHETGFRLDNPEIARLNHFVGRLLEAPFPRH
                     LSQHVGGFVLTEDRLDETVPIHHAAMEDRTFVEWDKDDIDALGLMKVDILALGMLTCI
                     RKAFDLIRDHDGTDHSLRDIPREQPDVYAMLQKGDSIGLFQVESRAQMNMLPRLKPKE
                     LYDLVIQVAIVRPGPIQGNMVHPYLRRRQGIEKWSFPAPSPPHPADELHDILGKTLGV
                     PLFQEQAMKLAIVAAEFSPVDANKFRRAMATFRNVGTMPEFEEKMVGGMTKRGYTEEF
                     AQRCFSQIKGFGSYGFPESHAQSFAILVYASAYLKRRHPAAFCAALLNSQPMGFYAPA
                     QIVRDAREHGVEVCPIDVTASGWDNRLEVGAKGPAVRLGFRQIDGFKEEWAKAVEEAL
                     FLPIADGEGDHLRQQMVEGKSPAPGYCPSTAFGGPSPPAPRGEDVVERLARLIPARAL
                     RLLADADAFRSLELGRRDALWEVRRTPHDALPLFAAAKARELAEETDAQLPAMPLSEE
                     VAADYQMTRLSLKQHPMAFLRGLFRDEGILSAAELAALPDGRAARMAGVVLVRQRPGE
                     GKAIFVTLEDETGVTNVLLWAADFEKQRAAVMASRLMEVRGVVQKSEEGVVHLMTTQV
                     VDRTAELDRLSADHQTRPLLSRADEFAHPQHPRKKGAERRHPRNVRVLPPSRDFH"
     gene            65701..67188
                     /locus_tag="HL653_00260"
     CDS             65701..67188
                     /locus_tag="HL653_00260"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017669680.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="QJU56421.1"
                     /translation="MVNDSVEAERLATLAALQILDTPPEREFDEIVTLARDLLGAETA
                     LISLVDDHRQWFKAKEGLDARQTPREYAFCAHAIQQEDIFLIPDAMRDDRFVTNPLVT
                     GAPNIRFYAGMPIRAKHPTCEERLPIGTLCVLGPEPRSLAFFEERTLRALARITEALI
                     EARATAIGATRLAIEYQAALEKLDRSHRLFAQAERLANIGAWRLTLADNQLVWSDQTY
                     AIYGLPPDQSPSLETAIAHYPPHARAQIEEAVAHTIKTGQALDVEADFFTAQGEARRV
                     RSMGELEYKDGEAIALVGVFQDITARYRMEQTLRDIAETDELTRIASRSHFIAFFDAR
                     IAEARANGTPLAVLLIDLDHFKEVNDRCGHAAGDDLLRLIAKRLRAPYLETSFAARLG
                     GDEFVMVITDPEALADLPNLLRRMLADLRHTVTRAGLAIRVSATIGAAWLGEGVDTRG
                     VLLERADEALYDAKERQRGAAMIAGHDELIHPVRRAQTDRMRALG"
     gene            67250..67326
                     /locus_tag="HL653_00265"
     tRNA            67250..67326
                     /locus_tag="HL653_00265"
                     /product="tRNA-Pro"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:67284..67286,aa:Pro,seq:tgg)
     gene            67436..69457
                     /locus_tag="HL653_00270"
     CDS             67436..69457
                     /locus_tag="HL653_00270"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56422.1"
                     /translation="MCRIPYADRIDGRYVFRRRIHFRNLISKPVTIALRTADPKAARR
                     RAAMLSACFVIVKAKVERMLETGPALTGQQIDEIFRLALEEELNSLLDDAYKNAPWSD
                     AVTDVAAEIAAACRNLRRPNRPLSPATSWREGPPDPGEYQHLDGADFYAAQILANLGD
                     DRVAAILRAVGAPVHSGNLEPARTHIIRGMGRGAELAQRAFDDKICGAPVPAAALTAE
                     LGPRMVSAVQNVQPPMAVALTPTVPGEQDCQFLLHDKRRFSEIIEEVLAELKRKGIWK
                     RDLSQSRRIMQTFAWITGDKMLGDYNHLDVAKFQNGILRLPKGFRFGTLTKGAMTRPF
                     AEVVAKLPEPKDSQKRHLKTLNRDLSVMQTVSKHLEMGSWKGRHSEALVLNFGKSRVR
                     IKRGGNARPPWTKGHIACLFQSPIYTGNDGALRRLKNDARNPVIWHDAAYFAPLIWYY
                     SAACREEICGLELQDVILDHETPHFHIRDNLTRGRDGEKAGEKTEARNRLLPIPSEVM
                     RLGFADYVRAIAKEKHVALFPELYATAEKRGGAFFYDRAWQHMVGYIADRMPLPEPIN
                     GKGADIHSLRSLFSSFYEVDGVNEILRADVMGHSRRGTNAENYSQRERTEGQEVILKE
                     RLEFMKRYVPEISKHLDPSPIRLLPLNQRSRVGSSRIRQVRSDAGKKQR"
     gene            complement(69516..70235)
                     /locus_tag="HL653_00275"
     CDS             complement(69516..70235)
                     /locus_tag="HL653_00275"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013848891.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MobA/MobL family protein"
                     /protein_id="QJU56423.1"
                     /translation="MFIDHEQLKAARREFVVRPRAISRTEWPDFKIRPVSEEWRYVGR
                     VPAYRTMTANVAYIWRDSAPVDRFGPMPARFAERRCELKAAGLALPATAPLWAVTNPY
                     QIWEEADQVTVASGNPADLAGWHVMMEIPKHNRPENWRWMVEGFVQSQFVAKGAAVAW
                     AIHALEGGDGDWIIPPHAHLIVTGRHWRHDYRRGRRHPNWIASWAQQKRMEFAWRRRC
                     ANLRDIESAGFTVNDRWPGFG"
     gene            complement(70311..70847)
                     /locus_tag="HL653_00280"
     CDS             complement(70311..70847)
                     /locus_tag="HL653_00280"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56424.1"
                     /translation="MTHPYIKTGQSWSFALAILLGYPIGKPARHTVSFSSSGPRDGEK
                     DLHLATVALEAQRDFVHLTFADLEATEPLEFGMALLGIDRVHWLPNARLFAAGDKAPL
                     EMLHGDKRWRIDERNQLVSHKLPARHLIPRGEQVAWQRLRKMAAALADLEVVDGKFIK
                     LGDTCRDAHDLANLRVAA"
     gene            complement(70928..71596)
                     /locus_tag="HL653_00285"
     CDS             complement(70928..71596)
                     /locus_tag="HL653_00285"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56425.1"
                     /translation="MRPEDNMKMNVTTYVAMTAVMVAIPPSAGGTYPAGRQLVGLSLF
                     VATQYDFERWRFALHRRMVLAGESEAPLLEWAADLLPADAILIGWNVDHALVPLLLDA
                     AETAPPVVAHHFLARLHRLLRGGVVDLSLPRGGAGAPPLTAVAEEMAIRSPYLDRESV
                     LSAWATGDTDQLGHDLADEALAIWRVFVRTAGLAGIGAEAATDDWMRRRRRMRVVTPT
                     GSRS"
     gene            complement(71675..72514)
                     /locus_tag="HL653_00290"
     CDS             complement(71675..72514)
                     /locus_tag="HL653_00290"
                     /inference="COORDINATES: protein motif:HMM:NF021613.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56426.1"
                     /translation="MRRGQQPQRDAFNEHAIVAYDIETIVDDEPADGSFPPWPRHRPV
                     AAAFLTAKWTPNGYAFALDTLSCQPGTEEAFYRKVDELLPAGATAITYNGRGFDIRCL
                     ALQASRWVPDFKLPNLARQAASGRFDGAHCDLADAYSGFGGTRSVAMVELCKALDIPC
                     KIDVAGNQVGVLWRTGQRQAVREYVAQDVICTAVLWWHYIAFQKSDEKLLTLPLAELV
                     TWIQSEPGLAHLKPFAECRPAQLALKRAPALRVAAALADAELRVSQERDEAAFAAGDA
                     TPF"
     gene            complement(73472..74263)
                     /locus_tag="HL653_00295"
     CDS             complement(73472..74263)
                     /locus_tag="HL653_00295"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56427.1"
                     /translation="MPRRAHLVDAAALVARCAQALRDLPRPGEARVTFELAEMLIGRD
                     GVTPEKVGTSQPQRLAATRLDVPDLLGELQNRTELPRKVLADILVQSGRLADAAVNPS
                     AFVDAVTAIIQAGKRLMMTDGIVYKPLEEWWAQNLFAAEADVPLDRLVAVEHAPLDHI
                     VTDSNIEAELAKALDISGAIKVFAKLPQGFKITTPLGTYNPDWAIVRQHDDREDVYLV
                     SESKGDLNTLREAEKAQIACGKAHFEALSIPFVTATNLEGILTQA"
     gene            74417..77236
                     /locus_tag="HL653_00300"
     CDS             74417..77236
                     /locus_tag="HL653_00300"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015039744.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class I SAM-dependent DNA methyltransferase"
                     /protein_id="QJU56428.1"
                     /translation="MNAVEIEEAVSDLALQPFDAAEFAFQFLAAFSARDTTLKRLRKG
                     DSNQSDVAGGVLWRGNIHIAVAPAGEVGATLAALRASPKTTAQKAKFILATDGDTVEA
                     EDLVVGDVIACAYADLPRHFATFLPLAGISTVKEIKNNPIDVKATGRLNKLYVELLKD
                     NPDWATEERRHELNQFMARLIFCFFAEDTGIFEANLFTNTVSRMSVAGHGTGDEQWGN
                     THEVLTELFRTMDIDTRDGGAARREAGVKSWADQFHYVNGGLFTGATDSPRFSRTARA
                     YLLRAGELDWKEINPDIFGSMIQAVADDGERGELGMHYTSVPNILKVLNPLFLDDLRA
                     TLEAAGDSKQKLRNLRKRLRSIRVFDPACGSGNFLVIAYKEMRAIEAAIVAKLGGEEN
                     LKLADRRSVIPLSNFYGIEIKGFAAEIARLALLIAEFQADCLYLSQQEARAMVLPLHK
                     TGQITIGNALRLDWREVCPRAGAASSGEQDLGGPTGRLALEANGLEDSAEAETYICGN
                     PPYKGSQDQTSDQKRDLEIVAGSKLKSIKSADYVIGWFLSASAFIRTDGGRFAFVTTN
                     SVNQGRQVASYWPAILGSDLEISFAHPSFLWRNLAAKKAAVTVSVVGISARSDSLKII
                     FDNGLATSCRSIGPYLSPNSEVVVDSRSRPISDLSDMEFGSMPNDGGGLLIDSSDYVA
                     FERSDPRTARFLRPFIGSRDVIHGQRRFCIWINDDQVNAASDIPIIRDRITRVKRHRE
                     ASERESTKKLASSPHAFGERRYRSVRSMLIARHSAEDRPYLPFDIVGENVVIADSAIA
                     LPDYRLFEAAVYASRIHLVWVATVCGKIKTDFRYSNTLGWNTFPVPRLTAQDKADLTR
                     TAENILLAREAHFPATIADLYDPEAMPDDLRRAHEENDEVLERIYIGRRFRNDTERLE
                     KLFDLYTKMTANAAPKGKNMKGKAA"
     gene            77233..78201
                     /locus_tag="HL653_00305"
     CDS             77233..78201
                     /locus_tag="HL653_00305"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56429.1"
                     /translation="MMDPLDAIRRDPPNVWLTSFYGFDPGSWGYLGFSTPGQRKGFIT
                     RSEPGVLVVVYGTGTAAQDELGKVIGVLQCSHRVNNAKAFMSPVAWTAKEKSAESAGK
                     WDLGVKATRAWRVAPETRPPIADFANETYTPGRGQAIGSQGMPLTAAEALKLLDLDLQ
                     EVPVFGEIPILEAAFGKGADVLVPSKPGPVSQSPFVVREAEGPKSLYILALDGDTSAF
                     LGRDAGLQKIIKVGVSKTPIGRCDDHNRALPRGAFAWRVFRSNDHVGAMPFPKSRAAI
                     EGETEMKRVLVAHGQSLGGEFFLADDEAIEQAWESGMNKANEWASQ"
     gene            78198..80273
                     /locus_tag="HL653_00310"
     CDS             78198..80273
                     /locus_tag="HL653_00310"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011443926.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DEAD/DEAH box helicase"
                     /protein_id="QJU56430.1"
                     /translation="MTESRSIPAVRLVTAQTGASSSANELGMRVMQARAYAHRGEQYL
                     LIKSPPASGKSRALMFIALDKLHNQPVSQAIIVVPERSIGSSFADEPLTKGGFYWDWA
                     VKPHWNLCNTPGADDVKVAKSKVKAVGEFLASDDKVLVCTHATFRFAIDELGIEAFDG
                     RLIAVDEFHHVSANPDNRLGAQLGQLIARDKVHLVAMTGSYFRGDSVAVLTPEDEARF
                     VTVSYTYYEQLNGYQWLKTLDIAYSFYTGRYVDKINTLLDPAVKTIVHIPSVNSREST
                     KDKHREVEEIMDHLGKWKGTDETTGFHLIETAAGTTIKVADLVDDDPAKRDRVSAALK
                     SPQARKDRDHVDVIIALGMAKEGFDWIWCEHALTVGYRSSLTEIIQIIGRATRDAPGK
                     TVARFTNLIAEPAAADDVVAEAVNDTLKAIAASLLMEQVLAPRFEFTPKDAGPKDGYD
                     YGPDGYVEGRTNVGFNEERGQFHFELKDLVQPTTPEARRVCEQDINEVITSFIQDKQA
                     IERGMFDPEVVPEELTQVRMGKIVRERYPEMSETDQEAIRQHAIAALNITQQAAKIVT
                     ETATEDSNGELKANTSFVDGVRKFMNVRELDIDLIDRINPFDAAYAILAKAMNEGTLR
                     QVQAAISARKNTLTEEEARAFAVRAVQWKRERGRAPEATSQDPWERQLAEGVAAFARF
                     RQKAATANG"
     gene            80266..81477
                     /locus_tag="HL653_00315"
     CDS             80266..81477
                     /locus_tag="HL653_00315"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006698749.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GIY-YIG nuclease family protein"
                     /protein_id="QJU56431.1"
                     /translation="MAEMTDDDILAELGVDLTPKKVRARTPREERIIAGFEDIVKFRE
                     EHGRAPQHGEDRDIFERLYAVRLDRLRAQADCRALLADMDVHGLLDDVAVAAPVDGLD
                     DSALLAELGIAAEAADDITQLRNVRSNADRQAAEEIASAKRCEDFAAFKPLFDAVQAD
                     LEAGVRTTRPFVRDLGMSKADIKLGEFFIVGGQLAYVSEVGDPQKAPNGETDARLRVI
                     YSNGTESNLLLRSLQRALYEPDKGGRWVSEPNAGPLFSEAQAAQLEPEQLATGTLYVL
                     RSRSTHPTIAANRDLVHKIGITGGSVEARIAGAADDATYLLADVDVVATYKLYDINRP
                     RLEALIHRVLDAVRFDISIPDRFGKPVRPREWFLVPLPVIDQIVERIGDGTLVGVIYD
                     PSQAALVGTIS"
     gene            complement(81667..83490)
                     /locus_tag="HL653_00320"
     CDS             complement(81667..83490)
                     /locus_tag="HL653_00320"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007405800.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent helicase"
                     /protein_id="QJU56432.1"
                     /translation="MVDLTLAQKEVLTADGPQLVVGGPGSGKTTVSILKAAKIAREKL
                     RPGQRILFLSFARATVSRVFEAIDEERSVTKEEKKRIKVDTYHSFFWRILKAHGYLVG
                     FPRRMTILTPPNEAIALSSIRSGFKAPSKLSDEERSQKAALEVAERMRLATEEGKVCF
                     DLFAERVAILLHGSAKVRELVSTMYPFIILDEFQDTSAEQWRAVEAIGKSSTLIALAD
                     PEQRIFDFIGADPERLNHFRAAFTPSEHDLAGDNHRSKGTDIAIFGNHLLTGKFRDEP
                     YQGVEAEWFASNPNQAYASLVAQVLKARQRLVALGQREWSLAILVPTKRMTRLVSDNL
                     RAPFGTVPPIVHTAAVDMEGPILAAEVIAFLLQQRSHNGCFDEFVDVLCSFFDGRGGA
                     KPTKGDLAEAGRFRSALEKWNECLAKGKATPSNSVLQPTFAVHQAASALVLTGQPDAD
                     WTAVRAVLEAGGCKRLVEVAQEARNVRLLERGMQLRQSLSQDWRDTGGYKNALAITRQ
                     SFVQEHFATAHKPESGVVVMNMHKAKGKQFDEVIIFEGWPKRVKGKIVGNPDRIVGGN
                     VSAGPMTQARQNFRVSVTRAKIRTTIMSPKDDVCVLLIPVE"
     gene            complement(83499..85391)
                     /locus_tag="HL653_00325"
     CDS             complement(83499..85391)
                     /locus_tag="HL653_00325"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007405830.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AAA family ATPase"
                     /protein_id="QJU56433.1"
                     /translation="MKIYAVSIDNFRGISSTKLVLPDHAVLIGDNNTGKSSVLEAIDL
                     ALGPDRLSRRPPVDEHDFFESNYLAVTPAVPEEGAEPVEGADAAPGEAPKITVEVTII
                     GLSEEQEARFGGHVEWLNVATGDFFTDANPAGVDEVNIKAALRVTFIGAYDPDEDDFT
                     GNTFYSRSLTDGDKPEPFSKKDKQHCGFLFLRSLRTGSRALSLEHGSLLDIILRLKEI
                     RPQMWEGTIGTLAGIDVASDPALGISGVLDSIDKSLKKYVPREWGVKPHLKVSNLTRE
                     HLRKVVTAFIATGDGTHAAPFFRQGTGTINMLVLAMLSQIAEDKQNVIFAMEEVETAI
                     PPYAQKRIVHELRKLAAQSIVTSHSPYVLEEFKLDETVILSRDNAGKLSQAQIALPDS
                     VKHKRYRQEFRTRFCEGLLSRRVLIAEGATEASAFPVAARRLSELNAATYASIEALGI
                     CIIDAGTESQIADLAGLYKGLGKRTFGLCDKQTDPAKAAIEAQVERLFMHDEKGIEDL
                     ILKNTTQEALERFSDALDWPPHILGKYPDPKANLIPALKEYFGWAKGNWGIADFLGQC
                     SEAEMPSWIRDACITLKAICDPPPAPVAPPAPPVPPPPPAPPAPPAPPAPLAGNGGQA
                     GLGPAA"
     gene            85720..86604
                     /locus_tag="HL653_00330"
     CDS             85720..86604
                     /locus_tag="HL653_00330"
                     /inference="COORDINATES: protein
                     motif:HMM:NF013540.1,HMM:NF017666.1,HMM:NF024949.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain-containing protein"
                     /protein_id="QJU56434.1"
                     /translation="MIYDFRAARLAAGLSQRALAELLDTDAQAIKRMEKGVGAVPTLI
                     AAMKALNFRLAGVGAGATLPEQLRTRRLRRGMSLDQVATMTGLSRTTIASLERGGGSV
                     ASLLRLLEAIAPNARRRSPERSYWGYAGELDRDSRFTPPDFMNAIYSAFGEVDLDPCA
                     HLLSPVVARCRILLSDGGDGLTDDWSGRLAFVNPPFSALLKWLRRAHDQWHAGNVETV
                     VFLAPVRTDSAWFHDTLSTVADIYLLRGRVRFLKADGKGQHTPFSLMVVTLGANADQR
                     RRFAEAVPGFWLARRDAG"
     gene            86666..86983
                     /locus_tag="HL653_00335"
     CDS             86666..86983
                     /locus_tag="HL653_00335"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003164512.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="QJU60362.1"
                     /translation="MLETPLELTTLIGHRIKRRRLDMGLTQTDAAARAGIAYRTWRRL
                     EAEGNASIEDLVRAAVALRCEQDLAGLFPAPPATSMDALLDQQKAAAKPKPRMRAPAS
                     RAS"
     gene            86980..88227
                     /locus_tag="HL653_00340"
     CDS             86980..88227
                     /locus_tag="HL653_00340"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012284554.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II toxin-antitoxin system HipA family
                     toxin"
                     /protein_id="QJU56435.1"
                     /translation="MKLAPGTPLDIGLMLDEGEAADTVCRLAMADGLAQVEWSAAVVD
                     QRWRIDPLLYPPEPGLHAARGRNFDGLHGFLSDSLPDAWGQMLMKRRLEKLGVRIDTL
                     SAVDRLALVGQTGRGALVYQPATTPTEDVGTIDLDALAEESRVLLLGNDPAQIDTLAR
                     LGGASGGARPKIHLGIAPDGTLSGEGDTGHEDWIVKFRATVDPIDIGPIEEAYARMAR
                     AAGIDMAASRLLPAQTGPGYFATRRFDRPAPGRRLHMISLAGALEARADMPSIDYDMF
                     LRATMAITRHAADVEEAFRRMVFNILAHNRDDHTRQHSFLQDAAGDWRLAPAYDLTFS
                     NGPGGEHYLAVEGEGRAPNRAQVMTLGRRHGLSNRAIALIIDEVRAALSDWPQIAAEA
                     GTTVSVAEIAERHAEVATHFGDR"
     gene            88815..89564
                     /locus_tag="HL653_00345"
     CDS             88815..89564
                     /locus_tag="HL653_00345"
                     /inference="COORDINATES: protein motif:HMM:NF024600.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56436.1"
                     /translation="MAGTALSAQTPSAPKLSTPQPSAAAMRPATPPISATPAPSPAGS
                     AAPTPPANPAAPSAPASDEITVRGRELADMTPLSGPKEFISPMGEPFRSETDLSGAEL
                     WFRKADANGDGRMTREEFRADAMRFFNLLDTDHDKVIGPIELEHYENDIAPEIRVMNT
                     YGDPSKVKVDSDGNVTDAPYPTRLGAGRYSYIAAPEPVLATDSNLDRGVTVYEFITAA
                     DARMKSLDHNGDGVLTRDDLPHLRRPNDPRQ"
     gene            89683..90282
                     /gene="wrbA"
                     /locus_tag="HL653_00350"
     CDS             89683..90282
                     /gene="wrbA"
                     /locus_tag="HL653_00350"
                     /EC_number="1.6.5.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012288331.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)H:quinone oxidoreductase"
                     /protein_id="QJU56437.1"
                     /translation="MAKVLVLYYSSYGHIEAMAEAVAEGARSVGATADIKRVPETVPE
                     EIAKGAHFKLDQAAPIAAVADLEHYDAIIIGAPTRFGRMPSQLAAFLDQAGGLWARGA
                     LNGKVGAAFTSSATQHGGNETTLFSIITNLFHFGLTVVGLPYSHQGMMTLEEIVGGAP
                     YGATTIAGGDGSRKPSEIELSGARHQGEKVAEVATKLFG"
     gene            complement(90461..91006)
                     /gene="msrA"
                     /locus_tag="HL653_00355"
     CDS             complement(90461..91006)
                     /gene="msrA"
                     /locus_tag="HL653_00355"
                     /EC_number="1.8.4.11"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019369867.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide-methionine (S)-S-oxide reductase MsrA"
                     /protein_id="QJU56438.1"
                     /translation="MAEQIATLAGGCFWCVEAVFNDVAGVTQVESGYTGGHAVDPTYK
                     QVCSGTTGHAEAIRVHFDTDVIDYATLLDIFFHTHDPTQLNRQGNDIGTQYRSAVFPT
                     SPEQEAEVRAAIERAQPDWPAPIVTTIEPDAPWYPAEDYHQAYWESEGQSNPYCLATI
                     PPKLAKLRKSYQARLKAGLVA"
     gene            complement(91078..92220)
                     /locus_tag="HL653_00360"
     CDS             complement(91078..92220)
                     /locus_tag="HL653_00360"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007686259.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyltransferase"
                     /protein_id="QJU56439.1"
                     /translation="MAEDKRSMGRLLIPRDDGLRRNNFNTLRLILALLVVWSHSFAIW
                     YGTERDEPLSLLLNGVYNAGNIAVLGFFTISGFLITLSWQRSSTAGSYLAKRIARIIP
                     GYFVATLVSSLVVVPILSGLPFGRITGQDALGLLSNLWLRNFIVPAPGYEGAVNGSLW
                     SIPYEFWCYLGIMGLGLAGLLRFRILLPVAAILVMLTRTILDLLGKHPGGGLIEQVIG
                     YPYLWFVVLPSFLIGAAMLLYREHLPRSGVAAAGLVLLTIASAWVPLPGGWAGAQTRL
                     LLPPTLAYALFHVAFHPRWQLGDAARYGDFSYGAYLYAFPIQQMLKVGLLAAGIRFFP
                     FYVVTAMLASLAAGVASWFLVERWFEQRKRKRKPKPLEEETLLAAP"
     gene            92427..93980
                     /locus_tag="HL653_00365"
     CDS             92427..93980
                     /locus_tag="HL653_00365"
                     /inference="COORDINATES: protein motif:HMM:NF016800.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56440.1"
                     /translation="MLSVLSVALQGSVILFVSGNLFAFLLNRQDALWVRRRLLPIMIG
                     FFAFAMLMPSKWIVYLALLAIIPAMARKRGDIPALYLVVATSLPDLDQPMVVGSLYLL
                     NISKWLVAGIGAAIAYAMLPPVKNEEIGRRFDLPFVLFLALQVIQARGNNFTNTLRVE
                     TDVIASYLIPYFVISRSLGRPEDFRRLLLAMGFVGFTLSGIAIYEAKRTVLLYTTITH
                     RLGIMETISAYSHSRGGVLRATASFADATAFGGFLCTALLCLLPARGAFRARKYQLFA
                     FFVIFVGIYMANTRSALLGLVVGLLVYDLFRKNYRSLFRNVALIAAAAVAMVGIAQFS
                     HSMATRIGIAGDAAETTDYRKLLITRGWEEIRKHPISGVNPGQAVLSLSDLKQGEGIV
                     DFVNAYIWYGLTTGIIGMIAFLMGFLLPAIKMVGIRHRLNRIAYGREAGAVVAAVSIY
                     YAVAAGTAGFGGRAVMIYFSILAVGAALSGARPPRRVFPAAGPTSIGRADTGSGSSTE
                     GAMLTVAAK"
     gene            94043..95554
                     /locus_tag="HL653_00370"
     CDS             94043..95554
                     /locus_tag="HL653_00370"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56441.1"
                     /translation="MATGAAVIGGAALLALAAAQHTSPSAKPAALPPARPITIQPTVV
                     GMNLGQGQYYSQEWIFADLVQNNGLLEGVDHKPLDVKVDASGHPVDVPKGKEIWLLLQ
                     ISAIWKSGDYRCSISPGWTPGIRFSGTISGGDENFKLTVPPGIEGNLVVVKLTAKHDG
                     ANLAKASCIPVGMVPDAMFTPEFLDDMKPFGIIRFMDWMQTNNAPPQTWAGRPKPTDF
                     SQLKGMAVENMVALANKLGADPWFTLPFDADPEYYRNFAIYVRDHLAPGRKAYVELSN
                     EVWNPGFKQDRDAAERGKARYPGVEPYQAADYYYADRVIDMMKIWDEVFVGQMPRIVR
                     VAGGQIGWKERSDGLLAHKDLWKSVDAYAIAAYFGGVIQDIPESGPARVDKVLARLPD
                     QGNQVITSIEAQKAVVAKYGVSFITYEGGLDVTGFTPDAVKDSVAVVHDPRLYDIYTN
                     FLEDYRKRIGGLLVLYNGTSSTNYGHKDYTGQPLSATTPKMRAVLDFMKRHPQ"
     gene            95588..96481
                     /gene="xrtV"
                     /locus_tag="HL653_00375"
     CDS             95588..96481
                     /gene="xrtV"
                     /locus_tag="HL653_00375"
                     /inference="COORDINATES: protein motif:HMM:NF035943.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exosortase V"
                     /protein_id="QJU56442.1"
                     /translation="MTDISSTKAPASGRAVAAFASAHWLLILGLAAMILPTLGSVARD
                     SWSTEQGAHGPVVLATGVWLVLRMRPAFLPLATAGSPALATIGMAISFAAYALGRISG
                     TVEMEGFALYALMVCITYAYIGAKAMRVLWFPILYFAFLFPPPDSLVAAVTQPLKLGI
                     SREAVNLLSHFGLSVSRTGVIIQVDQYDILVAAACSGLNSIISLSAIGLFYIYIRHNA
                     NWRYAALLMVAIVPVAILANFVRVLLLILITYFFGDAAAQGFLHGFAGMTMFTVALLG
                     IFAIDTLASPIRRRLAGAGEA"
     gene            96478..97197
                     /gene="epsI"
                     /locus_tag="HL653_00380"
     CDS             96478..97197
                     /gene="epsI"
                     /locus_tag="HL653_00380"
                     /inference="COORDINATES: protein motif:HMM:NF023410.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="EpsI family protein"
                     /protein_id="QJU56443.1"
                     /translation="MSMTDEPTHATQPSLRVSRRDLLVGGACLAVAGGTYARMPRRRL
                     ASIPKDGLEKLAPDHIADWRYETTSGIVLPPPDELARLLYDQQVSRAYVSDKYPPVML
                     VMAYGSSQGGMLQVHRPEICYPASGFRLSQTVTDTLPIGGGHGVAVRAFTATGDTRTE
                     QVMYWTRIADALPTSWTSQRIAIMESNLRGAVPDGLLVRLSTVSDNITTGRATLADFA
                     RAMLAAAGPSGRRQLLGASAA"
     gene            97262..98164
                     /locus_tag="HL653_00385"
     CDS             97262..98164
                     /locus_tag="HL653_00385"
                     /inference="COORDINATES: protein motif:HMM:NF025010.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56444.1"
                     /translation="MSNMKVIAVAGLLATAATLSGCSKAAPSGQVAAVVNGKEVTLQE
                     INAELQAANLPPTADKQTVQRELLQRIIERKLLVAAAEEKGIDKTPEYQTQKRRADEL
                     LLVQLYAKQQLALVPVPSSTDISTFMAQHGNVFAGREQISLDQIRFPAPADVSKLKVL
                     EKDHTLDAVSQTLTGMGIKFERAQVGLDSGSVPTDIMKKIDGLPQGEPFVIPQPGFIT
                     VNVILSRKPISIDETKAKPAAVNAWRQEKFGQLLTKQIEALKSGAKITYQNGFAAPAK
                     PSAPTPPSATPTAPAAAPGAPTNP"
     gene            complement(98297..99112)
                     /locus_tag="HL653_00390"
     CDS             complement(98297..99112)
                     /locus_tag="HL653_00390"
                     /inference="COORDINATES: protein motif:HMM:NF013793.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CpsD/CapB family tyrosine-protein kinase"
                     /protein_id="QJU56445.1"
                     /translation="MSYEDSDRDAFKQMSNIAEGVATPLYGDETEFPRLEVDADGLGQ
                     RFVFGFRGGDQRARPFKLLRTRIAKMAADDGVKLIGVTSAAPNVGKTFVAANLAAALS
                     RLVDTHVCAIDLDMHRPALGPRFGVPDGDGIHDFLTGDVADIRAVGRQVNEERLVVIP
                     GYRRNVATGELLSGPRGDALFAGLRALPAGTLVIVDMPPIFADDDAVIISNRIDGYLL
                     VVEDGRTTKKQVEETIRMLSPAPMLGTVLNRYHRRIFSDDYGYGASYGYGAYY"
     gene            complement(99109..100563)
                     /locus_tag="HL653_00395"
     CDS             complement(99109..100563)
                     /locus_tag="HL653_00395"
                     /inference="COORDINATES: protein motif:HMM:NF014732.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipopolysaccharide biosynthesis protein"
                     /protein_id="QJU56446.1"
                     /translation="MNPYPNPGPLASLAQQGEDEGGSSSFLQVLPVILWEKRWWIIAP
                     GVLGLVGGVVAAFTIPTMFESSATVLIESQQLPLDVVNSPVTDVIGQRIARARERVLS
                     RQDLIRLIRTNNLYAEEQRHQALSAIVDKMRDATSVEAIGSDITGAPGGAAGRTIALK
                     IGFSYADPVKAQIVAQQYVNRFLEVDASSQTDQAVGAANFLNQQGSQIQAQISAIESQ
                     ITKIKSENGPLLALQSQATGNPAADAGRIDAEIIGLQGENARLAAQSGGDGNSAVQAA
                     EMALANARARYSDTHPDVIAAQNQLDAARRSATATSGASSPMINANNAQISSLRAAKA
                     MILSQSGEVRAAQARGPALAAEVDALEKRADSLRDQYRDIGSKAQSAQLSARMQTEQK
                     GERLTLADPPVVPDAPYKPNRPLLIAGGLVGGLGLGAAIVLLLELILRPIRGTEMLRE
                     AAGAAPLVIIPDFSRKPNMIIRWLERRNRKRART"
     gene            complement(100565..101719)
                     /locus_tag="HL653_00400"
     CDS             complement(100565..101719)
                     /locus_tag="HL653_00400"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56447.1"
                     /translation="MRRASLLVAALMAGAAGPQVADAQVVTAGGSVTGRIGYGSNPYL
                     SLNSPGDSGVAGGDLTAWVQRASENSTTRLTGSADIDQNFNYYGRAENYLARLEHQQT
                     ISERLAVTARLRYQDSINPRNFFDNTNSSNIDLLSIGQRSRTFGANANLQWTPSARDS
                     FYFGPQYSRSRYPNQPGNAFDQYGLQGGYLRQVTEKLKVGVDLSYQRLNSRAFSDSDS
                     YQGGLRLVYDFSPIWQFDGGVGLIHQISRPGGSATTPGFNASLCGKYPRYSVCIEGSR
                     QSAASGFGGLRTDNRIGAHGNYALTSRSSVNFSMLYDVSQSSGISTIPTQKFWEISGG
                     YSRTLSERLSAGFSGRYQYRDYGSLVAAGGTSVTGFSGTFDVTYKFGRID"
     gene            complement(101716..102384)
                     /locus_tag="HL653_00405"
     CDS             complement(101716..102384)
                     /locus_tag="HL653_00405"
                     /inference="COORDINATES: protein
                     motif:HMM:NF014606.1,HMM:NF022007.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar transporter"
                     /protein_id="QJU56448.1"
                     /translation="MMIRPVAALVGLAAFVPASLIAQTTPSKSTSTSTSSAASQPPIT
                     VNAKAPGQANSTYVISPGDVLDIYVWGDERLQRALTVLPDGTFGFPLAGTVMAAGHTT
                     NDVEKELSRLLAPQYKDVAPQVTVSVKQSTGMQISVIGKVKGPGTFSPTRYVTVLDAL
                     ALAGGPTDFADLSNVVILRKAGGKSQVLHAKLGGVLKGKPGEADLSGDSIPQLQAGDT
                     VVVP"
     gene            102614..104119
                     /locus_tag="HL653_00410"
     CDS             102614..104119
                     /locus_tag="HL653_00410"
                     /inference="COORDINATES: protein motif:HMM:NF025910.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tetratricopeptide repeat protein"
                     /protein_id="QJU56449.1"
                     /translation="MPRRGFAPFPLGIALALSLAPLVVGCGQNASKAMAAEAKADSYL
                     AAGDKVRAAAMLDAAVGFDGNDAGRWIKLGRVRRDLNQPQQAVDAFQQGVDLDPGNIE
                     GLQNLAVLYIAGRQFEMAKRIVDPLLSLSSNDIAGLLATGAIAYYEERYADADKIADQ
                     LIQLSPDGKEGYLLKAHVLEKTGRAAQGARLLERRMAITPDDPELAQQLLALYRSIGD
                     LQGVRSISIRLATLRPDDPRYRLESLRAYQAMGNIAERDRVTDYILGRYRNNPSVLGA
                     LADFWIAALPPADATKRIAQLASGANGVTKAALTGRLIRMGALNEAGALLAPVAGQPV
                     TGLNVDLHAMLATLLVAQGKIKEGRDQAEMALSFDGGNDVALLARARAHVALKEYDKA
                     LTDAQSVVANDSNEAASLLIADIYAKQGNDLLAASAFGEAQNNSPRSIGVVKARTAWL
                     VGRGRADEAAQVAGLFARQVNNGDAWKLYAQMCRAADDSICLMQARAGGAS"
     gene            104125..104886
                     /locus_tag="HL653_00415"
     CDS             104125..104886
                     /locus_tag="HL653_00415"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015457406.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="WecB/TagA/CpsF family glycosyltransferase"
                     /protein_id="QJU56450.1"
                     /translation="MGQDDLASKREFLGLDFDGLDTEGALAWIAARSAESPFAYVITP
                     NVDHMVRLTQLGRDLRRAYTHADLCLCDSRVLARLGRMVNVDLPVAPGSDITKALFET
                     GLEAGDTICLIGGTPAHAARLAELYPRLTIVQHVPPMGLLHDPAARAAAIDAAAAASA
                     RVTLIAVGSPQQELIAFEMRRSGKVHGTALCIGASVDFLVGNEKRAPRVVQKAGMEWA
                     WRLASNPRRLAKRYLVDGPAIFPLVWRWAKKRRRT"
     gene            105055..105900
                     /locus_tag="HL653_00420"
     CDS             105055..105900
                     /locus_tag="HL653_00420"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003166650.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dienelactone hydrolase family protein"
                     /protein_id="QJU56451.1"
                     /translation="MQTLTRPDGNRPEDFHVTRRTAAGLLFAGYAVAAFSAEAAPITT
                     PSDGLIAEWTTIPNGAEKPLPAYVARPAAKGTHPTILVVNEVFGIHEWIKDICRRLAR
                     AGYNAVAPDFFYRSGVDLPAKSDLKEILAVVNQASDEQVDGDVRATTDWIKKQSFAKR
                     GAIGITGFCWGGQVVWRSAMVDPDIKAGVAWYGQLKKVATRAAELKAPVLGFYGGKDQ
                     GITQEDVATMRAALKAAGKQDEIIVYPDAQHGFLADYRASYDEAASKEAWPKLLAFFK
                     AHGVG"
     gene            106123..109392
                     /locus_tag="HL653_00425"
     CDS             106123..109392
                     /locus_tag="HL653_00425"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012930170.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase S41"
                     /protein_id="QJU56452.1"
                     /translation="MRTAGRLTSSLIALLGSAALFAQTPSASPPPASPGKPALTQPAA
                     SPDGRTIAFASGGDIWEVPSTGGIAHLLVTDAATEARPLYSPDGKSLAFTSTRGGSTN
                     IFLLDLASGAVTRLTWSEASEELDSWSADGKWLYFASSANDPGGTPDVFRVSAAGGTP
                     IEVSREDYLSEFQAAPSPDGSIVALAARGISFNQWWRNGHSHIDETEIWLKPLSGTGA
                     YRKLLPGGAKQAWPMWKPGGASIVYMSDASGAENLWEVPAAGGTPTQLTRFTSGRLLF
                     PTMAADGKAILFERDMAVWRYDPATGQTAEVPITLRGAPATEGQRHLNLATFTRLAVS
                     PDGQKVAVIAHGEVFAAPAKDGGTAQRITNSVGAERELTWSPDSRRILTVGERGLDRR
                     VAEYDVAADRETMLTGAGIATVPVYAPDGKSIAYVKDARELHLLTLAAPGKPATDRIL
                     YTGTLATDEGDGPRPTFSPDGRWIAFPLVDRRSFVNVNVVATAGGPARPVSFLANGQM
                     GGIAWSPDGKYLLIDSAQRTEDSRLIRIDLLPHVPRYREDAFRDLFKPKSPGDPAPDK
                     GPSTTPQPKPLPAAAKKKGAAAPAKPAVPPVEIVWEGLRDRATILPIGLSAELPHVSS
                     DGKTLVFLAREKGQENLYSYNLDELATETPVAQQISASDRPKADAGLTADGKTLFYLD
                     GGRIIATPLEKPAPKVVAVTAQMDVDFATEKQIMFDEAWSVLDRNFFDPAFNGHDWKA
                     LRAQYQPYVDGARTPDELRRVIGLMIGDLNASHSGINRPRRGPGALPQGRVGMLGLRF
                     DRAAYEAGRGLVVSEVVPLSPAAIEGKIVPGERLVSVDGHAIGAHDNLDALLENSVGQ
                     RVAIGVSGPNGTRTVNLKPVTLTTIDGLAYRGWVDRRRAYVDRISGGKLGYVHMADMS
                     ADSLDQLYLDLDADNQAKQGVVIDVRNNNGGFVNGYALDAISRRNYLTMEPRGLYPFP
                     ARQALGQRALGLPTILVTNQSSLSDAEDFTEGYRALGLGKVVGQPTAGWIIYTWSETL
                     IDGSTVRVPRARIRTLSGQDMEMHPRPVDIAVERPLGETGAGTDAQLDVAVKTLLGAE
                     K"
     gene            109643..111049
                     /locus_tag="HL653_00430"
     CDS             109643..111049
                     /locus_tag="HL653_00430"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004208259.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2083 domain-containing protein"
                     /protein_id="QJU56453.1"
                     /translation="MAAPLDRKLYLGPRLRVLRRELGINQTQMAEELGVSPSYLNHLE
                     RNQRPLTAQMLVRLANTYDIDMRDFVAGGGEAAAGDLHAAFADGLVRDLGIPRQELNE
                     LADAHPGVAEGIGRLFRALTDLRRLPEALDRIAPAATASPVEWLRDHFQQRRNHLAEL
                     DAAAEAIAADLPDDPASLYHALKTRLADTHRIGVWIVPASVMPQALRHYDLHRRRLMI
                     ADRLTAPSRLFALAYQLCLIELEPLILEQVERAAPADTEARTLAKIAFANYAGAALLM
                     PYARFVAAAEESRYDCGWLAARFGVSFEQLAHRLTSLDRSGTRGIPFFLLRMDAAGQV
                     SRLVLTEAYPFARHGGVCPRWNGTTALRAPGEMVADLVESPDGGRTLILAQARAPEAL
                     RGAVSPRIVAIGCDARHMEAIVHADPLRAHAATTIGPACAFCERPDCPDRAMPPVTRS
                     LTPSQHQRPIAPYPFRRT"
     gene            complement(111181..112140)
                     /gene="secF"
                     /locus_tag="HL653_00435"
     CDS             complement(111181..112140)
                     /gene="secF"
                     /locus_tag="HL653_00435"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019832620.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein translocase subunit SecF"
                     /protein_id="QJU56454.1"
                     /translation="MRLLKLVPDNTNIGFVRLRHWAFGLTILLTVAAAALVGLRGLNL
                     GVDFVGGVMIEAHFKQPPVLDQLRGEVDRVGVGEAALQQFGAADTVSIRLPMPTSADE
                     GATNKIVRAVEDDLAKRYPGVSFNRAETVSGKVSGELIRNGMLAVFLAVFGIALFSWF
                     RYEWQFGVSTFVAIAHDLLVTLGFFALTQLEFDLNIVAAVLTIIGYSINDKIVIDDRI
                     RENMRKYRQMDMRALIDLSVNETLPRTVMTSVTILLALGAMLIFGGPVLRGFTAAMML
                     GVVVGTYSSIYVSSSLLISLGLKPQPFAAAPKKGPASRAERIS"
     gene            complement(112250..113848)
                     /gene="secD"
                     /locus_tag="HL653_00440"
     CDS             complement(112250..113848)
                     /gene="secD"
                     /locus_tag="HL653_00440"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013847776.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein translocase subunit SecD"
                     /protein_id="QJU56455.1"
                     /translation="MLDFPRWKVWGIILVLAVGVFLALPSLMPESTARGLGLGGMPRI
                     NLGLDLSGGSHLKLEADTADLAKQNLAKMEDTIRTEMRRGDTKIGIGDISTANGRISF
                     FVRDIAQLDAAVERARQQTSAVGVTGQRDWNVAVVDSTRIVMTQTQAGLDDAVDKAMQ
                     TATEVVRKRIDELGTREPTIVREGKDRILVQVPGLADPAGLKALLGKTAKLEFKLVDL
                     TADPAAVAANRAPPGSQIVPYPGNPGGAPLIAVQRRVIISGDDLIDAQVANDQNQQSV
                     VSIKFNSEGGRKFARVTQENTGKPFAMILDGSVLSAPNINEPILGGNAQISGNFTVDS
                     ANQLAIALRSGKLPVALKVIEERTVGAQLGADSIHAGVVASIIASVAVIVFMLVTYGR
                     FGVYANLAVVLNIFIILAVMAILNATLTLPGIAGFVLTIGTAVDANVLINERIREERR
                     RGRNVVQSVELGYKEASRTIFEANTVHAISGLIMLGLGSGPVKGFAVVLLIGICTSVF
                     TAVLFTRMLVALWLRKARPTEITI"
     gene            complement(113865..114206)
                     /gene="yajC"
                     /locus_tag="HL653_00445"
     CDS             complement(113865..114206)
                     /gene="yajC"
                     /locus_tag="HL653_00445"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013847777.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit YajC"
                     /protein_id="QJU56456.1"
                     /translation="MFASPAYAQSAGGAAQGSGGFLPLLIQMAPLILIFGIFYILLIR
                     PQQKRMKEQRNLIDSAKKGDIVVTGGGLIGKVVKVDGDEVELELGPNVKVRALKSTLS
                     DVRSGSKPAND"
     gene            complement(114485..115318)
                     /locus_tag="HL653_00450"
     CDS             complement(114485..115318)
                     /locus_tag="HL653_00450"
                     /inference="COORDINATES: protein motif:HMM:NF012862.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="caspase family protein"
                     /protein_id="QJU56457.1"
                     /translation="MRSSLRPFLLPFLLLMLAVLAVLAPAERAAAEVKALIVTGSYQT
                     AASPSLRLANPVVDGREIALALTRAGIRQIALVEDPDAAHWSEALDRFVGSLGKSDIA
                     LVYYAGHGLQVGGINYFLAGDGKTLLSVDAIVQQISSKAGSSLFVIDACRNNPFQKNA
                     AIGEQTIASRAAVGISMAQVAASGQGLAQLGELTGLSTVILFSTEPGNVALDGPAGAG
                     SPFAHAFAAEIVRRQSLDVTLRRTAVAVQRATEGAQSPWRQGDLARAVYIAGMPSFPV
                     P"
     gene            complement(115308..116351)
                     /locus_tag="HL653_00455"
     CDS             complement(115308..116351)
                     /locus_tag="HL653_00455"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56458.1"
                     /translation="MGAFVLAGKRIRWVAGAIGVLLCWAPPAVARISVTPRFSGYFDN
                     SVQRQSSAEAIGDRGATDRLDDIGQTLRALFGNGAGISIGDTRLISGGNQTFFAMGGA
                     SVTVPVDDRTQLTLTGLYGSTHGDVRVLSTSTQRLTVAGVTAQDLLVSSTQGRIRLRR
                     LDVELSAQRRLTENFSLTGGARIERVREHLVAGGEFEATQNGANLIRALSGDPALDPG
                     LSVSRFAATSRGTTTVYSLRGGGAAFAPIGGGHSFYVNGMLHVSRLPVQARTLKLTFV
                     ESGDQVEAQTKAPGEWSAGPDMAVGYSLRLNDRLGLDARYRGVFYFPLSGARTISDPR
                     VNHGFNLGVSVAL"
     gene            116565..116641
                     /locus_tag="HL653_00460"
     tRNA            116565..116641
                     /locus_tag="HL653_00460"
                     /product="tRNA-Pro"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:116599..116601,aa:Pro,seq:ggg)
     gene            116762..117205
                     /locus_tag="HL653_00465"
     CDS             116762..117205
                     /locus_tag="HL653_00465"
                     /inference="COORDINATES: protein motif:HMM:NF012301.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator"
                     /protein_id="QJU56459.1"
                     /translation="MNMLRVLVVDDSLTIRAALEEILQKGGRCRVVGSASSVEEARVM
                     IPALQPDVITLDLALPGEDGMSFLDEISAPLHAPAVVVSSATGPGTEKSAEALKRGAA
                     ACFDKSRLIAEGHRLLRAVQLAALDHLRARVAGLERELKLNGVRV"
     gene            117302..117844
                     /locus_tag="HL653_00470"
     CDS             117302..117844
                     /locus_tag="HL653_00470"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004211878.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sigma-70 family RNA polymerase sigma factor"
                     /protein_id="QJU56460.1"
                     /translation="MSPPSEKSVTDQLPVLLRFARALTRDEHDAEDLVHDALTAAYAR
                     RAQFRQGMPLLPWLFGIVRHRFIDGWRAARRRDQAIVDLAQLSPTEAPPSQEAAFRLA
                     EIGRLLEAMPAEQREALHLVVVEGLSYQEAASVLDVPIGTLMSRISRARLHLRAAEQG
                     TGNKIGAEPIARPRLRMIKE"
     gene            117850..118623
                     /locus_tag="HL653_00475"
     CDS             117850..118623
                     /locus_tag="HL653_00475"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004211880.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anti-sigma factor"
                     /protein_id="QJU56461.1"
                     /translation="MTGHPITETDLQAYVDDQLDAAGRLEVADYLVRHPEAAARILSD
                     LRAAEAMRCLARDGAALPSARLIQAATQLDGAFRRNRRVMRLRWAASIAVALASLAGV
                     NAYHNGRAPSLSTPARASTPIYVEEAMMSHRTALMRRQMRSQVETPHLDANDIRAATR
                     IRVPRFPDGWRLLDVQLFPSDYGPSLQVVMDGKQQAPLFLFAAVGTSELSRTPVMRMS
                     DGTPIACWARDGMIYVLSGGRSAQALKDAALDLADNKEA"
     gene            118623..120263
                     /locus_tag="HL653_00480"
     CDS             118623..120263
                     /locus_tag="HL653_00480"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012048606.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GMC family oxidoreductase"
                     /protein_id="QJU56462.1"
                     /translation="MLIDLAEADGSLLVSTEICLIGAGVAGITMARQLLGQGHQVTLL
                     EAGGIDYDRATAALGAGMNIGRDYYPLEDSRLRFFGGTTAIWGGRCATLDPIDLEKRA
                     YVPHSGWPIGWRELEAYYRKARPLFGLAENGASVGAMAATGLDVPPFDPDRIATPVWQ
                     FDQAFDRFSFAAARDLVDHPRCRIVTHANVTDIALQTDGKAVREIVAQSLNRRRITIR
                     PQAVVLAAGGIENARLLLASRSVMRRGVGNGHDQVGRYFMEHPHARGGHVVTRQAWQF
                     LKLFGRRHRIGAGEMAALIAPGEALQRREGILNTSLTLVARQPELARQFVGMKVYGGL
                     KHGLPPNRAGRSLWMGTKKVAAWAQRTIDPARPWLLHKLGQVELALLVRAEQAPNPDS
                     RILLGETRDALGMPRAVLDWRLSEIDKTSVSVLVDTLGDELRRLGLGRVERSGWLDDP
                     DRLWHTDPLVSAHPIGGYHHMGTTRMSEDPRHGVVDRDGRVHGVANLHVVGSSTFPTG
                     GWANPTLTIAALALRTAERLSARIRRPQSSLRAQTVAA"
     gene            complement(120314..120754)
                     /locus_tag="HL653_00485"
     CDS             complement(120314..120754)
                     /locus_tag="HL653_00485"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009822299.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HIT family protein"
                     /protein_id="QJU56463.1"
                     /translation="MDDEGPNPTILRFGYPATRIAETAHWMVLLRPEQPTLGSMILAA
                     KSSETAFGALSPEAFADMGVAIARIEAMLAATIQPARINYLMLMMVDPHVHFHVLPRY
                     EGERSHAGIAIGDRGWPKQPELAGAKPLDADQVKILRDWLSASW"
     gene            121149..121892
                     /locus_tag="HL653_00490"
     CDS             121149..121892
                     /locus_tag="HL653_00490"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012702917.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphocholine cytidylyltransferase family
                     protein"
                     /protein_id="QJU60363.1"
                     /translation="MLAAGRGSRLGDVTKDRPKCLLEFGGRPLIDWQLSALAANGVTD
                     VIVIVGFGAKRVAHYLGEHWPSVRLLHNPFYDVSDNLASLWLAREEMVGDMIVLNGDT
                     LVSTALVERVLKGAEAPITVTIDRKPAYDADDMKVRLDGTRLLAIGKTLSPDHAHAES
                     IGMLLFREAGTFLFRQAIEEAMFDPATVRRWFLSIIDSLASRAEIRVISIEGLGWGEV
                     DFPADIVAGELLVTGWLNAADPSRDSLSA"
     gene            122012..122494
                     /locus_tag="HL653_00495"
     CDS             122012..122494
                     /locus_tag="HL653_00495"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015457483.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PaaI family thioesterase"
                     /protein_id="QJU56464.1"
                     /translation="MSDALTPFDPLGLLGRHRSGHMVALGAQYVAHGDDWCELALPYD
                     RRLISDLATGTLASGPIVSLMDSAAGMAVWLKCGQLEPTVTLDLRVDYLRPARPGRRV
                     IGRCHCYRLTRRVAFIEGMAHDGDPDRPVARVAGSFLRLDDASQTDGGGAHPKLEAQL
                     "
     gene            122500..122922
                     /locus_tag="HL653_00500"
     CDS             122500..122922
                     /locus_tag="HL653_00500"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010544815.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PaaI family thioesterase"
                     /protein_id="QJU60364.1"
                     /translation="MQLLPYADFLGITVVSQDGGSPLLAMPYSEGLNGMPGRLHGGAI
                     AGLLEIAAIAAIDATLEEPDDPRQRFKPINVTVDYMRPGRPVETFARGVAVRVGSRIG
                     SVHVEAWQESPDKPIAAARMKLLIAQKIEDQTEKQEEK"
     gene            122922..123323
                     /locus_tag="HL653_00505"
     CDS             122922..123323
                     /locus_tag="HL653_00505"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019368185.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="EVE domain-containing protein"
                     /protein_id="QJU60365.1"
                     /translation="MRYWLLRSEPDAYSWDDLIRDGATEWNGVRNYTARNFLKEMQPG
                     DRAIFYHSNTQKAAVGVMEITRAWQPDGDDGKWASVAVKPLEALAKPVPLEAIKAEPR
                     LKALEMLRQSRLSVTPVRDDEWAVLLEMGAA"
     gene            123443..125149
                     /locus_tag="HL653_00510"
     CDS             123443..125149
                     /locus_tag="HL653_00510"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007678076.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-xylosidase"
                     /protein_id="QJU56465.1"
                     /translation="MAGKSGFCGALTLLGGLLASTASLAQAPASGPSIPVTMTVDAGK
                     PLGPLKPIWRFFGADEPNYATMKDGRKLLDHLGKLRPEQVYFRAHNLLNTGDGTAAFK
                     WGSTDIYKEDAAGKPIYDWTIADHIIDTYRARGIHPYLQLGFMPEALSSAPKSTPYQH
                     NWRPGFSYKLIEGGWNAPPKDYGRWAELIYQWTRHNIERYGRDEVARWYFEVWNEPNG
                     ESYWKGTPEEFQKMHDYAVDAVRRALPEAKVGGPDAAGTGGAFMDAFMAHLARGTNYA
                     TGKIGTPTDFLAFHAKGQPSFVDGHVRMGIATHLRGVNNGFAKIAAVPEMAHKAIVIG
                     ESDPEGCAACPGPQNAYRNGTMYSSYTVASFARIWDLADTNKVNLDGALTWSFTFEDQ
                     PWFAGYRQLATNGIDLPVMNVFRLFAMMGETRIGATSSGEVPLAAIMADGVRAAPDVG
                     VVATKAADGTVAILVWNYHDDDVAGPDAAIHLDLAGLGAGGTRTITEWRVDKTHADAF
                     SAWAAMGSPQSPDEKQYAVLEKASEMAPTVRPTSLAVRSGKAGLDVTVPRQGVMLLTV
                     AR"
     gene            complement(125724..127559)
                     /gene="typA"
                     /locus_tag="HL653_00515"
     CDS             complement(125724..127559)
                     /gene="typA"
                     /locus_tag="HL653_00515"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004210140.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translational GTPase TypA"
                     /protein_id="QJU56466.1"
                     /translation="MRLRNVAIIAHVDHGKTTLVDQLFRQSGTFRDNQRIEERAMDSN
                     DLEKERGITILAKPTSVEWEAPDGVKTRINIVDTPGHADFGGEVERILSMVDGVILLV
                     DSSEGAMPQTKFVTGKALKLGLRPIVVVNKVDRPDERIQEVLDEVFDLFVSLEATDEQ
                     LDFPVLYASGRNGYANEDPTLREGTLIPLFQKIVDHIPEPTADPDGPFKFLVTLLDRD
                     NFLGRILTGRIYSGVVKTNQAIHALDIDGKVIEAGRASKILAFRGLERVPTDEAQAGD
                     IISIAGLTEATVAHTIADTSVSEPIKSQPIDPPTLSMRFAVNDSPMAGREGTKVTSRM
                     IRDRLAREAESNVAIKVTESADKDSFEVAGRGELQLGVLIETMRREGFELSISRPRVL
                     FGEDEAGKKTEPYETVVIDVDEEHSGTVVEKMNLRKAEMTDMRPSGGGKTRITFSAPS
                     RGLIGYHGEFLSDTRGTGIMNRLFEKYGPHKGNIEGRKNGVLISNGAGEAQAYALGPL
                     EERGILFVGHGEALYEGMIIGENAKTDDLEVNPMKAKQLTNFRASGGKDDAVRLTPPK
                     RMTLEQAIAYIDDDELVEVTPKNIRLRKRYLDPNERKRMSRSKAA"
     gene            127760..128365
                     /locus_tag="HL653_00520"
     CDS             127760..128365
                     /locus_tag="HL653_00520"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015459102.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PEPxxWA-CTERM sorting domain-containing protein"
                     /protein_id="QJU60366.1"
                     /translation="MLWGEARMMATVRCSVVAAALAAIAVPASAATFTVDGDTSSGAT
                     YHRPLSDFGPPTQLSRVGTAVRYASLSFSVSAPGDYDFMMTSTTPDFDPVLTLYQFSF
                     DPANALTNALLTNDDLVAGNLTQAGFTHLLSAGIAYVVVMTGFENSDSGTFTFTIDGP
                     GTVSADLPAAPEPATWAMFIGGFGLIGGAMRRRRRVSVRFG"
     gene            128434..129054
                     /locus_tag="HL653_00525"
     CDS             128434..129054
                     /locus_tag="HL653_00525"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006700452.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flavodoxin family protein"
                     /protein_id="QJU56467.1"
                     /translation="MPLTAIALNATLKPSNGKPSSTDRLIGEIAAALKAEGVETVETI
                     RLADHDIKPGVSSDEGAGDAWPALRTRILAADILILGTPIWMGQPSSVSKRVLERMDV
                     FFSEVDDKGRTPAYGKVAVVAVVGNEDGAHHVSAELFQALNDVGYTLPAAAVTYWVGE
                     AMGDVDYVDLKETPSKIDQTTKMLARNAAHLAGLLSGKIYPGLDRS"
     gene            129107..130522
                     /locus_tag="HL653_00530"
     CDS             129107..130522
                     /locus_tag="HL653_00530"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56468.1"
                     /translation="MTIGREVPKIHGKAGTLALPLAALAFAALTACAYWPGLMTWDPV
                     RQYGEAISGEIDDWHPPMMQWVWRQLIPLHPGPMPMLVLQLSLYWGGFLLLAGAIRAR
                     GRPHLGWALLACGLWPFGLALTGMILKDCLMAGALLVATGLLAWRQDRGGGAGAIVAA
                     AFLFFAATLRFNAFAACLPLLIALLPQAWRASWPRLLLSTLVGAVLLLAAMPLANRLI
                     GAEKSDVELSLVIFDLAGITEHGGGNVFPAALAMPDAIAINHRCYRPDKWDSYSDWVD
                     PECPLGFSAWGEKVDDRIVRPYPTLARAILAHPLAWAEHRLTHFAINTRILPLPDTIE
                     RPIPHETAPNDWGFHITPNAATRALDALALALAHTPLGWPIVWIALALGMTIASAGLP
                     SSRLILPIALSGFLYGMGYLVFSVASELRYHLWTALAALIAMVLALAEPEIRRSRRLV
                     WAFTPAALAVAAGLIARSAAG"
     gene            complement(130627..131043)
                     /locus_tag="HL653_00535"
     CDS             complement(130627..131043)
                     /locus_tag="HL653_00535"
                     /inference="COORDINATES: protein
                     motif:HMM:NF024797.1,HMM:NF024890.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="EF-hand domain-containing protein"
                     /protein_id="QJU56469.1"
                     /translation="MKTMMVTGTALAALLAPMLSGAPALAQRGPMGPVTHDAYVAMQK
                     QRFDMMDADHDGVVTKEELTAQLTARMGEAPPAERVDALFKTMDTDGDGKATAAEVAA
                     SAESRFAAMDTNHDGTLSEDEFRAGMAQMGMGGRRR"
     gene            complement(131394..131558)
                     /locus_tag="HL653_00540"
     CDS             complement(131394..131558)
                     /locus_tag="HL653_00540"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56470.1"
                     /translation="MRATDDRRMLRRGRAYGSLERARLRIWLSELWCALGAAALLIFT
                     VAVLVFAARH"
     gene            131823..133034
                     /locus_tag="HL653_00545"
     CDS             131823..133034
                     /locus_tag="HL653_00545"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015459902.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="toxic anion resistance protein"
                     /protein_id="QJU56471.1"
                     /translation="MATTATETETDLVLTPPTPVQAIAPAKAAGLVPLQDEQKTQLDA
                     KAEGFVEELAALDANSPEFGKKVDQITNMGRREIAEAAGQSNRFLDRPVRAMDGESGV
                     GADLAELRRTIEDLDPGKKGNLLAPRKLFGVIPFGGKLRNYFDSYKSAQGHISSILAS
                     LASGKDELIKDNAAIDVERQNMWAAMQRLEQMIHVAKALDEKLEGKALDLEATDPAKA
                     KAIRESALFYVRQRAQDLLTQMAVTVQGYLALDLVKKNNVELVKGVDRASTTTVSALR
                     TAVTVAQALTNQKLVLQQITQLNTTTANIIDSTGELLRSQTGEIHKQAAASTIPLETL
                     QRAFQNIYDTMDSIDRFKLEALDSMKTTVTSLTSEVEKSRGYIARAEGAAQARLTSAG
                     ATPEDPFKPVG"
     gene            133055..133759
                     /locus_tag="HL653_00550"
     CDS             133055..133759
                     /locus_tag="HL653_00550"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010125344.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56472.1"
                     /translation="MPDPQRVVADAEALLRRVSDEGREQARRERRKRNAAAFRTARRL
                     AVATFAVFLAAIVWAMAIGPIGITGFTGALVALVAAWSIILFSSRSIVETPERLVQSD
                     LARLAPRTETWLQAQRPLLPPPAARLIDGIGVKLEVLTPQLASLDPNEPAAAGIRKLL
                     AEELPELIQGYARVPLSLRKARNGIGPDVQLIQGLSAVDEELARMSEDLAAGDLHKLA
                     TQGRYLELKYKDETGG"
     gene            complement(133763..134488)
                     /locus_tag="HL653_00555"
     CDS             complement(133763..134488)
                     /locus_tag="HL653_00555"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010218756.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metallophosphoesterase"
                     /protein_id="QJU56473.1"
                     /translation="MTRLFHVSDLHFGREDAAAVARFAEIVRAERPDAVICTGDLTMR
                     ARSHEFAAATEWLKSLGVPVTVEPGNHDLPYFNPVQRLLDPYKRYARVAAAIDRPIDL
                     PGVAIVPLKTTARIQPRRLSWGRVSRTGLIRALALLAEKPKGVLALVTCHHPLVNTGF
                     EGHGDTLGGESALALLAAAGADAVLSGHVHDAFDVARDVGERTVRLIGAGTLSERTRT
                     TAASFNEMRVKKGRLEVTAREVR"
     gene            134702..134983
                     /locus_tag="HL653_00560"
     CDS             134702..134983
                     /locus_tag="HL653_00560"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017181736.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56474.1"
                     /translation="MTSHTPAADNPEADPDPFTRRARPTFLYVMYVLLLAAIPVGLLA
                     AVRPAAAQAIATGMRAYFGAIPEPLYALFGTGYLGYTVAREWGKAKGTR"
     gene            135133..135699
                     /gene="hslV"
                     /locus_tag="HL653_00565"
     CDS             135133..135699
                     /gene="hslV"
                     /locus_tag="HL653_00565"
                     /EC_number="3.4.25.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010218484.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent protease subunit HslV"
                     /protein_id="QJU56475.1"
                     /translation="MSEDKIGWHGTTILSVRRNGKVVVAGDGQVSMGNTVMKPNARKV
                     RRLGEGGHVIAGFAGATADAFTLFERLERKLEQYRGALLRAAVELAKDWRTDKYLRNL
                     EALMIVADKDVTLILTGNGDVLEPENGIAAIGSGGNYALSAARALVEYESDPETICRK
                     AMAIAADLCVFTNGNLTLETIEEDRPEE"
     gene            135829..137127
                     /gene="hslU"
                     /locus_tag="HL653_00570"
     CDS             135829..137127
                     /gene="hslU"
                     /locus_tag="HL653_00570"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015457964.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent protease ATPase subunit HslU"
                     /protein_id="QJU56476.1"
                     /translation="MNQSLTPKAIVAALDAHIVGQTDAKRAVAVALRNRWRRQRLPED
                     LRDEVSPKNILMIGPTGCGKTEISRRLARLADAPFVKVEATKFTEVGYVGRDVEQIAR
                     DLVEEAIRLEKERRRAAVKDKAEEAAMARLLDALVGKDASEATRTAFRQRFTDGHLDT
                     SEIEIELEDAGGAQFEVPGMPGQMSMINLGDIMGKLGGAKMKKRKLPVRAAWTKLVDE
                     EADRRLDQDEVSRQALADAEANGIVFLDEIDKIAVSDVRGGSVSREGVQRDLLPLIEG
                     TTVATKYGPMKTDHVLFIASGAFHVSKPSDLLPELQGRLPIRVELKALTEADFVRILS
                     DTRASLTEQYRALIGTEGVEIAFTEDGIAAIAKIAAQVNDQIENIGARRLQTVMEKLL
                     EDVSFDAEDRQGTTITVDAAYVEGQLAEVARDTDLSKYVL"
     gene            137268..137549
                     /locus_tag="HL653_00575"
     CDS             137268..137549
                     /locus_tag="HL653_00575"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56477.1"
                     /translation="MKNVTVSLDDETYRRARLRAAEMDTSLSALVREFLNKVGAQETE
                     FERLAREQRELFEQFDRDGIGVDAGARLPREELYDRDRARRDAAEASRD"
     gene            137542..137985
                     /locus_tag="HL653_00580"
     CDS             137542..137985
                     /locus_tag="HL653_00580"
                     /inference="COORDINATES: protein motif:HMM:NF013970.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PIN domain-containing protein"
                     /protein_id="QJU56478.1"
                     /translation="MTDRWFLDTNVLLYAISQNPADVEKGRIARSLVFQTSCALSVQV
                     FQEFLNQATHPKGGFGLSLDAAEKVLAGYRRFPVQETTLALFDTALAVTSRTGYSIWD
                     SLIVAAAQALGCNILYSEDMQDGRIIDGLRILNPFREGASLPWVS"
     gene            137979..138605
                     /locus_tag="HL653_00585"
     CDS             137979..138605
                     /locus_tag="HL653_00585"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019831457.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DedA family protein"
                     /protein_id="QJU60367.1"
                     /translation="MVEKILAPVAAWIIMVISAGGYLGVVGLMAIESACIPLPSEIIM
                     PFAGYLVSTGRFSLIWVATAGAIGCNVGSILAYEVGKHGGRPFVERYGKYVLLNMHDL
                     ALAERFFARWGSATVLICRLLPFVRSFIAFPAGVARMPLLKFHLYTFVGSWPWCFGLA
                     WVGMKLGAAWHTDPRLGKILHGADAVVVAALAIGIGFVIWHKTRQNRG"
     gene            138895..139587
                     /locus_tag="HL653_00590"
     CDS             138895..139587
                     /locus_tag="HL653_00590"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020702780.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PEP-CTERM sorting domain-containing protein"
                     /protein_id="QJU60368.1"
                     /translation="MSNSDNSVQYVSNWVNTTDGSYTGYNFIVKGNDGTTAGGIKNNG
                     GNSLYFWGKYSDASNAASNGFTNSASIGGSGGNYLAADGAFQTALIYQVITGLTAGQQ
                     YDLTFNWAGAQQHGYSGTTTDNWTAYFGTSTSNYQSYTTDTLTNVDHGFTGWQKASTT
                     FTATSSTQILAFLAKGTPDGQPPFSLLDDVSLTEHVAAVPEPATWAMFIGGFGLVGGA
                     MRRRRTVATLAA"
     gene            139611..140414
                     /locus_tag="HL653_00595"
     CDS             139611..140414
                     /locus_tag="HL653_00595"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020703227.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sterol desaturase family protein"
                     /protein_id="QJU56479.1"
                     /translation="MSLHGLVVDTLRLTLWLALLAAILVPVERFLELRPSVRTARRTL
                     ADLGFYFFNSLIPAFLLGFPVAALAATAHRLLPAAYFDGLNALPLWVQLVATFVVGEI
                     GFYWGHRWSHQIPALWHFHALHHRPEQLDWLVNTRAHPVDIVFGRLCGLAPIYLIGLA
                     GRGAGEGNLPAILFAIGGTIWGFLIHANIRWAPRWLEPILSTPRFHHWHHVKGGSGPI
                     DRNFASMLPVVDRLFGTLHMPEGKAWPEAYGVEETVPARPAPKASAVSA"
     gene            complement(140900..142255)
                     /locus_tag="HL653_00600"
     CDS             complement(140900..142255)
                     /locus_tag="HL653_00600"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015456996.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DEAD/DEAH box helicase"
                     /protein_id="QJU56480.1"
                     /translation="MTDFTSLGLAAPILDALAAKGYTNPTPIQQKAIPVVIEGRDLCG
                     IAQTGTGKTAAFALPSLHRLSANPKPRRPKACRMLVLSPTRELASQIADSFELYGKNL
                     KLSVATIFGGVPIPRQIKQLATGIDIVVATPGRLLDLIDQHALSLRDVEILVLDEADQ
                     MLDLGFIHALKRIHRLLPTKRQTLFFSATMPKTIADLGDSFLTDPIKVSVAPPSTTAE
                     RVEQRAIFVNQAEKQALLTMRLKSDPIDRALVFTRTKHGADRVVKHLAAAGISANAIH
                     GNKSQPQRERALAEFRSGQSPILVATDIAARGIDVGGVSHVYNFELPNVPEQYVHRIG
                     RTARAGADGVAISFIADDEKPYMRSIEKLTRVKPAIDALPENFLQEMARLPKPKADER
                     PARPQGQRPQGQGQRRHDGERSGGGERPAGGPRRRRPGGGGGGARVGAHKGAVRRTGD
                     R"
     gene            142560..143876
                     /locus_tag="HL653_00605"
     CDS             142560..143876
                     /locus_tag="HL653_00605"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014074936.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="M20/M25/M40 family metallo-hydrolase"
                     /protein_id="QJU56481.1"
                     /translation="MRYLAFPLFAALLSSTPALAALSPPERKMVASVDAHTEGDIALL
                     GRMVDLNSGSRNFAGVKAMADLMRAELEPLGFTVSWTPMEQVTGRAGHLIAEHKGSGR
                     GSHMLLIGHMDTVFEKDSPFQTMTRKGDIVTGPGVDDMKGGLVVMIAALRAMKDAGTL
                     KAADIHIILSGDEESVGQPQHKARAAMIEQAKWADTAFEFEGLANEGGEEIGSIARRG
                     SISWRLSASAKSGHSSGVFSDGAGFGANYELVRIVDAFRRELREPNLTYNLGLILGGV
                     DVTATPTDTIAGSARGKPNIIAAQAIATGDIRALSNEQAERIMSRMRAIVAQHLAGTS
                     AEIVFSEGYPAMPPTPGSRALLGKLNGVNADLGLPKMAELDPMKRGAGDIAFAAPYTD
                     GLVGTGIAGAGSHAEGETASLSSMGRQAKRNAILFSRLAVAPRKAK"
     gene            144071..144640
                     /locus_tag="HL653_00610"
     CDS             144071..144640
                     /locus_tag="HL653_00610"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015456999.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NifU family protein"
                     /protein_id="QJU56482.1"
                     /translation="MLIETEPTPNPATVKFLPGRTVMEAGTRDFADPESAEASPLAQA
                     LFDLGDVSSVFFGRDFVSVTAGEGVEWRELKPRVLGVLLDHFSGQIPLFRPGSAGDIL
                     IDDEILTDDPADADIVSQIKDLLETRIRPAVARDGGDIVYRGFDRGVVYLAMQGACSG
                     CPSSTATLKQGIEQLLKHYVPEVTDVRAA"
     gene            144680..145270
                     /locus_tag="HL653_00615"
     CDS             144680..145270
                     /locus_tag="HL653_00615"
                     /EC_number="1.1.1.298"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019831453.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malonic semialdehyde reductase"
                     /protein_id="QJU56483.1"
                     /translation="MIDPLEDAALDRVFRTARTYNGYTDEPVTQDELRQIYELLKWGP
                     TSANQSPLRIVWCTSDEAKEKLASACSAQNAPKVRKAPVTAILGMDMEFYEKLPTLFP
                     HTDARAWFVGNEALIQESAFRNSTLQGAYFIIAARALGFDTGPMSGFDRAKVDELFFA
                     GTPVKTNFISTLGHGDPASIFHRLPRLDFEDATRYA"
     gene            145274..145882
                     /gene="tsaB"
                     /locus_tag="HL653_00620"
     CDS             145274..145882
                     /gene="tsaB"
                     /locus_tag="HL653_00620"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007406989.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA
                     (adenosine(37)-N6)-threonylcarbamoyltransferase complex
                     dimerization subunit type 1 TsaB"
                     /protein_id="QJU56484.1"
                     /translation="MTILVIETATAACSAALLAEGAVVEGAHEVVGRGHAERLVPMIS
                     ELLGPGGRADRVLVDCGPGSFTGVRVGLAAARAFGLGWSVPVAGFSSLALLAAMAAAE
                     ETIAVAIPGGHGELFVQSFAPNPIRPTSDLVSLKPADAAAAFSETIVVGPGAAALVEA
                     RGWGEARDMLPDASAAVRLSPELADLPPTPIYGRAPDAKLPA"
     gene            145879..146370
                     /locus_tag="HL653_00625"
     CDS             145879..146370
                     /locus_tag="HL653_00625"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019517063.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="QJU56485.1"
                     /translation="MTPPVIAPGSTAEIEAVMRIMDSAFDPAFGEAWNRGQVLGILSL
                     SDVWLILATPEGELLPEGFALARQTIDEAELLLLAVRPEARMRGIGRALVEAVADEAR
                     GRGALRLMLEMRDGNPALALYSAAGFGQIGRRRDYYRGRDRSVHDAITLARPLGIDPN
                     LVG"
     gene            146483..146905
                     /locus_tag="HL653_00630"
     CDS             146483..146905
                     /locus_tag="HL653_00630"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017184208.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional repressor"
                     /protein_id="QJU56486.1"
                     /translation="MNRKIDVEALCAEKGLRITDQRRTIARVLSESEDHPDVEALHER
                     AAAIDAGISIATVYRTVRLFEEAGILERHEFGDGRARYEAAADGHHDHLIDVESGRVI
                     EFIDADIEMLQRKIAEKLGFRLVDHRMELYGVPLDRQS"
     gene            146915..147622
                     /locus_tag="HL653_00635"
     CDS             146915..147622
                     /locus_tag="HL653_00635"
                     /inference="COORDINATES: protein motif:HMM:NF013702.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
                     /protein_id="QJU56487.1"
                     /translation="MTIRAYLRLFAAALILAVCFIGFSIARLVGRQNAWVPRFLRVIG
                     HLVGLRVTIEGKPAGRDVLYVANHISWLDILAIGGTAPVRFIAKDQIAHWPLVGKLAK
                     LGGTVFVARERRGATREQADTVVTALGEGRPVMLFAEGGTGDGSIVRPFRAALFASAV
                     ESGKPVQPVAIDYGPDRMRYAWPPGMSFADEARRMLNRAEPVPVTLRFLPPLDPRMLD
                     RKTLAARSQDAIAGALS"
     gene            complement(147738..148490)
                     /locus_tag="HL653_00640"
     CDS             complement(147738..148490)
                     /locus_tag="HL653_00640"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010160957.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin-dependent oxidoreductase"
                     /protein_id="QJU56488.1"
                     /translation="MNGRLTRRGLIVGAGGALVAGCDRIGKSAVAKTTFKGAEALTMS
                     AQRLVTDRAALAPEFGAGDISPIFRSNGNATPGTPEYARLLAGNFRDWRLEVGGLVDR
                     PLMLSLDDLFAMPKRTQTTRHDCVEGWSAIGRWTGVPLRFVLQRAGLRASARYIVFSC
                     YDSFGGAPYYESIDLVDALHPQTILAWGLNGHRLPVPNGAPLRLRVERQLGYKHAKFL
                     RSIEAVASLDGIGHGGGGTWEDVGDYAWYAGI"
     gene            complement(148487..149293)
                     /locus_tag="HL653_00645"
     CDS             complement(148487..149293)
                     /locus_tag="HL653_00645"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007013012.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56489.1"
                     /translation="MSKARGKLVYRHRLPTRLWHWLNALTIFILLMSGLMIFNAHPRL
                     YWGAYGANRDHAWLTIRGNQAIGQLTIGSVAIPTTGVLGHWKDQQGRIQTRAFPYWAT
                     IPSRYSLAGARRWHLTFAWLLIGGGCAFVVASLINRHFVRDLRPRREELAPRHIWRDI
                     KDHARLRFPTGEAATRYNILQKASYIFVIFLAIPLMILTGLTMGPGFDTTMPWLLDLF
                     GGRQSARSIHFLCAMALAAFIGVHLVMVVLAGPYNEVRSMVTGWFRLRER"
     gene            149434..149808
                     /locus_tag="HL653_00650"
     CDS             149434..149808
                     /locus_tag="HL653_00650"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010337978.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MerC domain-containing protein"
                     /protein_id="QJU56490.1"
                     /translation="MTKRSDLVESMAIAAAAACLAHCVALPVLIAALPALASVIPVPT
                     AFHIAALIFAVPTTLFALGIGYRHHRRAFPLIAGLAGLALLAIAVIVYERTPGEAPVT
                     MAGSLLIVAAHLSNWRMRRHPA"
     gene            complement(149951..150367)
                     /locus_tag="HL653_00655"
     CDS             complement(149951..150367)
                     /locus_tag="HL653_00655"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56491.1"
                     /translation="MKISKIERSKLANSGDTYKALLASDADWFVRTADDLRQLRTEDK
                     EGGLAKLSDDVFERFVASCTFANGGIAGGKTAILTTELGLKSIFEIFNRFGADDVLIL
                     SWQERDCDPNTHHCTWDFTSFCSDTTCKPIIVAADS"
     gene            complement(150471..150578)
                     /locus_tag="HL653_00660"
                     /pseudo
     CDS             complement(150471..150578)
                     /locus_tag="HL653_00660"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010125059.1"
                     /note="incomplete; partial on complete genome; missing
                     N-terminus; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="PEPxxWA-CTERM sorting domain-containing protein"
     gene            151345..152157
                     /locus_tag="HL653_00665"
     CDS             151345..152157
                     /locus_tag="HL653_00665"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011542499.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CoA ester lyase"
                     /protein_id="QJU56492.1"
                     /translation="MIDLTAIRSALFLPASNARAIAKARTVPADLVILDLEDAVAEDA
                     KADARGAAIAAAAEGGFAGLLAVRINGTGADWHDADVAALADASGVDLVVLPKAEDAI
                     TCRALAAALGKPLLAMIETPGAVLNAPHIAWTEGVAGLIAGSNDLAASLRLPPGAPRA
                     SLTLALQTIILAARAAGIVALDGVWNRLDDADGFAAECTDGRMLGFDGKTLIHPSQIE
                     PCNRLFSPDAAEVEDAEALIAAATGGAERFRGRMIETLHVEAAKRLLARAGR"
     gene            152424..153881
                     /gene="guaB"
                     /locus_tag="HL653_00670"
     CDS             152424..153881
                     /gene="guaB"
                     /locus_tag="HL653_00670"
                     /EC_number="1.1.1.205"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007685762.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IMP dehydrogenase"
                     /protein_id="QJU56493.1"
                     /translation="MIELGLTFDDVLLRPGASDVLPTDADTRTFVTRDIALNIPVLSA
                     AMDTVTEADMAIVMAQLGGLGVLHRNLEVDEQAAAVRAVKRFEAGMVVNPITVHPNET
                     LADVLALMQRHRISGIPVTELDGKLVGIVTNRDVRFAERPDQPVRELMTHQNLATVHA
                     GVNSEEARRLLHQRRIEKLLVVDDAYRCVGLITVKDIEKAVTYPSATKDGSGRLRVAA
                     ATTVGDKGFARTEALIDAECDLIVIDTAHGHNRDVARAVERVKRISNSVQVIAGNVAT
                     GEATRALIDAGADGIKVGIGPGSICTTRVVAGVGVPQLTAVMESAEEAWKSGIPVIAD
                     GGLRTSGDLAKALAAGASVVMVGSLLAGTDEAPGETFLYQGRAFKSYRGMGSVGAMGR
                     GSADRYFQGEVKDQLKLVPEGIEGQVAYKGPAKDVIHQLVGGVKAAMGYTGSATLKDL
                     REKARFVRITNAGLRESHVHDVSITREAPNYPSMG"
     gene            154065..155243
                     /locus_tag="HL653_00675"
     CDS             154065..155243
                     /locus_tag="HL653_00675"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017978851.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RsmB/NOP family class I SAM-dependent RNA
                     methyltransferase"
                     /protein_id="QJU56494.1"
                     /translation="MNPAARVQAGIEILDEVIAAARSGGAAADTIVARYFATRRYAGS
                     KDRRAVRDWVFAAIRRAGEIPASGRAAMIGLAGERDDLALLFDGSPRGPTPIAPDEPA
                     APAAPLPAWLADKLVPVIGAEELPALLARAPLDLRANRLKTDRATLLARLPETEPGHL
                     APDAFRLPEGTRVEAMEAWHEGLFEVQDEGSQVLAEAVRAQPGETVVDLCAGAGGKTL
                     ALAAAMANRGRLIASDVDRARLSRLAPRKERAGASMIEELLLDSGHEDRALGPLAGQA
                     DAVLVDAPCSGSGTWRRNPEARWRLTPDRLARLTGMQAHVLALGATLVKPGGRLVYAV
                     CSLLPDEGPDRIAAFLGAAPSWTPEQLPLGRPSGAGVMLTPACEGTDGFFVASLIRAC
                     "
     gene            155276..155803
                     /locus_tag="HL653_00680"
     CDS             155276..155803
                     /locus_tag="HL653_00680"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010124376.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tetratricopeptide repeat protein"
                     /protein_id="QJU56495.1"
                     /translation="MRFSPAAVAMAFVLATVSSSVESQKPDDQIDPRSVALVTRADAA
                     RAAGQLEQAQDMLETALAIDPRNRGAYIAMGRVATAQTLPGKAVRFYREALAIDPNDV
                     SALSGQGVAMVERGAVERAKDNLAKVRTLCKAECPQAATLAAAIAKGPPPAVVTAQNN
                     TVVPPKDKADEKAKP"
     gene            complement(155984..157555)
                     /gene="purH"
                     /locus_tag="HL653_00685"
     CDS             complement(155984..157555)
                     /gene="purH"
                     /locus_tag="HL653_00685"
                     /EC_number="2.1.2.3"
                     /EC_number="3.5.4.10"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007686983.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional
                     phosphoribosylaminoimidazolecarboxamide
                     formyltransferase/IMP cyclohydrolase"
                     /protein_id="QJU56496.1"
                     /translation="MTDITIRRALLSVSDKTGLADLGKALAARGVELVSTGGTAKALR
                     EAGLEVRDVSDLTGFPEMMDGRVKTLHPMVHGGLLAVRDDAEHAKAMADHGIGAIDLV
                     VVNLYPFQQTVAKGAERDEVIENIDIGGPSMVRSAAKNHAYVAIVTDPADYALVASGS
                     TTIADRKSLAAKAFASTAAYDAAISGWFAQVDQGEDFPASLSIPMTKKAEVRYGENPH
                     QMGALYVPAGVRTQGIAAAVQLQGKELSYNNYNDADAALELVSEFRDGPPTVVIVKHA
                     NPCGVATGATLVEAYEAALACDSVSAFGGIIAVNRPLDGPTAEAISGIFTEVVAAPDA
                     DEAAKAVFAKKKNLRLLLTGDLPDPARKEKTIKSIAGGFLVQSRDFGMVAKADLKVVT
                     QRAPTDAELADCLFAWTVAKHVKSNAIVYAKGGSTAGVGAGQMNRLESARIAAWKAKD
                     AADKAGWAEPRTIGSAVASDAFFPFADGLLAAVEAGATAVIQPGGSIRDAEVIEAADA
                     AGLAMVFTGMRHFRH"
     gene            complement(157640..158323)
                     /locus_tag="HL653_00690"
     CDS             complement(157640..158323)
                     /locus_tag="HL653_00690"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010124207.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fe2+-dependent dioxygenase"
                     /protein_id="QJU56497.1"
                     /translation="MMIVVPGVLDGAALVRCRTLLDEGPWIDGNATSGHQSALAKRNR
                     QLPEGSPAANEIGNMILDALGRSPLFIAAALPARVFPPLINAYGVGDTFATHVDNAVR
                     IRRADDFRVRSDLSATVFLNDPSDYDGGELTVEDNYGAHSVKLPAGDMILYPASSLHS
                     VTPITRGERRASFFWIQSMIRDDAARTTLFDLDGAIQTVAADRGHGDDAVIRLTGVYH
                     NLLRRWAEV"
     gene            complement(158334..159086)
                     /locus_tag="HL653_00695"
     CDS             complement(158334..159086)
                     /locus_tag="HL653_00695"
                     /inference="COORDINATES: protein motif:HMM:NF015506.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="energy transducer TonB"
                     /protein_id="QJU56498.1"
                     /translation="MIQAGYVRTTERRSMRTAPVTSPSPEPEVLARAGGGFCDQQRRP
                     RWEAMGLILALHIVGFVLLAYFDVIQIGHKAKPRLTVIEIQPEPIVPESPPAPPQASK
                     TPPPPVEQPIVAPPPIVQTIALPSPVATTPVAVAPPPPVVSAAPPSAVVSEAAAPVSA
                     PDGSAKSLGNPAPKYPMDARRNRWEGTVRLRVVITPEGLVKDISVARSSGFDSLDQAA
                     LKTVGKWRFLPGKQAGVAVEAVGFLSIPFRLT"
     gene            complement(159360..161690)
                     /locus_tag="HL653_00700"
     CDS             complement(159360..161690)
                     /locus_tag="HL653_00700"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004212116.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent siderophore receptor"
                     /protein_id="QJU56499.1"
                     /translation="MRSHQHARPGSAFLALSCVGLFATPTALQAQKTPEEKGQELEGV
                     TVTDTAVSDDVKVGKLESPKYTRDLLNIPQTITVIGNTTIRQQNLLSLRDALQTIPGI
                     TFGAGEGGGGYGDSINLRGQSVNNDLQIDGVRDSAQYTRSDTFNLEQIEVVNGANSVY
                     GGGGSISGTINLVTKRPKDGNLTVVQGAVGTDDYFRGTVDSNMKVSDTVAIRLNAMGH
                     RNDIPRRDVEYMHRWGIAPSITVGLNTATRFTVLYSHQEDHNIPVYGVPYYASLGGLL
                     PGASYSGYYGYKDVDRQKQQTDVGTVIIEHDFTDKIALRNLSRWQRVEADSIVNPPQG
                     TYCLTSGLTTAGAACAAGLQPGMFYPSGPRGTARYTTTKNLFTQFDLRGVFETFGLEH
                     TANLGASIGRETYHISNGNVLRNAGGATPNPTLPPINIANPNPVYGGPINYVPSAASQ
                     GKLVTKAIYLFDAIKLVEKLELNGGVRYEGFDNTFRSDTVVATPGATFGQVTRGANQK
                     SDDGLFSYRVGLVYKPIANASLYIAYGNSKTPVSSTVRAGCGTIAAGAPNVDPCQAKP
                     QTAVNYEIGGKIDLMDAKLQLTASVFRNERTNFSVQSFDPAFPTLQVNDGRSRVNGIS
                     LGASGKITPNWSIFANYTYLNTKILQSISDLCRDRPTTTGCSIDAQAGAVINQTPKNA
                     GSLFTTYTLPFGLQVGYGFTYQGDYNLNNTGVTYRSKDYLIHRAMLSYPIVGGLTAQV
                     NIQNFTNKKYYSGIRNNGWAVPGEGRQAILSLFYSF"
     gene            complement(161883..162104)
                     /locus_tag="HL653_00705"
     CDS             complement(161883..162104)
                     /locus_tag="HL653_00705"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012050774.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribbon-helix-helix domain-containing protein"
                     /protein_id="QJU60369.1"
                     /translation="MEGPIKRSVMIAGHATSVTLEPIFWNALREAAAEDQLPLSALVA
                     RIDAERVGGEAAVNLASAIRVWLFRRALL"
     gene            complement(162131..162853)
                     /gene="phbB"
                     /locus_tag="HL653_00710"
     CDS             complement(162131..162853)
                     /gene="phbB"
                     /locus_tag="HL653_00710"
                     /EC_number="1.1.1.36"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010161447.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetoacetyl-CoA reductase"
                     /protein_id="QJU56500.1"
                     /translation="MARVAIVTGGTRGIGEAISLALKAEGVTVAANYAGNDERAKEFS
                     DRTGIPAFKWDVADPEACAAGVAQVEAALGPVDIVVNNAGITRDATMLKQSYDEWKAV
                     IDTNLGGCFNMAKATFKGMKDRGWGRFVNIGSINGQAGQYGQVNYAAAKSGIHGFTKA
                     LAQEGARFGITVNAIAPGYIDTDMVAAVPADVLAKIVAKIPVGRLGKAHEIARGVTFL
                     CSDDGGFVTGSTLSINGGQHMY"
     gene            complement(162892..163896)
                     /locus_tag="HL653_00715"
     CDS             complement(162892..163896)
                     /locus_tag="HL653_00715"
                     /EC_number="4.99.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010185012.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferrochelatase"
                     /protein_id="QJU56501.1"
                     /translation="MKPAGHPDIPAPKVGVLLINLGTPDAAEPKAVKRYLKEFLSDRR
                     VVELPPLLWQPILRGVVLTTRPAKSAHAYRQVWTEQGSPLAAITRAQAEALAPRLAGQ
                     GVVVDHAMRYGHPAIADRIAAMKAAGCERILLAPLYPQYSGATTATANDAAFAALAKM
                     RWQPAIRTLPPYHDAPAYIDALADSIRAQVAALPFEADTLVASFHGMPQRTLDLGDPY
                     HCHCRKTARLLGEALGRELTVTFQSRFGKAKWLEPATDVVLGELGRTGRRVAIFAPGF
                     SADCVETLEELAIRGRESFVEAGGKDFAYVSCLNATDGGMKMIEFLVVQELAGWLRAS
                     "
     gene            complement(163893..166127)
                     /locus_tag="HL653_00720"
     CDS             complement(163893..166127)
                     /locus_tag="HL653_00720"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015459347.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="xanthine dehydrogenase family protein
                     molybdopterin-binding subunit"
                     /protein_id="QJU60370.1"
                     /translation="MAPPKPSSPPSSPSRGLTRRRLLVGGGAGVGLALAWGIWPRDYA
                     PNLAAGPGETIVNAFLKIGTDGRVTVIVPQAEMGQGVWTALPQILADELGADWRQVGV
                     EPAPINPVYANTLLIADAAAEQLPGFLAGPGRWAAREYATRNALMMTAGSSSIRGFEQ
                     RFREAGAAARVLLCMAAGKRLGADWQACDTEAGFVVRGDDRFRFGELAAEAAGFSPPD
                     PVPLRDPGEGKLSGQSMPRLDLPAKVDGTMRFAGDVRLPQMLFASIRHGPLGDTSVGA
                     IDEKAAHAVPGVVSVVKRQGWVAVLANTTWAADRGADALAAKYQTRGTLPGAVHVAGA
                     LDRALATGGKRLIAIGDAESALGGTPTVAADYTVPLAAHAAIEPLVATARMTGGRVEI
                     WVPTQAQGLTRRAVAQATGYAEDAVTVYPMPVGGGFGRKVENDAAVEAALLAIEAKRP
                     VQLLWTRGEEMQRARHRPPAKARLKAKLTGGRVAAWSATVATPSAMGAMGQRLFGHGG
                     GGGPELAAIEGAQPPYAIPAVAVAHAPAEIGIETGMWRSVAHSYTAFFSESFMDELAA
                     AANSDALSFRMAQLGGNPRLARCLTRVTAAGGWAGEAESGQGLAIHSAFGSHIALLAE
                     AGVEDDAIRVSRLVASVDCGRIINPDIVRQQIEGGLVWGLAAALGGAVSYTAGVVDQR
                     SLAALNLPKLADIPDIVVELVPSKEVPGGVAELAVPVVAPAIANAIASATGKRLRALP
                     LVLA"
     gene            complement(166175..167095)
                     /locus_tag="HL653_00725"
     CDS             complement(166175..167095)
                     /locus_tag="HL653_00725"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016745934.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine acetyltransferase"
                     /protein_id="QJU56502.1"
                     /translation="MGVEPSLQMGSYWELGEVLAGLREVRTKWRDAHPRNREHGSANF
                     PARRTLEEVMSILCGVLFPLRLGPSYVRADNEEAYVAETLENGLSHLYGQIRRELAYS
                     APTGGTEEAIDAGARRIIGAFAHALPSIRAALDSDVEAAFAQDPAARSVDEVLLCYPS
                     LLAIIHYRIAARLHRLGAPLVARIIAEIAHSETGIDIHPGAAIGHSFFIDHGTGLVIG
                     ETAEIGHHVRLHQSVTLGGPAGPLEEGRGRPRHPVIGDDVIIYAGATLLGRITVGAGS
                     VIGGNVWLTDDVPPGSRVEQAVAVRGIDAA"
     gene            167242..168612
                     /locus_tag="HL653_00730"
     CDS             167242..168612
                     /locus_tag="HL653_00730"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017501454.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid carrier protein"
                     /protein_id="QJU56503.1"
                     /translation="MDAFARFIDALSAIVFFKIHFGSIQIEAIVLYLALPMLFFTLWL
                     GFPNLRLVGRGLAQLRRQPGEAEAKGDTSQFGALATALAGTIGLGNIAGVAVALTMGG
                     PGAIFWMFVIGWFAMTVKMVEVTLGLKYRITDADGHVHGGPMYVLREVLRRRGWPRLG
                     VAIGGCYAFFALFGAIPMVQVNQSFAQVSTVTGFANGWAYGIFIAAAVACVTLGGATW
                     LGEVSKRLTPAKVAIYLAGLCAILILHADAIPAALAQIWHGAWGADAAQGGAVGAFVS
                     GMRRAVFASEAGVGSAVMAHSLAKTDEPVSEGLVALLEPLLGTMLVCSLGGLALVVAG
                     TWTGGLQGIAIMSAAFAQISPWFPYLLAVVVFLFAYSTLVAWGFYGLQAWGYLFGNGQ
                     RAQMIYKVLYVAALPPAAAIDLGHVIGIVDCSFFLMAIPNVIALFLCAGEMRRDLRAF
                     EASDAR"
     gene            168845..169843
                     /gene="bla"
                     /locus_tag="HL653_00735"
     CDS             168845..169843
                     /gene="bla"
                     /locus_tag="HL653_00735"
                     /inference="COORDINATES: protein motif:HMM:NF033103.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class A beta-lactamase"
                     /protein_id="QJU56504.1"
                     /translation="MKRLLWAAVTVAMLGIPVTGGAETPEETRLAPPSTARNLPTLAM
                     LRTKLDAEASSGKARVGLAAIDISTGDMVSVNGDQHFPMASTVKVAIAAAFLHGVQQG
                     RLSLDAMYRLPPAQRQAARGLGDMRLHGRPLSGAELMDLMLIRSDNAAADTLLYAIGG
                     TRALGTWLDNAGIAGQRVDRSIAELLRDHETKKRIRVGKGKRRRWITVSVPRAAPVGD
                     KRDSSTPEAMVALLAKLRNGELLDARRTTYLFDVMERCRTGPGRIRGLLPAGTRVAHK
                     TGTMNGITDDVGIVTLPNGHDLAVAIFETGSGGSRAHDRKIAQLSRILYDHFSATS"
     gene            170050..171945
                     /locus_tag="HL653_00740"
     CDS             170050..171945
                     /locus_tag="HL653_00740"
                     /inference="COORDINATES: protein motif:HMM:TIGR01686.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HAD-IIIC family phosphatase"
                     /protein_id="QJU56505.1"
                     /translation="MSEYASLKIFEATAAIKLVVWDMDDTFWHGTLSEGGVTLIDRNI
                     SIVRELVDRGIMSSISSKNEHEAVKQVLADAGIWDLFVFPQISWNAKGGALETIINHA
                     NLRADNILFVDDNPINLEEIRFRFPTMMVAHPDEVLEGLLDLPQAKGKDDRKHSRLEQ
                     YKNLEKKVSEQTGTTLSNEDFLRQCEVKLSFDFDVEAHFDRIVELVNRSNQLNYTKVR
                     LETDEAIADFRAKLQRHDIMSAAISARDRYGDHGMIGFYMQHKDERQNRLIHYVWSCR
                     MMNAGLEQYVYERIGSPDITVAEPVSNPIVTFPKIDWIEEVAANDDGGASALAAQQLL
                     LIGSCDLSAVASYCSRDRREYVNAVKNDIMTRCDDFGFILNDPAKVAASSVIETLPAW
                     GRDEFLDFHRELPQRDVVIISLSAALRGAHLVTSDDVVVRVHPNGLGEHIDAHPWEEF
                     LAPCSFYGLDLTQKLALLNESFDHVRRTAKPGAQIFVLGANTRDAAMPLSATDRELMT
                     TYNAVCEAYCAPLADWHYVSIDAVVPKEQLVDDRHYTRIGYFAIATDINRRIAEAAPA
                     IEAAGEAPHAAAASGRPFDLVKAIRAGQRLSRFTVFGPERKDQGMIALSRRVLNRSLK
                     RVVAAVR"
     gene            complement(172085..173278)
                     /locus_tag="HL653_00745"
     CDS             complement(172085..173278)
                     /locus_tag="HL653_00745"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012286448.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56506.1"
                     /translation="MRIGFLFNHDQVHQVAHSLPIALALARQGTGAEIILATTNPRMQ
                     AEVTRLAAGAIGRGVTLQPLTLKSRRSKIIAGVSEYIAPAAKLLIYGDNLDFFRSLDV
                     LVVAEKTSLILKTRYGLDHLKMVHTRHGAGDRAIGFDPASALFDQVLVSGPKIRDRLV
                     NEAKVPCDRVSIVGYPKFDMAEPARAHGLIDDDRPIVLYNPHVSPHLSSWYKMGRQVL
                     DWFVEHEEYQLIFAPHVMLYERPFVLTIDKLRIDRAGPIDQRYLRAPNIHIDLGSRAS
                     TTMAYTNRADIYLGDVSSQVYEFLYRPRPCVFLNAHKVAWRGDANFAHWAAGPVIDRV
                     ADLGAALATARSEQTDLYRPVQERLFRYSFDLRDTPSSDRAAKAIAEVAGIPWPEPQR
                     AFAMA"
     gene            complement(173470..174654)
                     /locus_tag="HL653_00750"
     CDS             complement(173470..174654)
                     /locus_tag="HL653_00750"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018075255.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase"
                     /protein_id="QJU56507.1"
                     /translation="MRIVDICAFYAPRGGGVKTYVERKLQAARPGEQEIIIVAPGDRD
                     GVVMEAPAGRIISIAAPRFPLDRRYHYFDDEPRLHALLDRLRPDVVEASSPWSSPAMV
                     ARWRGPALRSLVMHADPLSAYAYRWFGPVASRRTIDRGFDWFWRHLRRLDDGFDLVVS
                     ASAGLSARLRDGGLRKVATVPMGVTPGVFSPDRRDEALRAELLARCGLRPDATLLIGL
                     GRHAPEKRWPMVIEAVTGAGYANPVGLVVLGEGRDRTRVIRATRSNPHIYLGRPETDR
                     QRLATILASADALVHGCEAETFCMVAAEAKASGLPLIVPDQGGASDQFVEGQGARYRA
                     CSTTSLAEAIRRFAATMPAHQRAEASRDAAGVMTMDAHFERLFATYAEALAMRTGLRD
                     AA"
     gene            complement(174657..175163)
                     /locus_tag="HL653_00755"
     CDS             complement(174657..175163)
                     /locus_tag="HL653_00755"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008828717.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2141 domain-containing protein"
                     /protein_id="QJU56508.1"
                     /translation="MIAALLLLASQAIASSPDLGKAEGRCRANEPGPAFLVSVIGLRD
                     RVGLLKLELYPANDPDFLADDNVLLNAGKAFRRVEMPVPAAGPALLCIRAPAPGPYAL
                     SLLHDRNGNHRFDLSEDGIGFSANPKLGLSRPAAADATVHAEARPTKLTIVLNYRRGL
                     FSFGPVGG"
     gene            complement(175160..175984)
                     /locus_tag="HL653_00760"
                     /pseudo
     CDS             complement(175160..175984)
                     /locus_tag="HL653_00760"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008828754.1"
                     /note="incomplete; partial on complete genome; missing
                     N-terminus; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(176176..177324)
                     /locus_tag="HL653_00765"
     CDS             complement(176176..177324)
                     /locus_tag="HL653_00765"
                     /inference="COORDINATES: protein
                     motif:HMM:NF012744.1,HMM:NF024831.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase"
                     /protein_id="QJU56509.1"
                     /translation="MRILTFLHSYEPGGVERIALRLVREWRARGIDAPLFVGRADGTM
                     RDDVGAGLAPIIPPPPRNGLDPARWEAIWMILTLPRVVREQQPDVLFCAGNTYAVIAI
                     ALKLLLGPACPPIVAKISNDLRRRDKPWWRRMLYRFYLRVQGRLFDRVIGMEASAVDE
                     ICEMLAVHRDRITVIPDPALSHAMIATLRDAPARPMEGGRRFVAVGRLARQKNLPLML
                     RAFARGAAPEDRLALIGEGPERPRLEALAAELGIAGRVSFPGYHPEPATILCGHDVLL
                     LSSDYEGVPAVVIEALAARLPIVATDCSASMGALLLGGRLGDLVPVRDEALFAGAIAR
                     AVPSRQDAALTLRQAERFTIERASDLYLAVMRGSLRRVAKERMPLPVS"
     gene            complement(177324..178091)
                     /locus_tag="HL653_00770"
     CDS             complement(177324..178091)
                     /locus_tag="HL653_00770"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007406529.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2334 domain-containing protein"
                     /protein_id="QJU60371.1"
                     /translation="MPEHAARPEKRLLLSIHDVGPRFESEVSRLLDLLGRHARRDRIA
                     LLVVPDHWGEAPIRAGSPFAATLRRWAEGGTDIFVHGWFHRDTQDHASPVARLKARHM
                     TAGEGEFLGLDRQTAGRRMRDGRALLEDITGRPVAGFVAPAWLYGEGAMEALGDCGFA
                     VAEDHWKVWSPQNGETLCRGPVLTWASRSRMRIASSLVAAAALPPVLRRMPVARLAVH
                     PGDLGVPALVSSIDRSLARLVRSHRPTRYSELGLSLT"
     gene            178311..179375
                     /locus_tag="HL653_00775"
     CDS             178311..179375
                     /locus_tag="HL653_00775"
                     /inference="COORDINATES: protein motif:HMM:NF015338.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease/exonuclease/phosphatase"
                     /protein_id="QJU56510.1"
                     /translation="MKILVRSALALACLSLLGTTWSWARRDDTYLPAASPSGPGTVSV
                     LTYNVHGAPWPITFGRSAKLRQIADRLQRLRAEGRAPGVIVLQEAFSGDAQVIRKTAG
                     YAYTAVGAGKDEAGAGTMTPFDQVFADGARWWKGETEGKLVGSGLQILSDYPILAVHR
                     MAFPAFACAGWDCLANKGALMVTLAVPGGPPVDVVTTHLNSRHASAVPDARSNYAYGR
                     QVEMLTAFIRAKHDRAHPLIVAGDFNVGPVPPRREALLTEARNWAGDETIRDAMHEYR
                     RDGGRMSADAAFSFHRARDWQFYAAGTTRRIGLLGIEVPFGFEPSGGMLSDHVGYVAR
                     YRLDTPAATALATTSGRAKA"
     gene            complement(179347..181704)
                     /locus_tag="HL653_00780"
     CDS             complement(179347..181704)
                     /locus_tag="HL653_00780"
                     /inference="COORDINATES: protein
                     motif:HMM:NF012801.1,HMM:NF019335.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent receptor"
                     /protein_id="QJU56511.1"
                     /translation="MAASCACWIPPLASLLVTAPAAAAPADDLPFDIAAGTVAASMSA
                     ISDKAGVSIGWTAADASVRTRAVKGRMPVADALRAALHGSGLRAVPGGSGTFRIEHAQ
                     PFPLIGRRRPIDRPVVAGGGPPPDEDPAAPIIVTGQKRRQLLQGIPASLSRVDLADTD
                     AGKVSLASRDLALSMEGLSLTNLGPGRNRPFIRGVADSPFNGNSQSTVAVQLDEARIT
                     FDAPDPDLRLIDMEQVEILKGPQGPLYGSGALGGIYQIVTRKPDLTDIAGAVRLSGEA
                     VQHGGIGGGVEGVLNLPIATDSLAIRAVGYDTREGGWIDNIDGRSNANVTTTRGGRLA
                     LGWAIDPVWMLDVSGAVQDVNSRDTQYVTDDETVQRYARIAEPADNDFREAAATLRGR
                     IGGLDLLATGSYVDQQVDSILDSSDSSADFGLSGASRFVDQRAYSIANGEVRLSPAGS
                     SRWLLGASYLRSTSRDTGTIEGTTQSLTVESLDRVVTEMAIFGEATVPLWRHISATAG
                     ARLYRSVADNEASERHGGTSARFAKFFASPSLSLSWAPSTHHLVYLRYARALRPGGLA
                     AAGEATSRRFDSDELGTFDLGYRGEPIAGMLTLNGSLFHTRWNHIQADYLLSNGLVAT
                     RNAGLARITGAEASADLTPAPRWQISAGATYVRALLVKTEDGSKLDDRRLPVTPNITA
                     RLTARYEFPLAGWTTRLSAQANYIGRARLFFDEDLDRQMGNYATAQTAAFFSRGRLTI
                     GGRIDNLLDIQGDTFAFGNPFSIMAGRQYTPLRPRTFTLSLARSW"
     gene            complement(181664..182620)
                     /locus_tag="HL653_00785"
     CDS             complement(181664..182620)
                     /locus_tag="HL653_00785"
                     /inference="COORDINATES: protein motif:HMM:NF016648.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56512.1"
                     /translation="MSARSEIDERLLDEAIAWHQSLEHEDADWDAYLAWLEADAGHRE
                     AYDEIALLDRAVDDHAPELKRFVDPQPMIASAPERTKRRPWLYGSVAAALAVAVSIPM
                     LRPAAPDIVYSTGAGQTRRVAIGDGISAELAPSTRLVAMTGDPRTLELASGEAYFDVA
                     HDPSRALSIKAGDFKVTDIGTQFGMTMGGESVRVAVAEGNVSVGAADGAPTRVAAGEQ
                     LIALNIDHSATKRTISSKDVGSWRRGRLVYNEAPLSAVAADLSRYSGKTVTVDPALRD
                     RQFSGVIVVGDGSKLFDTLSGLMAISYETHGGVVRLLDPAAR"
     gene            complement(182681..183208)
                     /locus_tag="HL653_00790"
     CDS             complement(182681..183208)
                     /locus_tag="HL653_00790"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010216433.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sigma-70 family RNA polymerase sigma factor"
                     /protein_id="QJU56513.1"
                     /translation="MEQDTSQELAALYGVYRADLLRFLIARTGDRGEAEDLLQELWIK
                     VRQSAGAPVANGRAYLYRIAQNMVVDRLRESQRRSRRERLWSDEATGHQPSGVETADV
                     RRNAEEAILDREEIAQLASAIATLPEGARRAFELHKIEGLSHADVAARLGISKSGVEK
                     HMAVAMKYLRRAMLD"
     gene            complement(183343..183729)
                     /locus_tag="HL653_00795"
     CDS             complement(183343..183729)
                     /locus_tag="HL653_00795"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013054090.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nuclear transport factor 2 family protein"
                     /protein_id="QJU56514.1"
                     /translation="MMTSELEIRAARAGFNRALAEADLGAIGPLLAPDVVLVTGTDSA
                     VISGRKAQLQAWKREFADAARTVYTRTPEAVVVATDHPIAFEQGRWAGIPAAGGEPLA
                     TGTYAAKWRWMAGRWVIEAELFVTIV"
     gene            complement(183726..183926)
                     /locus_tag="HL653_00800"
     CDS             complement(183726..183926)
                     /locus_tag="HL653_00800"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020820702.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56515.1"
                     /translation="MAVIATIMNSTTGQPIQRMSFGRMPKPWASFTLESGERVTADRV
                     DVGKPAPGKVVAPISVWVTPKA"
     gene            complement(184111..185496)
                     /locus_tag="HL653_00805"
     CDS             complement(184111..185496)
                     /locus_tag="HL653_00805"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010406405.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar porter family MFS transporter"
                     /protein_id="QJU56516.1"
                     /translation="MAVVADQGSLPPIKGEEPSLLNPGLLACIATAALAGLLFGFDTA
                     VISGTTESLRTTYALDDFWLGVTVSSALWGTLIGALTAGIPGDRFGSRDTLRVLVLFY
                     VVGGLGCALAWDWTSLVAFRVIAGLAVGGSSVLAPVYIAEVAPPSRRGGLVASFQFMV
                     IFGILAAYVSNAVIASLALGADDWRWKFGVSAAPALIFLLLLLRIPNSPRWLVGKGRR
                     EEAIAAFGRVGMDGARAKQEADAVEVSAGTQPSEGRLSWRRHRKPILLAFMVAGFNQL
                     SGINALLYYLNEIFAKAGGSLSPDVQAIIIGVVNAIFTAVGMLLIDRLGRRTLLLIGS
                     AGMAVCLVVAGLAMTAVAPGWLVLPALIGFIAFFAPSTGAVIWVYISEVFPTSVRGRG
                     SAIGASTHWGFDAVIAAAFPSIAAVSVGLPFFFFAAMMVAQFVIVLAYFPETKGVPLE
                     EMERKLGVVMD"
     gene            185601..187058
                     /gene="xylB"
                     /locus_tag="HL653_00810"
     CDS             185601..187058
                     /gene="xylB"
                     /locus_tag="HL653_00810"
                     /EC_number="2.7.1.17"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017334025.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="xylulokinase"
                     /protein_id="QJU56517.1"
                     /translation="MYLGIDIGTSGVKTVIIDADGRVVGQGHAPLTVSRPHPLWSEQD
                     PAQWAEATDQAVCALDPTLRAAVKGIGLSGQMHGAVTLDAADRVLRPAILWNDGRSGP
                     QCAELLEREPRAHAITGNAILAGFTAPKLLWLAEQEPDIFAATRTVLLPKDWLRLTMT
                     GDKLSDMSDASGTLWLDVAARDWSDEMLAACRLSRAAMPGLVEGSAPGGRLSATTAAR
                     WGMSRVPVAGGGGDNAAGAIGLGVIRPGDAFLSLGTSGVIFSVSDGFRPDVARGVHSF
                     AHAIPDTWHRMSVMLSAAACLDWAAGVLAFADVPALLAAAEDAEPQSKLLFLPYLSGE
                     RSPHADPDAQGVWFGMTGATGRPELARAVLEGVAMGLRDGLDALEAGSERIRSLSLAG
                     GGSRSPLWNRIIAATLNRTLVERESATVGPALGAARLGQLAAGDGDVSAVAATPAEIS
                     RIEPDATLTERMADQQVRFRALYRAVRDLWTGKPS"
     gene            187144..187323
                     /locus_tag="HL653_00815"
     CDS             187144..187323
                     /locus_tag="HL653_00815"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56518.1"
                     /translation="MMVEKEASRERERTAQHLRALTSALRTAYSAEPPPSRSFNADMA
                     SLLDAIDKRDRLERD"
     gene            complement(187320..187544)
                     /locus_tag="HL653_00820"
     CDS             complement(187320..187544)
                     /locus_tag="HL653_00820"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56519.1"
                     /translation="MAEQTARRQEIERLRRRAERHRQVAQGLGSEDDARAAQDEAMAV
                     ELMVARLERELREMVVGAAALRASPVRSSR"
     gene            complement(187721..187810)
                     /locus_tag="HL653_00825"
     tRNA            complement(187721..187810)
                     /locus_tag="HL653_00825"
                     /product="tRNA-Ser"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:complement(187774..187776),aa:Ser,seq:cga)
     gene            187932..188315
                     /gene="hspQ"
                     /locus_tag="HL653_00830"
     CDS             187932..188315
                     /gene="hspQ"
                     /locus_tag="HL653_00830"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010185185.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heat shock protein HspQ"
                     /protein_id="QJU56520.1"
                     /translation="MTLSHRTLTGTTAPLPIMPAISHARFALGDVVRHRLFGFRGVIF
                     DVDPVFANSEEWYASIPEEVRPVKDQPFYHLLAENAESSYVAYVSQQNLEPDGSDEPI
                     DHPAINGLFEPFTDGRYALRREHRH"
     gene            188354..189370
                     /locus_tag="HL653_00835"
     CDS             188354..189370
                     /locus_tag="HL653_00835"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011355082.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="QJU56521.1"
                     /translation="MTRTPAMDGSTGIRIDPRWVPHPDSISAEARAALARQVTHEGLP
                     FNALYPMPAPDDRVAWVALQERVALHYASAGVATAATLRATAETIRIGEAPVYRATPE
                     TLWSEECAFIDLHGGALVFGGGEACRDAARLAADRHGVVCYGVDYRMPPEHPYPAALD
                     DCLAAYRHVLAHHRPENVIVGGRSAGGNLAAALTLRARDEGLPLPAALVLLSPEVDLT
                     ESGDSFETNRMVDVVLPGSLMTANLLYAGGADLTHPYLSPLFGSFAEGFPPTFIQSGT
                     RDLFLSSAVRLHRALRRANVPADLHLFEAMPHGGFGDAPEDRELADEMIRFVRAHWGV
                     AGRG"
     gene            189536..190780
                     /locus_tag="HL653_00840"
     CDS             189536..190780
                     /locus_tag="HL653_00840"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010185087.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="putative DNA modification/repair radical SAM
                     protein"
                     /protein_id="QJU56522.1"
                     /translation="MAQLDTRQKLAILADAAKYDASCASSGTTKRTSLDGKGLGSTEG
                     MGICHAYAPDGRCISLLKILLTNSCIFDCHYCINRKSSNVRRARFTVEEVVQLTLAFY
                     RRNYIEGLFLSSGIIRSSDYTMERIVEVARCLREDHGFRGYIHLKTIPDADPELVHAA
                     GLYADRLSINVELPTLPGLARLAPEKSAARIEGAMGDLKGAIEEGHDARKRFRSAPRF
                     APAGQSTQMIVGADSANDGDIIASASGLYDRFGLRRVYYSAFSPIPDASAILPLKRPP
                     LMREHRLYQSDWMMRFYGFQPAEVAAATDATGMLPLDMDPKLAWALKFRAAFPVDVNR
                     APKEALLRVPGLGTKAVDAILSARRQRRLRLEDVARLTVSIAKIRPFLIAADWTPARI
                     DGAADLAALVKPKVEQMELFAA"
     gene            complement(190931..192052)
                     /locus_tag="HL653_00845"
     CDS             complement(190931..192052)
                     /locus_tag="HL653_00845"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007679607.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADH:flavin oxidoreductase"
                     /protein_id="QJU56523.1"
                     /translation="MSSAAADILFRPFTLRGLTLPNRIVMAPMTRGFAAGGVPGAAQA
                     DYYRKRAEGGVGLILSEGTVIDRPASRNHPGIPFFHGEEALTGWKSVIEAVHAAGGKM
                     GPQIWHTGAVKSFQTDWTPDAPVESPSGLDAPGVERGVAMSDSDIADAVAAYAKAAGD
                     AKRLGFDVAELHGAHGYLIDQFFWAGSNLRDDRHGGSTIAERARFAADVVAAVRAEVG
                     PDFPIIIRLSQWKQQDYAARLAETPAEMAAWLEPLADAGVDIFHCSQRRFWEPEFPTV
                     DGEKGLNFAGWAKKLTGKATISVGSVGLSGEFMAAFGGESSTSVGIDQLIERMERDEF
                     DLIAIGRALISNPDWAAKVRDGDAAGLRGFEVSALGELV"
     gene            192153..192539
                     /locus_tag="HL653_00850"
     CDS             192153..192539
                     /locus_tag="HL653_00850"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008831259.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="QJU56524.1"
                     /translation="MPGCSVPPCDRQRFSVECPSRLLFDQIADKWSMMVLTVLDGGPL
                     RFNAIRRHLEGITQKALTQCLRRLERNGLLSRRVIPASPVGVEYEITPLGRSLQPPFK
                     ALYRWTLDHFDEVEAARLRFDDQPTA"
     gene            192579..193511
                     /locus_tag="HL653_00855"
     CDS             192579..193511
                     /locus_tag="HL653_00855"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013077516.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="QJU56525.1"
                     /translation="MDTILSISGLAKNYKGGHQALKGVDLDIRRGEIFALLGPNGAGK
                     TTLIGAVCGLVQPTAGEIRIDGEDARAHWRKARARIGLVPQELSTDMFEHVEHTVAFS
                     RGLFGKPRNPALIERILRSLSLWEKRDAKIMQLSGGMKRRVLIAKALSHEPDILFLDE
                     PSAGVDVELRREMWAMIGQLRDQGVTIILTTHYIEEAEEMADRIGIIRKGEIILVEEK
                     KALLAALGKTQAAIGLTDPLPAIPAGLADWPLTLSEDGQTLTYTISAEEADARGLAQL
                     VKRLEAEGIDFRTLDTRRSSLEDIFVDLVEGARA"
     gene            193508..194269
                     /locus_tag="HL653_00860"
     CDS             193508..194269
                     /locus_tag="HL653_00860"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010124457.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="QJU56526.1"
                     /translation="MNLPAIRAIYLFELARTWRTLFQSIFTPVLTTSLYFVVFGSAIG
                     GRMHEVNGVPYGAFIIPGLMLLTILSESISNASFGIYLPRFTGTIYELLSAPVGVAET
                     LIGYVGAAATKSIILSLIILATARVFVPYHIVHPFWAVSFLLLITISFCLMGFILGCW
                     ADGFEKLQIVPLMVVTPLTFLGGTFYSIDMLPEPWRTITLFNPIVYLVNSFRWAFYDT
                     ADVDIRLSAALIVAFLAICLGVIAYIFKSGWRLRS"
     gene            complement(194476..196134)
                     /gene="recN"
                     /locus_tag="HL653_00865"
     CDS             complement(194476..196134)
                     /gene="recN"
                     /locus_tag="HL653_00865"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010544337.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein RecN"
                     /protein_id="QJU56527.1"
                     /translation="MLTRLAIRDVVLIEALDLDFGPGLATLTGETGAGKSILLDSLGL
                     ALGARAESGLVRNGAAQASVAASFDLPADHPALAILDEGGLEREPGEPLVIRRQLRAD
                     GGSRAFVNDQPASAGLLRALGGTLVEIHGQHDDRGLLNARGHRALLDAFARSQTGAVA
                     SAHARWKASEEALAHAEAELESAARDREWLEHAVAELRKAAPEPGEEASLAEARADMQ
                     KGARLAEELSGVSGHLDGSDGALAQLRQATRRLDRIAAEDERLAEALAALDRALVEAG
                     EAEDRLAAAGEAFAFDPARLEAIETRLFDLRALARKHRVEPDHLAALTEELSGRLDRI
                     EAGGAGIAALAREVSLSREEYEAAADALTAARTAAAARLDAAVAGELAPLKLDAARFR
                     TVVEPLPEAQWGAAGRDRVEFEIATNPGAPFAPLIKIASGGELSRFILALKVALAEEG
                     GAGTMIFDEVDRGVGGAVASAIGERLARLAQTTQLMVVTHSPQVAARADRHWLIEKRS
                     DGLVARTGVHVLGAAERREEIARMLSGAEITDEARAQADRLLVA"
     gene            complement(196214..197008)
                     /locus_tag="HL653_00870"
     CDS             complement(196214..197008)
                     /locus_tag="HL653_00870"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019832623.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein assembly factor BamD"
                     /protein_id="QJU56528.1"
                     /translation="MRVSALRTIALIGIALSSLSLAGCAGRGGMKKGQDSNRYVARDV
                     DTLYNAARDALDKKQYRMAAALFDEVERQHPYSVWARRSELMSSFAYYLAHSYPESIQ
                     SAQRFLSIHPGNRDAPYALYLIAVDYYEQISDVTRDQKITGQALDAMGELIRRYPDSK
                     YAADARLKIDLINDHLAGKEMEIGRFYQRRGEWLASVIRFRTVIDKFQSSSHTPEALM
                     RLTESYIALGVVDEAKKSAAVLGANYPGTDYYKHAYDLIQRRQRKG"
     gene            complement(197076..197459)
                     /locus_tag="HL653_00875"
     CDS             complement(197076..197459)
                     /locus_tag="HL653_00875"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015458159.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56529.1"
                     /translation="MANLDKTPAAVGPIVTAVGPSGFRVSDRIVPGGLILTPDNAVDW
                     PVASLEALTEADFAFLLALFPLPEFVLLGTGATLRRPAPALTAALEAKGLFLEPMDSR
                     AAARTWGLLRGEGRAIAAALMPVGE"
     gene            complement(197642..198202)
                     /locus_tag="HL653_00880"
     CDS             complement(197642..198202)
                     /locus_tag="HL653_00880"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016745382.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemerythrin domain-containing protein"
                     /protein_id="QJU56530.1"
                     /translation="MAENYAARNNQGLHRIAKDDPLAIAILKEEHHRFRDLFTEANEA
                     SGARLKHVADEICLRLDVHMTIEEEILYPAGKQVGERSEVDEGIVEHAAGKELAAEIQ
                     QLKGTEELYKSKVHVLGEQTIHHIDEEDEELFEEMKAAHKAGKIDLDAVGLTLRARQA
                     VLYRTVEASGDLGPTQEADAEEIARV"
     gene            198541..199326
                     /locus_tag="HL653_00885"
     CDS             198541..199326
                     /locus_tag="HL653_00885"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016745381.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="QJU60372.1"
                     /translation="MSGPIDTALARIDEACDIGTVVVDASVDVPELDRLFDRLEAAAR
                     EGRFRSVLTISPDLIDLAARFCPHPHVDTLCRDGGADGVAALAVALAGARRIPQRAAE
                     DGPMRLKQLSEEVGRIARTLAALSENDERMPALRPIRIGDDDGAEPSAAMIRACIRAR
                     RMRELYFPADLFADPAWDMLLDLMAARIEGRRVAVSSLCIAGAVPATTGLRWIKTLTD
                     GGLFLRVADPRDGRRIFIELSEAAARGMSGYFRALDRAGLAGV"
     gene            199633..199708
                     /locus_tag="HL653_00890"
     tRNA            199633..199708
                     /locus_tag="HL653_00890"
                     /product="tRNA-Val"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:199666..199668,aa:Val,seq:tac)
     gene            complement(199849..200229)
                     /locus_tag="HL653_00895"
     CDS             complement(199849..200229)
                     /locus_tag="HL653_00895"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016747808.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF559 domain-containing protein"
                     /protein_id="QJU56531.1"
                     /translation="MQRIPPETTDSARRLRREATFEERLLWSVLRQARPRFIRQLAID
                     RYIVDFACRSARIAIELDGGQHASRTEEDAARTAHLERHGWTVLRFWNNDVRDHTEGV
                     VDTIFRAVSRASTHPQPLPFREGG"
     gene            complement(200490..201247)
                     /locus_tag="HL653_00900"
                     /pseudo
     CDS             complement(200490..201247)
                     /locus_tag="HL653_00900"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611979.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS5 family transposase"
     gene            complement(201366..202187)
                     /locus_tag="HL653_00905"
     CDS             complement(201366..202187)
                     /locus_tag="HL653_00905"
                     /inference="COORDINATES: protein motif:HMM:NF015506.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="energy transducer TonB"
                     /protein_id="QJU56532.1"
                     /translation="MVAFTALMMMAAATDAAPTKAYRTLVPIGNQKTWFQPNDYPPGA
                     IAQKAEGIVHFAVQIGEDGKPTACRIVKSVGNDALDAATCKALMARAQFHPLVDKKGK
                     PTTATFDQIVRWRLPRQTTEEINDRTFTAHSIISPRGDVVECTMTGSGGNRFGQTGNN
                     CGPFGERGFLARLMGADYAKARVSDVRLQVSYEGLPEHGEGKVPDFYQLLAESEISIN
                     PDGSMGKCTSIRPLEMQGRSVDLCNIVAMAPPRFQPGTASKRAIFVLDISVSYKG"
     gene            complement(202244..203341)
                     /gene="dprA"
                     /locus_tag="HL653_00910"
     CDS             complement(202244..203341)
                     /gene="dprA"
                     /locus_tag="HL653_00910"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010406130.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-protecting protein DprA"
                     /protein_id="QJU60373.1"
                     /translation="MAPASLDADALDRLRLIRTQTIGPVTFRQLLARFGTAGAALAAL
                     PDLARRGGGRVPSVATPGEIAREAERVAAMGGAYLLLGRPPYPALLAELEDAPVALIV
                     LGDVALAARPAVAMVGARNASAAAIRFARALAHDLAGEGRVIVSGLARGIDTAAHVGA
                     LEGGTIAVVAGGADIVYPPENERLQRAIAERGLLVAEQPPGTEPRARHFPYRNRIIAG
                     LAAGTVVVEAAPKSGSLITARLAAEAGRDVMAVPGSPLDPRAQGCNLLIREGAVLVQN
                     AADVIEALAPLDGRAAARPSLLREEPVSMDVADRERIVVTQLLGPVPVAVDELVRLSG
                     VAPALVHTVLLELELGGRLDRHAGGRVSLSG"
     gene            complement(203346..203924)
                     /gene="plsY"
                     /locus_tag="HL653_00915"
     CDS             complement(203346..203924)
                     /gene="plsY"
                     /locus_tag="HL653_00915"
                     /EC_number="2.3.1.15"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010125840.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate 1-O-acyltransferase PlsY"
                     /protein_id="QJU56533.1"
                     /translation="MVPALVALCGYLLGSIPFGLLLTRFSGAGDLRAIGSGNIGATNV
                     LRTGRKSLAAATLILDAGKGAVAVLLAERVMPGLGVLAGVFAFYGHIFPVWLGFRGGK
                     GIATYLGIALALFWPCGLTFAVVWIGASLLTRHSSVGGMAASLLTPVCAAYFFQPGLT
                     LTFLAFALTVLWTHRANLMRLFAGTEPRIGER"
     gene            complement(204082..204261)
                     /locus_tag="HL653_00920"
     CDS             complement(204082..204261)
                     /locus_tag="HL653_00920"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012223176.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CsbD family protein"
                     /protein_id="QJU56534.1"
                     /translation="MGEIADKLKGTANETVGKIKRAIGDATDRPDIRAEGDAQEAKGD
                     LQKAKGDVKGVINRI"
     gene            204391..204927
                     /locus_tag="HL653_00925"
     CDS             204391..204927
                     /locus_tag="HL653_00925"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56355.1"
                     /translation="MTTLLPPARATLAAAALLALLAGCATTPPPAAPKAPPAPPPAAP
                     PPPPPADLAWADLPLSPGSWSYAREATGSAARFGTSADAPALAIRCEKARRLIHIAPA
                     GATAGTLTITTSYAGRALPLAAGTGGHAEATLPAVDPFLDRIAFSRGRVSYAVAGQPL
                     LVVPAWAEPARVIEDCRS"
     gene            complement(205301..205783)
                     /locus_tag="HL653_00930"
     CDS             complement(205301..205783)
                     /locus_tag="HL653_00930"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011951712.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2721 domain-containing protein"
                     /protein_id="QJU56535.1"
                     /translation="MPLPVDLDELFRIQSLPGLARDIQFALAPVFLLNGIGLILNMLT
                     GRLARIIDRARYIEENFTPRDHPRHGWQVSELRILDRRMAIVNNAIFLSTASAVVLCS
                     LVAGIFLARLVGVGFARTLSILFAVSLLLLIASLVLFLYEVRMAVAAIRVRDELLERS
                     "
     gene            complement(205783..206988)
                     /locus_tag="HL653_00935"
     CDS             complement(205783..206988)
                     /locus_tag="HL653_00935"
                     /EC_number="2.6.1.83"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010184991.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LL-diaminopimelate aminotransferase"
                     /protein_id="QJU56536.1"
                     /translation="MTEDFYRIRRLPPYIIAEVNAMRAAARAAGEDIIDLGMGNPDLP
                     PPPHVIAKLVEVAQKPDAHGYSASKGIPGLRKAQAGYYARRFGVDVDADSEVVVTMGS
                     KEGLASLATAITAPGDVVLAPNPSYPIHTFGFIIAGATIRAVPTTPDERYFEALERAM
                     NFTVPRPSILVVNYPSNPTAETVDLAFYERLVAWAKENKVWIISDLAYSELYYDGKPT
                     VSILQVKGAKDVAIEFTSLSKTFSMAGWRIGFAVGNKQLIAAMTRVKSYLDYGAFTPI
                     QAAACAALNGPQDIVAQNRELYHKRRDVLVESFARAGWDIPSPSASMFAWAPLPPALA
                     HLGSLEFSKQLLTHAKVAVAPGVGYGENGEGYVRIALVENEQRLRQAARNVKKYLQSM
                     GVNTGLRVG"
     gene            207164..208894
                     /gene="phaC"
                     /locus_tag="HL653_00940"
     CDS             207164..208894
                     /gene="phaC"
                     /locus_tag="HL653_00940"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007405305.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class I poly(R)-hydroxyalkanoic acid synthase"
                     /protein_id="QJU56537.1"
                     /translation="MAKATDKPHDGGALLDEMAHWTGVIGQAQQMMMEHGASAAIKAG
                     DEFVASMAQMPLGDPAGLANAPGMMWAETLGFWRSMMPDSKLPAADGRFTAPDWQEPL
                     FDLIRQSYAMVADQFLSAIDHAPGLDARQQEQLRFAARNFVDAMSPTNFPFTNPQVVA
                     KIVETRGQNLITGLQRMMDDMTAGQIRHVGKDAFEVGRNIAMTPGKVVYEAPLFQLIQ
                     YSPTTESVSEIPIIIFPPWINRFYILDLAPQKSFVKWATDQGLTVFMVSWKSADASTA
                     HVVMDDYILHGEWEAIEVVTRLLDVPSTHVIGYCVAGTALSMLLAWAHATGRADKVAS
                     ATFFTAQVDFSEAGDLSLFVDDAQLALMESIAKDGVFDGRYMAATFNLLRSRDLIWNY
                     VVNNYLLADDYKSFDLLHWNSDVTNLPAEWQRRYLAELYRDNLLVKPGALSVAGTPID
                     LTTVKTPAYVQAGREDHIAPPGSVWKLTHYLAGPLRFVLAGSGHIAGVVNPPSAQKYQ
                     YWTNEAKVDTLDAFVAGAAEHKGSWWPDWRAWLATQDGGTVPAEGARIPGEGPLPAIE
                     DAPGRYVRMR"
     gene            complement(209017..210210)
                     /locus_tag="HL653_00945"
     CDS             complement(209017..210210)
                     /locus_tag="HL653_00945"
                     /inference="COORDINATES: protein motif:HMM:NF019474.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="QJU56538.1"
                     /translation="MKHLFRTGLLTVAWLLVLPCLIVLLSAIFPVVPTVRVYLVDIVP
                     NHAPWLLIWSLLGLSAAVLAHRRKEALSSRAPMAAGTIAVLLAAGVTAHLSYVAIQNG
                     ARINLVKALSWRHFSESAAPDETHVYSRPGGEALSLDVYRGRRERPDALTPVVMFIHG
                     GGFSKGSRTFGAANMRWYANHGWTVISIDYRLARDDRPTWNLANRDVECALAWTAEHA
                     GALGLDLHRLTISGTSAGGSLAMAAAYAADTGRADPQCGPHVPHVAAVVMKVPLVDAI
                     GSWNLPRELQPIQQRVLTRYIGGSPTQFPDRYAALNPARYLKGPLPPTLIISGSDDPL
                     VPPQGAAEFVRAARASGHDVQRIVFPYSGHEFNTTYGAITNQATQQIVANFLRAHDGT
                     PTTQR"
     gene            complement(210213..211139)
                     /locus_tag="HL653_00950"
     CDS             complement(210213..211139)
                     /locus_tag="HL653_00950"
                     /inference="COORDINATES: protein motif:HMM:NF013884.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyltransferase"
                     /protein_id="QJU56539.1"
                     /translation="MILVILGHFSELTSRHTFIVWLGFGFRMPMLIGLTGYLFNLDHA
                     REMRLVTLVRHYHRLIIPWLVASIVYVVLVQPVDWRLPLELIVRPPFHLWFVPVMLAF
                     ILIAWGCRLRRGQMLAIAVPASIAAMYAFGVGHGIEQYSPWMPDRRYFIYPIYFTYGL
                     WVARRPPDPAKLPYAIIVSLIGLVWWSALYRQPAPEAEVAAELLLCMPLIGMLPRVRR
                     IVVDFPSVANVGRDSLFFYLWHPLIFGLCAAAGLSGLPMLAVTVVLLALGWAGIARVE
                     SLRGILGIRDPARSARIGTISPDEALTMRTAA"
     gene            211403..211888
                     /locus_tag="HL653_00955"
     CDS             211403..211888
                     /locus_tag="HL653_00955"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011952350.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine zipper 2TM domain-containing protein"
                     /protein_id="QJU56540.1"
                     /translation="MKTFLLGAALAAMTLPLAAPVLADPPRDHGRGHDRHDNGRGWGN
                     DRGGNRGGNDWRNYRNYDWNRPDRSHGGYDAARYYRDGRGYQERRIGRNDRIYRGSNG
                     RYYCRRTDGTTGLIIGGALGGLLGNSLASGGSSTVATLLGAGGGALLGQSIDRGNIRC
                     R"
     gene            212008..212526
                     /locus_tag="HL653_00960"
     CDS             212008..212526
                     /locus_tag="HL653_00960"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010161262.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine zipper 2TM domain-containing protein"
                     /protein_id="QJU60374.1"
                     /translation="MIAATVSGAVAAPAVAQSRGQIEARWADAQRRYQIETDRYYAER
                     DLYYASRRGGYRPAEVPPPPPPPPGAYGAGYADDRYDPNFDPANHYRPGDREQVLAND
                     DRVYAGNDGRYYCKRSDGTTGLIVGGAAGGVLGNVIDGGHSRTAGTLIGAAIGALAGK
                     AVDQNQAQIKCR"
     gene            complement(212585..213010)
                     /locus_tag="HL653_00965"
     CDS             complement(212585..213010)
                     /locus_tag="HL653_00965"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56541.1"
                     /translation="MPLLILAATAALADPVPPTPPQQASVEAAVAVVRAYYAAVEARD
                     YRTAYRLWHGRYTLAQVRAGYADTAHVAVTPIPPFEADGGAGSLYAEIRVRVEAVQTN
                     GRHQHFAGSFTLRRVNDVDGSTAEQRRWHIIGAKLKPIA"
     gene            complement(213015..213272)
                     /locus_tag="HL653_00970"
     CDS             complement(213015..213272)
                     /locus_tag="HL653_00970"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017979677.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56542.1"
                     /translation="MSFTQLEPPLPLTVLDKGDGYAVAVIDYGQEFDLLWVVALNDSG
                     EIWCAPNPKVRMQGNWSMGRKRPALDEATKRAPARIAAMAG"
     gene            complement(213365..214480)
                     /locus_tag="HL653_00975"
     CDS             complement(213365..214480)
                     /locus_tag="HL653_00975"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007403553.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidoglycan DD-metalloendopeptidase family
                     protein"
                     /protein_id="QJU56543.1"
                     /translation="MGGPLAAALALALPAAAASAVPPTFSAFEKRSSSGGDGASREDK
                     AREDKAPPAAPRSAASARPRVAPPAASPSAEETPPARADAVDVEKQTYVVKPGDTLSR
                     VAGKTGAAFMAIARENKIERPFIVRLGQKLKVPAGRYHLVRPGERGIAIARAYGVEWG
                     RIAEINHLEEPFLLRAGERLLIPSTREVAGMSMEERAKAFHIDIDDLVTGNEPALAPK
                     ARPARPVRTAARPVPPGVPVAEPAQTFSGKFVWPVVGSIMRRYGLQPSGARNDGVNIR
                     AQMGETVRAAADGVVAYAGDLAAFGKLVLIRHGGGWLTAYGHADSLLVTRGQAVKQGQ
                     PIARAGATGSAREPQLHFEIRDGRKPVNPMEWLPKRN"
     gene            complement(214486..215250)
                     /gene="surE"
                     /locus_tag="HL653_00980"
     CDS             complement(214486..215250)
                     /gene="surE"
                     /locus_tag="HL653_00980"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007684043.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5'/3'-nucleotidase SurE"
                     /protein_id="QJU56544.1"
                     /translation="MRILVTNDDGLGAKGIELLERVALSFTSDVTVVAPAEEQSGKGR
                     SLTITAPLRMRSHDARHHAVYGTPTDAVIMALGEVMKDGPPDLVLSGINRGANLAEDV
                     SYSGTVSAAMEGALAGIPAIALSQIYPRRGMGDAVTFEAAEGWCARVLDKLIGMEWTP
                     RTLINVNFPPIPAEEVKGIKVVRQGLRDWSRPRLEQGVDPRGYPYWWMHHGLTPRTID
                     ADTDLEATAAGYVAVTPLHLDLTHDPSKAALEARFG"
     gene            complement(215250..216527)
                     /gene="serS"
                     /locus_tag="HL653_00985"
     CDS             complement(215250..216527)
                     /gene="serS"
                     /locus_tag="HL653_00985"
                     /EC_number="6.1.1.11"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013846217.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine--tRNA ligase"
                     /protein_id="QJU56545.1"
                     /translation="MHDIRVIRDDPAAFDHGLARRGLGPTASALLQLDERRRALLTEV
                     QTLQARRNEASKAIGQAKAQKDEAAAASLMAEVAAIKDRMAALDHESGHAQAELDAAL
                     AALPNIPVADVPVGEDEEGNIEQKRWGTPRDFGFAAKDHADLGPPLGLDFEAGAALSG
                     ARFTVLRGAMARLHRALGQYMLDTQSGTNGYVETAPPLLVRDEAVFGTGQLPKFAEDL
                     FRTTDGRWLIPTAEVSLTNLVREQIVPTGALPMRLSALTQCFRSEAGAAGRDTRGLIR
                     QHQFEKVELVVIAHPDDSDAEHERMTRAAEGILEALELPYRRMLLCSGDMGFTARKTF
                     DLEVWLPGQQRYREISSCSNCGDFQARRMDARFRPEGEKGTAFVHTLNGSGLAVGRTL
                     VAVLENYQEEDGSVTVPAVLRPYMGGLDRLAAL"
     gene            216866..217420
                     /locus_tag="HL653_00990"
     CDS             216866..217420
                     /locus_tag="HL653_00990"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56546.1"
                     /translation="MFAKFVLMSGAAMLAMPALAQTAAPATAPTAAATPGEGVVTGAK
                     VVDTAGAEVGTIESVASGNAILSTGAAKVSVPVTSFAKGPNALVFGMTKADIESKVAQ
                     ASSAPVEITVGALVSDPSGAKVGTVKEVAADGVTVASDTAQAKLPKTSFAKGQSGLVI
                     AMSPDQFDAAAKAAGGAKPADSAS"
     gene            217590..218045
                     /gene="dksA"
                     /locus_tag="HL653_00995"
     CDS             217590..218045
                     /gene="dksA"
                     /locus_tag="HL653_00995"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009821358.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase-binding protein DksA"
                     /protein_id="QJU56547.1"
                     /translation="MASVADDVDGRGSGDIELPRDYRPSPDEPFMNDRQQAYFRAKLL
                     DWKDAILRESRETLNQLQIEPLREPDVTDRASSETDWSIELRTRDRQRKLISKIDAAL
                     RRIDEGEYGYCEVTGEPISLARLEARPVATMTVEAQERHERQEKVSRDD"
     gene            218143..218541
                     /locus_tag="HL653_01000"
     CDS             218143..218541
                     /locus_tag="HL653_01000"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010543412.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PilZ domain-containing protein"
                     /protein_id="QJU56548.1"
                     /translation="MRQSVDASGGGFEVEEEEQHYAHLRSAPRDSMFLLATIRRVGGA
                     DVPIKVRNLSAGGMMADCPTSFSRDELIEVELRGIGTVGGRIAWGTGGRIGVAFDREI
                     DPKLARKPVTGNPQPQLVKAAKSMWRPGLR"
     gene            218824..220020
                     /locus_tag="HL653_01005"
     CDS             218824..220020
                     /locus_tag="HL653_01005"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004208174.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate aminotransferase family protein"
                     /protein_id="QJU56549.1"
                     /translation="MSITPLMPVYPRCGVRPVRGEGAYLYGERGEAYLDMAAGIAVNI
                     LGHSHPVVVKAISDQAATLMHVSNLYGMPLGEQFAEALLAKTFADTLFFTNSGAEAVE
                     CAIKTARRYHYANGHPERNRIITFSNAFHGRTLGGISATDQPKMRDGFEPLLSGFTVV
                     PFNDLAAATAAIGPDTAGFMLETVQGEGGILPATQEFMTGLRQLCDEQGLLLILDEVQ
                     CGYARTGTFFAYEQYGVTPDIMAVAKGIGAGFPLGACLATENAAKGMVIGTHGSTYGG
                     NPLAMAVGQAVLGVVGTEAFLANVRATGDRLRGALEQLIPNHDHVFQEVRGLGLMLGI
                     KLKPSVEARGFVAHLRDNHGLLTVSGGDNVVRILPPLNIDDSHIAECVEKLSAGARSF
                     PVPEAA"
     gene            220157..221086
                     /gene="argF"
                     /locus_tag="HL653_01010"
     CDS             220157..221086
                     /gene="argF"
                     /locus_tag="HL653_01010"
                     /EC_number="2.1.3.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007714051.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ornithine carbamoyltransferase"
                     /protein_id="QJU56550.1"
                     /translation="MTRSFLDLADAGPEGLRAILTEAQRRKQARMGWPKGMADADAPL
                     AGHTLAMIFEKNSTRTRVSFDMAMRQLGGSTIIMEAGSTQLGRGETVSDTAKVLSRYV
                     DAIMIRTDDHAKVVELAGEASVPVINGLTDKSHPCQIVADLLTYQERRGPVEGSRWAW
                     LGDGNNVLHSIIEAGSLLGFDVAAATPEGYDPDPAIVEEARRVGNHPPILTRDPNEAV
                     AGADIVVTDTWISMGQSHAEQKLAAMAPYQVTEALMGGAKRDSLFLHCLPAHRGEEVV
                     DSVIDGPKSAIWDEAENRLHAQKAILLWCFGLI"
     gene            221214..222116
                     /locus_tag="HL653_01015"
     CDS             221214..222116
                     /locus_tag="HL653_01015"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019832192.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Hsp33 family molecular chaperone HslO"
                     /protein_id="QJU60375.1"
                     /translation="MAAMTLSSPDQALGFTITSRSARGRIARLGTTLDSILGAHGYPP
                     AIERVLAEALVLAALFGSTLKDAGGQMTLQAQTEGGAIDLLVCDFRGGEMRGYVRHDP
                     ERMAELPTEPSLFALFGKGYLAITFDQAVTGERYQGIVPLEGGSLAEAAESYFAQSEQ
                     IPSLVRIGVERLADGTHMAGGLLLQHLPEGEEGRERLHTRLDHPEWEHVAALGTTVRA
                     EELTDPALPLKTLVWRLFNEDEVRVLPSIALARGCRCDPDHVRSVIERFPADEQAEMA
                     DEQGLIHVDCEFCARRFSLEAATV"
     gene            222618..223352
                     /gene="queC"
                     /locus_tag="HL653_01020"
     CDS             222618..223352
                     /gene="queC"
                     /locus_tag="HL653_01020"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011952246.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="7-cyano-7-deazaguanine synthase QueC"
                     /protein_id="QJU56551.1"
                     /translation="MSTAASQPREKAVVLVSGGLDSMVVAGLAREAGRDVCALTIDYN
                     QRHRVELEAAARVAAAIGVERHIVLPLDLTRFGGSALTADIAVPKEGVGLDGASDGGI
                     PVTYVPARNTIFLSLALGFAEACGARSIWIGVNALDYSGYPDCRPEFVRAFQDLANLA
                     TKAGVEGDRFRVETPLLHMTKADIAAEAARLRLDAGISWSCYDPVPTDDGARACGTCD
                     ACRLRAKGFTEAGLPDPTLYAGEAPR"
     gene            223349..224023
                     /gene="queE"
                     /locus_tag="HL653_01025"
     CDS             223349..224023
                     /gene="queE"
                     /locus_tag="HL653_01025"
                     /EC_number="4.3.99.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010183924.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="7-carboxy-7-deazaguanine synthase"
                     /protein_id="QJU56552.1"
                     /translation="MSYAVKEMFLTLQGEGLQAGRRAVFIRFAGCNLWSGREQDRADA
                     QCRFCDTDFVGVDGEGGGRFADGAALAAEARNFWDRGLTAPEARPFAVITGGEPTLQL
                     DAEAIDALHAQGFEIAIETNGTNKVPTGVDWVCVSPKAGTTIVQTEGDELKLVWPQTG
                     LDPATLESWDFRHRLVQPMDGTALGGRAPDGEVLGDTRQACIDFVLANPRWRLSVQTH
                     KMIGVR"
     gene            complement(224148..224870)
                     /locus_tag="HL653_01030"
     CDS             complement(224148..224870)
                     /locus_tag="HL653_01030"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015457159.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56553.1"
                     /translation="MARVWKKAIPAVAVASLVAVSVAEPASAYLFWRSPQLKGEPVTG
                     DEPGLLVPLPGATPKEVKANLLWGMRAGLNVAALQCQFAPSLLTVSNYNALLRNHSAE
                     LQDAYNTLVAYFKRQSAAPVAAAKGKAVKGKPAPKAKSGGISWQTAIDQFSTRTYNGF
                     STFHGQLEFCETASSLGREALAVNRGELLALATARMREFRNSLSPAGDMVFAYGTSSI
                     VATPMPSLTCVNKKGKEIPCKD"
     gene            complement(225036..225236)
                     /locus_tag="HL653_01035"
     CDS             complement(225036..225236)
                     /locus_tag="HL653_01035"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007407094.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56554.1"
                     /translation="MNIIKKTVAVAMIAGAALAVSACGKTENTNITETNVTDMNTMAP
                     EEGSMNDMSGMEMNESNSSNMM"
     gene            complement(225330..226025)
                     /gene="lipB"
                     /locus_tag="HL653_01040"
     CDS             complement(225330..226025)
                     /gene="lipB"
                     /locus_tag="HL653_01040"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013848551.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoyl(octanoyl) transferase LipB"
                     /protein_id="QJU56555.1"
                     /translation="MTVCSLEAPVPAGPPPGPAVEWQVSPGLTDYAEAVAEMEARAAA
                     IREGTAPELVWLLEHPPVITAGTSAPPEELLSPDLFPVHRSGRGGRHTYHGPGQRVGY
                     VMLDLNARGRDVRCYVAKLERWLIASLARLGVSARTAEGRIGIWTDEPGGGEAKVGAI
                     GVRVRRWVTLHGFSINVAPDMAHFGAIVPCGIADHGVTSLERLGCETGMSALDQALEA
                     EFPSFLWSLSQVR"
     gene            226192..226980
                     /locus_tag="HL653_01045"
     CDS             226192..226980
                     /locus_tag="HL653_01045"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56556.1"
                     /translation="MHKISIEQGLRALQHFLAAEWRLALPVALAFLALPPFGLGLVLA
                     PLMKQMPSTIEGIRALSLSLPGWVTPVMALGGIVTIVGAMTLQALLLLPRISVGEAIL
                     AALRHLPAWIGACLIVFAAMFAFLITVGFLVGAGPGGASILVLATFFGMTLAGLYLVL
                     IMPLIVERGMGPLVALRYGFSFYGAQLPRLISGLILFLAGAWILAMAIQVALGSVFLL
                     LGRMIGQPDLGQILVGLLGAIVSSVEWGAFYLLVACFYAQRARG"
     gene            complement(226962..227561)
                     /locus_tag="HL653_01050"
     CDS             complement(226962..227561)
                     /locus_tag="HL653_01050"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007682719.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="QJU56557.1"
                     /translation="MSLTPVAEGELAAIVTSLEMRDRPKPKPLPAAPLRLVRWASPTT
                     AAYRTLFTRVGAPWLWFSRLMLAEEALAAIIGDPAVEIYAVVDRAGIEVGMLELDFRV
                     AGECEIGFFGLITELSGKGLGRWLMAETLARAWLPGITRVWVHTCTLDHPSALNFYRA
                     QGFVPFARAVEVFADPRLLGVLPRDAAPHAPLLDQPRAR"
     gene            complement(227575..228432)
                     /gene="hemF"
                     /locus_tag="HL653_01055"
     CDS             complement(227575..228432)
                     /gene="hemF"
                     /locus_tag="HL653_01055"
                     /EC_number="1.3.3.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010183932.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxygen-dependent coproporphyrinogen oxidase"
                     /protein_id="QJU56558.1"
                     /translation="MSHEPFPLDPEQQAARSWFEQLRDRICAAFEGVEREAGSDAAFV
                     YTPWDRTDPDGSPGGGGVRGVMKGRVFEKVGVNVSTVGGHLEGEFGKTIHGAGEDPRF
                     FATGISLVAHMANPHVPAVHMNTRFLVTTKRWFGGGADLNPPLPRDEDTADFHGSMRA
                     ACEAHPGPGDYPRYRTWADDYFWIPHRNVHRGAGGIFFDHLEGGFDTNFAFVRAVGEA
                     FLDIFPAIVRRRMGEPASDADRAALLAYRGRYAEFNLVYDRGTLFGLKTGGNIDAILM
                     SLPPVATWE"
     gene            228600..229169
                     /gene="petA"
                     /locus_tag="HL653_01060"
     CDS             228600..229169
                     /gene="petA"
                     /locus_tag="HL653_01060"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007012747.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ubiquinol-cytochrome c reductase iron-sulfur
                     subunit"
                     /protein_id="QJU56559.1"
                     /translation="MAASHTSDLSDGQTAEAAPRRRDFLNIAAVSFAGVGAVAVVVPL
                     VNQMNPSADVLALASIEVDISAIAAGQAIKTMWRKQPVFIRNLTPKEIKEADAVPVST
                     LRDPQTLAQRTKPGHKNWLITLGVCTHLGCVPLGAGEGEMRGDFGGYFCPCHGSVYDT
                     AARIRKGPAPLNLQVPDYSFKSNTVVQIG"
     gene            229185..230474
                     /locus_tag="HL653_01065"
     CDS             229185..230474
                     /locus_tag="HL653_01065"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019832203.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome b/b6"
                     /protein_id="QJU56560.1"
                     /translation="MSFPWAKHYEPTNPVMKWVDSRLPLPRLVYNAIGAGYPVPRNLN
                     YFWNFGVLAGLALVVQIVTGVVLAMHYAANADVAFNSVESIMRDVNSGWLLRYAHMNG
                     ASMFFIVVYIHIFRGLYYGSYKAPREMVWLLGVVIFLLMMATAFMGYVLPWGQMSFWG
                     AQVITGFFSAIPVVGGPIHTWLLGGFAPDNAALNRFFSLHYLLPFVIAGVIILHIWAL
                     HIPGSNNPTGVEVKGPQDTVPFHPYYTAKDGFGVGIFFIVFACLTFFAPNALGHPDNY
                     IPANPLSTPAHIVPEWYFWPFYAILRAFTVNWFWIPAKLWGVIAMFSAIALLFFLPWL
                     DKSPVRSATYRPMYKWAFVVLVLDVLVLGWIGKSPAEEPYVRIGQFAAAYYFAHFLII
                     VPVINLFEVPKPLPNSITEAVLKGETEDEPAPAGVAH"
     gene            230496..231347
                     /locus_tag="HL653_01070"
     CDS             230496..231347
                     /locus_tag="HL653_01070"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011952236.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c1"
                     /protein_id="QJU60376.1"
                     /translation="MVRVIGFFAGLAFVSALLIAFVMPREKAEPTAAHEFHLEPKEIH
                     FSFDNPVWGKYDRQQLQRGFQVYKEVCSACHSMKLVAFRDLEEIGFTKPEVKAIAKQW
                     QTEVPTINDKTGEPTTRKALPSDYFPSPFANETAARAGNNNALPPDLSDIAKSREGGA
                     HYIHSILTGYVDQAGFKNEKGQELLKEFPDAKTPESLHFNPYFANLNIAMPPPLAAEG
                     QVSYADGTKPTIDQMATDVSAFLMWAAEPKLENRHRTGIAVVIFLLIATALAFGSYKS
                     IWAGKKH"
     gene            complement(231464..232015)
                     /locus_tag="HL653_01075"
                     /pseudo
     CDS             complement(231464..232015)
                     /locus_tag="HL653_01075"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008944263.1"
                     /note="incomplete; partial on complete genome; missing
                     N-terminus; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
     gene            232188..233165
                     /locus_tag="HL653_01080"
     CDS             232188..233165
                     /locus_tag="HL653_01080"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015663835.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent epimerase/dehydratase family
                     protein"
                     /protein_id="QJU56561.1"
                     /translation="MTIAFVTGGTGFLGRHLVTRLVTDGWTVRALHRAPADAERLRAL
                     GAEPVRGDLGDPASLARAVAGTEVVFHAAALFKMWAPKAAFEQANVDGTRHLLAAAQA
                     AGVARFIQIGASGVVMSAGRSMIGVTEDAPLAFPDWAPYLASKARAEQLVLAADDPAG
                     MRTMMVLPPMIWGADMPMLGETIANIEAGRFAWPGGGASLMSTAHVDNVAHAALLAAR
                     RGAGGRAYFVTDGEDRTLREVIGQLLATRGVDAGTRSAPLGVAWFMATVMERVWRTFR
                     LAGEPPLTRQMLRMVGYDFTISDRRAREELGYAPVITWDEGVRAMSAGA"
     gene            233257..233817
                     /locus_tag="HL653_01085"
     CDS             233257..233817
                     /locus_tag="HL653_01085"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010405354.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DedA family protein"
                     /protein_id="QJU56562.1"
                     /translation="MALEALVARYGLLAILAGAGIEGEAVVITGGVLAQRGLLPIWGV
                     AAAAAVGSCLVDQLWFWLSRRYRDHRWVRKATHKPAFARALRWLERYPKAMILSFRFI
                     YGLRTVTPVAIGTSAIPSRTFVPLNIVAAAIWGPAIAWAGYAFGSALGTWLHDIESLI
                     LVAIGVLLIVPLAVLLVRTISGRLRG"
     gene            complement(233824..234495)
                     /locus_tag="HL653_01090"
     CDS             complement(233824..234495)
                     /locus_tag="HL653_01090"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009823445.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arylesterase"
                     /protein_id="QJU60377.1"
                     /translation="MLLAGCGKGAEAPPIENSANPAAPAVPAEVARPAGPERLVLAFG
                     DSLYAGYGLDRGQDLPHAIEGRLRKAGINATIVNAGVSGDTSAAGRQRLAFALDNLPR
                     KPDLVMLGLGGNDVLRQITPAETRANMTAMMEELAKRRIPVVLTGMMAPPNLGPDYVA
                     PFDAIWPDLAKHYHAGLYPFILDGVIGKADLMQADGHHPNMRGVAVVADHLAPVVETA
                     LPPAR"
     gene            234586..235260
                     /locus_tag="HL653_01095"
     CDS             234586..235260
                     /locus_tag="HL653_01095"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019370065.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding cassette domain-containing protein"
                     /protein_id="QJU60378.1"
                     /translation="MVIAARDIRLSLGAVAAQTQILKGIDLSVTRETSVALLGPSGSG
                     KSSLMAVLSGLERASGGQVIVDGLDFSALDEDALARARRGRIGIVLQAFHLLPTMTAL
                     ENVAVPMELAGHADAFARAEAELVAVGLGHRLDHYPSQLSGGEQQRVAIARALGPRPA
                     LVFADEPTGNLDAATGEAIMDLMFARQAAARATLIVITHDAKLAERCDRIITLADGRI
                     VEDRLR"
     gene            235287..237779
                     /locus_tag="HL653_01100"
     CDS             235287..237779
                     /locus_tag="HL653_01100"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008067369.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="QJU60379.1"
                     /translation="MAWRLARRELDLRFRGLRLLLVCLFLGVGALAAIGSLAQSMGRE
                     LAARGSTLLGGDVEFALSQRPANSAEIAAMRKLGQVSATVGMPATAVIGAGPKQQTVP
                     VELKSIDAAYPLYGALTLSDGRNVRAPGPDRVWIAQALAERIGGRIGQTIRFGTTDFR
                     VAGVIADEPDRLGEGFTLGPVAIVSTDGMARTGLIQPGSLYKTKYRIRLSASADPAAA
                     VTAFRRAFPAGGWDAKTRDKASPGAARFIERMGQFLLLVGLSALVIAGIGIANGVSSY
                     LAARRSSIAALKTLGATSALITRIYLLQIGAVALAGIAAGLIVGAVSVPAIVWAAGDI
                     LPVTPGFRVEIAPLALAAAYGMLIALAFTARPLSEAGSTPAAGLLRGTFGSRPIPRRS
                     WIGVGAAGAAVVALALVTADQPMLTAWFLAAIAGVLLLLAAFGRGVQALATRLPRPRR
                     PLARLALAALHRPGARTSTLVVALGLGLTLFVLLAAIRTSIDANIARTVPARAPALFA
                     LDIPSTREAEFRQTVARVVPTATIKAIPAMRGSIIGYGGTRVADLKTIPDEAWALRGE
                     RGLTYAETLPEGSTITAGVWWPKDYAGPPLVSMDQRLADALHLKIGDRLDYSLLGVER
                     SARIASFRRIDWETMGFNYVLVFSPNAIRDAPHNLAATIDLPPGKEGLVTRALLPGFP
                     SVSVIEVGGVLAQIRTIVAGMAAAITAAASVAILAGIAVLVGAIAAAREVRIYDSVIL
                     KTLGATRMQILIVQLLEYALLSAILAAVALVLGLSGAWYVVVRLFDFVWLPDPVAIGL
                     TLLAGIGVTMGLGLAGGWPVLAARPARALRQL"
     gene            complement(237904..238686)
                     /locus_tag="HL653_01105"
     CDS             complement(237904..238686)
                     /locus_tag="HL653_01105"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012335516.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="QJU56563.1"
                     /translation="MRRRHRGGDDAGTLPVQHLIRLDHDTTRPLYLQLEEQLTELITS
                     GQVPGGTRLPPERQLAEYLGVSRSTVQQSYTLLRERRMIVGQGRQGSIVPEEAVRLKP
                     GMDRLRGFTQEMAELGRVPSTRVLEHRIVTDRSVASLFGLPSTARFLYLVRVRLGDDV
                     PLSRETAWYSLDAAPFLAEADLAGSIYGQLAAEGLIPAHCDQTIEATPPTPSEIEIFG
                     FEDTTPCLLIKRRTYLRDGPMVEYVEGVFRGDTYIYRLRLDS"
     gene            238780..239757
                     /locus_tag="HL653_01110"
     CDS             238780..239757
                     /locus_tag="HL653_01110"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015932473.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribokinase"
                     /protein_id="QJU56564.1"
                     /translation="MNSDGPVFVLGSFVAALSMKVAHLPAAGESLRGEALLLEAGGKG
                     LNVAIALRRLGLAVDGLIAIGSDHFAAMAQEALARADLPEGMLVGFPGPSGTGVGLID
                     AHGENMIAVFPGANGLLSAREVAGAEARIGRSRAVVAQYEIGDAPIAVTFATARTWGV
                     RTVLNPSPYRPIAAEILAATDVLVLNETEAKCLLAELAGRRGVSSGQVPAALAEALAG
                     SGVESLVVTLGCEGAVLRQRDGRTLHQAAFAVEAKDATGCGDAFLAGLVAALSSGDDW
                     AGALRFASACGAITCSRIGVIDALPTRPQVVTMITGERPSERIPSPQGA"
     gene            complement(239769..241190)
                     /locus_tag="HL653_01115"
     CDS             complement(239769..241190)
                     /locus_tag="HL653_01115"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018628807.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="family 43 glycosylhydrolase"
                     /protein_id="QJU56565.1"
                     /translation="MARSKPLHVGRLLPLLLALTSPAIAQMPGHYDAIHSGTPWFDQR
                     GLPVSAHGGGIIKDGDTYYLFGEAHQDMTNAFAGFNCYSSKDLVNWRFERIALPVQPS
                     GPLGPETVGERAKVMRSPATGEYVMFMHADAIDYRGQFVGYATAKTITGPYTFQGPLL
                     FDGKPIRKWDMGTFQDKDGAGYVLLHGGDIYRLADDYLSVREHVNAAMAEGFEAPTLF
                     RKGDTYYFLGSDLTGWERNDNYYFTATSLKGPWTRQGLVAPQGTLTWNSQVTFVLPVE
                     GSRGTSYMFMGDRWSYPRQASAASYVWQPLTVEGERLTMPRYRDAWRIDTRLGTVAPA
                     ADADTIIAQDDASARFSGSWRDAAAGQSADRVTDDPQGSVSITFTGTQASLYSVARAD
                     GGYAQITLRDRGGRDILSSTVDMYSKYPVSGARFVTPLLRKGTYTISVAVVGSGWYWT
                     NKKGDRSGSAGHAISFQRLEIRK"
     gene            complement(241322..242626)
                     /locus_tag="HL653_01120"
     CDS             complement(241322..242626)
                     /locus_tag="HL653_01120"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019370029.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2264 domain-containing protein"
                     /protein_id="QJU56566.1"
                     /translation="MERREFIAAAMGAGAIAASLGTQAQGQMGPQASGASGEAPTPSV
                     GGTGAEDRAYMVDLLRRMAEPVLGPMSKGQLQARFKPELSPTWDGRPPKVAYLECFGR
                     LIAGLAPWLALPDTDDAEGKLRAKLRQQAQAAYAHSVDPKSGDYLFGGLAEQQLVDSA
                     YFTNALIRAPKALWEPLDATTKARIVKEIKGIRSVSPPYTNWLLFAAMNEAFLLSIGE
                     QWDPVRVDLAVRKMLEWYVGDGWYADGPHFHFDYYGSYVIHPMMVEILEVLTSTKAHF
                     NSLKSAELLEQAKKRMQRYGMSLERMVGADGSYPPIGRSLTYRTAVFQPLGLLAWRKW
                     LPEALPAGQARAATVAAQRAIFSNPTNFDAQGYLTIGFCGHQPTLADWYSNAGSMYLA
                     SLSLLALGLPADDPYWTAPPLPWTSKRAFAGAHFAKDYYVEY"
     gene            complement(242790..243656)
                     /locus_tag="HL653_01125"
     CDS             complement(242790..243656)
                     /locus_tag="HL653_01125"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010544533.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4861 family protein"
                     /protein_id="QJU60380.1"
                     /translation="MPPITLPLTPPADKSPRASALLAPYRYDDILWENDRTAHRIYGE
                     ALQAYEPPSGSGIDAWGKNVPWAFADRQLKTGDQHGFHGEGIDFYNVGTARGMGGLGI
                     WYQNKLWTSRNYHTYKIFKNGPDVADFEVTYSPWPVDVDRKVWETRRFTLPLGTQFTR
                     MVSTISSDKPGELIVGIGIGKRTTLAGKDGELSVDKAHGWLSWWGPESGDHGRMGIAV
                     KVDPAMIVEVKTNEADNDIVLLRVQPGKPFVYYSGSVWDKGNAGIRSREAWDKYVAGA
                     PVDFKVPPAPRG"
     gene            complement(243743..246943)
                     /locus_tag="HL653_01130"
     CDS             complement(243743..246943)
                     /locus_tag="HL653_01130"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007662879.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4981 domain-containing protein"
                     /protein_id="QJU56567.1"
                     /translation="MAEVTAPAPPIQPQVDASRPDWENPAVFAIGKQPARATGFPFES
                     RERAIAGHRTKSDRFVLLTGLWKFSFSPSADALPQGFEKPDYDVSGWKDIKVPSDWQA
                     EGYDQARYFNITYPFPANRPLIPHATNPVGSYRRDVDVPAGWAGEDVILHIGAAGSAY
                     YVWVNGQKVGYSEDSKLPSEFDVTRFLHPGKNVVAIQVYRWSDGSYLEDQDFWRVSGI
                     EREVFLMAAPKTRIRDFFVHAGLDDSYRDGKLAVDLAVTPSSAATTARIVLLDKDDKT
                     QLLTASAPVKAGTAERSVTLNATLPNVRAWSAETPNRYMLLVELYDSKGAILLSTYSR
                     IGFRSVAMKNGVVTVNGKPITIRGVNRHEHDPVTFHVLSPELMERDIQLMKQNNINAL
                     RTSHYPNDPRIYDLADRYGLYVMDEADIESHHYMEWSNNHPEQRGKYQIGFDPAWEGA
                     HVSRVMNMVERDKNHPSVIFWSLGNEAGIGPNFAKAAAAAKARDPGRLISYLGWGTWE
                     NQREHRPNDYADIYAPMYDSAAKLLDYATNFNFRQPLIECEYAHMMGNSGGDLKDYWD
                     VIYAHPDKLQGGFIWDWVDQSMSRKTADGRSYWGMGGEYGPNPGGELEFGDGLTQSDR
                     TPNPQLFELRKVYAPVQFADFDAAAGKVRVINRNDFIDLSHYAFSWQVANDGVVVARG
                     DLPALATPAHGQETIPLSLPMIKRKPGSELMVTIVARAKADTTQGVAAGQVIGWEQFP
                     MGNVQPADAPVPSGRVTLTDGRGRVTLSAGGAELTIDRATGLIDHYAAGGQTLLSGGA
                     PNFTRAATDNDIGTGTIKTHAIWQQASDARTVEAIEPRRLDDGRAEVTVRYAVGEGAT
                     RFVTRYVMNGDGSLAVEGDMTPLKADLPDPLRVGLSFAMPTAFDTLEWYGRGPHETYA
                     DRKTGAPIALWRGKIAEQNHDYMRPQETGNKVDVRWMELVRAGAPGLRVEGAQPLSMN
                     ALAFPYADLARRAPGTAKSSDIVPHDHVSLLIDAAQVGVGGDDQWTKWGRSLPKYRVP
                     LAPLHYAFRLKPFDGPGTTPDAARPASATSSPEIVP"
     gene            247158..247880
                     /locus_tag="HL653_01135"
     CDS             247158..247880
                     /locus_tag="HL653_01135"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004210636.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FadR family transcriptional regulator"
                     /protein_id="QJU56568.1"
                     /translation="MAARAGSLSDSLFRKLEERISSGEMAPGSRFPTQKEIAATENVS
                     RTVVREAVARLASQGLTTSRQGSGVFVAETAPYRAFQVTRDELGELADVIKLLEMRLA
                     VETEMASLAAARRTTANIGEIRDALTHMEDVGDDPAAAARADAAFHLAIARATQNDYF
                     VRLIDFLGIRLVPPRNLYLRDQSTESHASYAAKVRGEHDALVDAIVRMDSAKAREAAR
                     HHMQESLSRHSQLSETAHLRGK"
     gene            248049..249341
                     /locus_tag="HL653_01140"
     CDS             248049..249341
                     /locus_tag="HL653_01140"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017977744.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="QJU56569.1"
                     /translation="MSAETTISEAAGRASRYRWAICALLFAATAINYIDRQMIGVLKP
                     VLQADLGWKESQYADIVFWFQAAYAIGFLFMGRFMDAIGARFGYAIAFGFWTLAHIAH
                     GLVRGVTGFAVARFALGLGESGNFPAGLKTVADWFPQRERALAVGVFNAGANVGAIVT
                     PLLVPAITLAYGWRAAFLITGLFSVVWIVVWLVLYRSPGEHRRVNAAELALIQSDPVQ
                     PAGRMAWTKLFTKRETWAYAVPKFLTDPIWWMFLFWLPDFLGKRYGLDLKTFGPPLVV
                     IYVMSDGGSVLGGWVSSRMMKAGASANRARKLTMLGCAVCVLPVVIVPNISSLWLAVP
                     LLGIVTAAHQAFSANLLTLPSDLFPRTAVGSVVGIGGTAGAIGGMLIAKFVGYMLEIS
                     NSYAPIFAVAGGAYFLAIIALHLLSPRLERASFDTPAS"
     gene            249353..250519
                     /locus_tag="HL653_01145"
     CDS             249353..250519
                     /locus_tag="HL653_01145"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017501130.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl hydrolase family 88"
                     /protein_id="QJU56570.1"
                     /translation="MIARTLALLLAASLPAAAPSAAIAAKPAAAAASQQAPLALAARL
                     ADWQLGRLDSAHVSRVTTETRNPRAWEQAVFWVGMTALADAGGPPNIAQAVQTMGKAN
                     EWLPARRPYHADDLVITQSYLWAAKHGAGPEAIAPTRKAFDFILANPAHVTLAFYQPP
                     EGYDQTECLKRWCWCDALFMAPPAMLELSRQTGDPRYKDFALEEFWATTAFLFDPAEH
                     LYYRDSRFFEKRDEAKNKLFWSRGNGWVFAGLARMIPLLPEGSADRKKLEALFVEMAV
                     KLKTLQKPDGYWAPSLLATAGSPPESSGTGFYTYGMAWGVKAGLLDKATYEPIARKGW
                     AALVKSLQPDGRLGWVQQVSDKPETVEPGDTQYYGVGAFLLAATAIDALDHPAR"
     gene            250537..251370
                     /gene="kduI"
                     /locus_tag="HL653_01150"
     CDS             250537..251370
                     /gene="kduI"
                     /locus_tag="HL653_01150"
                     /EC_number="5.3.1.17"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017501129.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-dehydro-4-deoxy-D-glucuronate isomerase"
                     /protein_id="QJU56571.1"
                     /translation="MFEKTFYATHPDMMECVSNEELRDRYLVSDLFRTGEIVLTYSHG
                     ERFIIGGAVPGATPLALPVQAEPESAKGHPLLERRELGIVNIGGPGTVTVDGEEIALD
                     KYEALYVPMGTTDVVFAGEGARYYLLSVPAHKAFPRKKMTRADAATMQRGSLETSNER
                     DIYQLVLPHTCSSASLCLGMTILRPGSVWNTMPPHVHERRSEIYLYFDLQDDDRIFHY
                     MGQPDALRHIVMENEQVVISPPWSVHMGSGTRAYAFIWAMAGENLDYEDMDVKDVCQL
                     R"
     gene            complement(251499..253955)
                     /locus_tag="HL653_01155"
     CDS             complement(251499..253955)
                     /locus_tag="HL653_01155"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008831465.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF5117 domain-containing protein"
                     /protein_id="QJU56572.1"
                     /translation="MAYFGFGRSIARAALAWGLLAGCATAALAAPEAVATSKDGALLP
                     VSVDRADGRMLVTLPPMAADGTYGRFLYATVLRTGLGSATVRLDRAMNGPTHVLAFRR
                     FGKKVAAVFENPQFRASGTAAVEAGAKGSFPESIVWMGDIVSQGPAGVTVDLSSFFTQ
                     DVMDIAATLNSETSGFRLSEALSATDAGSVKVFPDNIEVDAYQTFVADKPGKQVTMIA
                     SEPRKVSLIVHHSLVRLPGPGYTPRRYDIRTGGFFAPVYDYGTPLGQPIVNDLAARFR
                     LEKTDPNAARSAVKKPIVFYIDDAAPEPIRTALEEGVSWWNQAFDAAGFVNAFQVKPL
                     TPDIDPLDIRYNVVNWIDRLTRAWSWGQWVIDPRTGEIVKSSVILGALRVRQDITIFE
                     SLVGKDQENTGGPNDPSRAALARIRQLGAHEVGHAIGFVHNFAGSMQGRISVMDYPGP
                     RIGLKDGQIDLSDAYATGIGTWDKFTVDWLYGQPKPGEDAEKVAEAKAAAMEKTGMIF
                     STDIDGRAPETPSPTANMWDDGTDSVGELAKLMEVRRIGLARFGPQVLNPGEPLSNLR
                     RVFVPLWLLHRYQMDAAAKLVGGVDYPYGVAGGNRPMAKVVPAADQAKALSGLLATLS
                     PDALTVPAKLLPMLSMGVNGRSDPQFDNEVFANAGSAVFDPLVATDVAARQMLETLLA
                     PERLTRVYEQKLVDPGQLGLDTVLDRLTATVVDRHATAVERQIAYRAVLTLARTRMNP
                     KTSPNVALLLEGRLRGFADRFGAAKGESEEALWSRGLAALLRDKEALRAALADKADQA
                     RIPPGMPIGGSGGWFDDLDS"
     gene            254210..255742
                     /locus_tag="HL653_01160"
     CDS             254210..255742
                     /locus_tag="HL653_01160"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009820383.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)/FAD-dependent oxidoreductase"
                     /protein_id="QJU56573.1"
                     /translation="MPHTAPSLSVDVAIIGAGPAGLTAGYLLSKDGVRVAIAEQDPHQ
                     VGGISRTVEHEGFRFDIGGHRFFSKSREVVALWDELLPDDFIERPRMSRIYYGGRFYS
                     YPLRAFEALRNLGLLRSAACMASYFRSRAFPRRAVRSFEDWTVNQFGAKLFSIFFKTY
                     TEKVWGMGCDEISADWAAQRIKGLSLGAAVIDGLKRSLGLHRKPNDGQAAKTLLESFR
                     YPRRGPGMMWDAARDRIVEAGGDMLMGHRLHRLSREGDGWRMIVRGPDGERTIRAKHV
                     ISSAPIRELIPRIHPLPATAPRATALRYRDFLTVALKIRSPDLFPDNWIYIHEPGVKV
                     GRIQNFRSWSPEMVPAEDVACVGLEYFCFEGDGLWSMPDADLVALATREMATLGLCDP
                     ALVIGGVVVRQEKAYPIYDDAYADHVAAIRADLEAHCPDLHLVGRNGMHRYNNQDHAM
                     MTAMLTVRNILAGQPLYDIWDVNEDAEYHEGGRMGEADGASDDPRAALASVRAVPRRI
                     AA"
     gene            255750..257516
                     /locus_tag="HL653_01165"
     CDS             255750..257516
                     /locus_tag="HL653_01165"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56574.1"
                     /translation="MTAARRPFWRWLLLVWIAAAIFLIACFRSAIATFRLADPDDVLR
                     LVEVRDWLGGQGWFDVSQHRMNPPHGLSMHWSRLLDLPIAACLSLARMVADQRTAETL
                     AAVIVPLVTLGLAMALVAALTRRLTAEGAERGPALLAAAFCTISVAAWYALRPMRIDH
                     HGWQIVAGLGVAVALTGRPTRRNAAIAGACAALWAHISLEALPFAAAAGAWLGLRAML
                     GARDDARRLSAYLAALTVAAAALTLAIKGPSAFAGLQCDSLSTVHLAALGGATLASLA
                     AERAPLRARWIILVAAAGADALFYRWGAGPCAAGPFGQLGPLGARLWYRSVNEGQPIW
                     RLSSELVLLWGLLPIVGLAGAAIVRRPMAPGPRREALTTYIVLLLAATGVGLLVMRAL
                     AFANLLALPGAMIALAVIARTCDRRARAFRILILTGSAILFSPLGPALAAALVSSERP
                     APQPPAPPAPACGRIDDYAVLNRLPPAIVIAPIDAGPALIAATHHRAITGPYHRDPQA
                     LEDLLRFFTAPPAEARTIAAVRHAGLLAFCPGAHDLGVMADSAPTGLAAALRRGAVPP
                     WLTRLDPARTAPLQVYRIAGPR"
     gene            257607..258320
                     /locus_tag="HL653_01170"
     CDS             257607..258320
                     /locus_tag="HL653_01170"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020163689.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PEP-CTERM sorting domain-containing protein"
                     /protein_id="QJU56575.1"
                     /translation="MKTIFAAALAALALGTSAGAAVTYHVTVDTSSQIGKAGYIDLQF
                     GAGCLGGGCNPQLATALVSGFTTDGTLQPFDGNDPNDLAEGTTGTLPTGVSFDNQTFT
                     PSDFSQAIIFGSSLSFAVTLSGPAIESPLNDGGNYVGTAFLFDFGNADFSDFYFSQND
                     GGPFGFLAGALHIQQDGSVLVVANPSSQDYTQSSGLSFTTITAASDVPEPASWAMMLA
                     GFGLVGGTMRRRKLTVSFA"
     gene            complement(258447..260723)
                     /locus_tag="HL653_01175"
     CDS             complement(258447..260723)
                     /locus_tag="HL653_01175"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010335887.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent receptor"
                     /protein_id="QJU56576.1"
                     /translation="MLLSNTAMARCLALIGMATIGGAAFAQAAPATGEAAEPAAAPAS
                     DASSAGDIVVTAQKRSQRIQDVPVAVQVLGGEALTSQGVRQFADLTKATPSLLIRPSE
                     QPVNNSISIRGIGTFAFSPSVEPSVAVQIDDVPVQFIARAFADLSDIDRVEVLRGPQS
                     TLYGRAASAGLINIITQNPTADLTGRIGGVVTTDREYAVNGAISGPLTDTLGFRLNAN
                     YDKFEGNVRNLGTGDRVNGFRTLSIKGKVVWDPTSNLNIAVSGGYIDGTTTIGRPFIR
                     LGAAARLRGVAAYDPSVFAPGIVATEDNTKVVNNINSGTNYTDYSASVRASLDVGFAS
                     LMSITGYDKFRQFDILDQDESAVAALDNRQFGTFRTHSWSQEFRLVAPGKNRFRYTLG
                     LYYSDLELSRVFQRGPFFSIANWYATNGTRQYAAFGQLEYDILPNTTLIGGARAGKNK
                     IDYRFTDYAATGVPTFAGNDSANYETYKAGVQQKFTPDIMGFVTFATGYKGQAYDIGT
                     GFNLVRQNSGPVQPERSKDWQIGLKTQFFDRHVTFNVTLFDTRFKNFQAQGIETLSDG
                     TTNFRLANVGRLRTKGVEVEASWRAATDINFSGGVTYNDAKITQFLGAQCYPNQTAAQ
                     GCVGTPARQNLAGFRPPQAPKWKLAASGEYTPSLTQSLDGVLQASYSYQSAINFSINQ
                     DPQTYQPGYGIANLSIGVRAPDRKWEAVAFVNNLFDKHYFSNMNNDTGNHANQLATLG
                     YLARDYNRYGGVRVSYKF"
     gene            261094..262671
                     /locus_tag="HL653_01180"
     CDS             261094..262671
                     /locus_tag="HL653_01180"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014507538.1"
                     /note="Members of the Solute:Sodium Symporter (SSS), TC
                     2.A.21 as described in tcdb.org, catalyze solute:Na+
                     symport. Known solutes for members of the family include
                     sugars, amino acids, nucleosides, inositols, vitamins,
                     urea or anions, depending on the system; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium/solute symporter"
                     /protein_id="QJU56577.1"
                     /translation="MQLATLDIAIVVLYGFAIFGLAQYVSRDKAGAGPKNTTDYFLAS
                     KNLPWWAIGASLIAANISAEQIVGMSGSGYAIGLAIASYEWMAALTLLIVGKFFLPIF
                     LRNEIYTMPQFLERRYGPAIRTLMAVFWLVLYVFVNLTSIIWLGSIAVTKVAGVDQTV
                     ALIGLGAFALLYQLRGGLKAVALTDIVQVTLLILGGLIIAYLTLTQIGAGAGVFAGWH
                     KLVTTAPDHFHMILKKGDPHYADLPGLSVLIGGMWIANLSYWGFNQYIIQRALAAKDL
                     PEAQKGVLFAAFLKLLMPLIIVVPGIAAVLIAPGLERPDEAYPAMMRLLPTGLLGLVF
                     AALIAAIIASTASKINSIATIFTLDIFAKLPSQQGAKDNEQKLVTIGRIAAVVAIILA
                     VLTARPLVGQSEQAFQFIQEFTGFFTPGITIIFLLGLFWKRANQAGAIVAAIASVVLS
                     WAFKELLPDLPFMDRMGVVFLVSLVLSVVVSLATPASGDRDVIKMGDVTYGTRATFNV
                     GALAVVLALIALYATWW"
     gene            complement(262931..263308)
                     /locus_tag="HL653_01185"
     CDS             complement(262931..263308)
                     /locus_tag="HL653_01185"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006961955.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YdbL family protein"
                     /protein_id="QJU56578.1"
                     /translation="MTTKQLLISGLIGLSLLTGAPALAQMDSEVEAALEAGTVGEQAD
                     GYMGFARAPAGGLKAKVDAINIKRRQGYTQIAQSKNVPIEAFAASIGCRTLEGLKTGR
                     AYNIGGAWAVKSGPITLPAQCGA"
     gene            complement(263305..263499)
                     /locus_tag="HL653_01190"
     CDS             complement(263305..263499)
                     /locus_tag="HL653_01190"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006961957.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YnbE family lipoprotein"
                     /protein_id="QJU60381.1"
                     /translation="MKRSGASPLIGLPAWLALSACVTVKAPDKPIEINLNISVKQEVV
                     VSLKKDADDFIANNPDLFPK"
     gene            complement(263517..266468)
                     /locus_tag="HL653_01195"
     CDS             complement(263517..266468)
                     /locus_tag="HL653_01195"
                     /inference="COORDINATES: protein motif:HMM:NF023167.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YdbH domain-containing protein"
                     /protein_id="QJU56579.1"
                     /translation="MRRRPRLWAVLGVLALALLLVWALRLRIAGLLVDRTLEAAQVPA
                     SYRITKVGPLLERMEDVRIGDPAHPDLVAKRIDVTIGYGWTGPVVRGVAVDGVRLTAR
                     LDGDGLHLGAIDRLLPRSGGKTELPDLAVNLRDVTLALDTPNGAIRVALTGAGNPTRE
                     FSGEARAEAGMLRLASCSLVHAVADMTVWTDAGNPHVAGPVALAGTGCPHFALGRGVL
                     RIQATSNKAFDRVQLEAQPFGFGGSAGPARFAGMAGSVEAAGTFGHLDAKGALSFAHL
                     ALPEQAGMVAGVAIPAGLPVTPTATRATRGIATLLRDAAARVEFDGAIEGLAASVRVR
                     RAMLAGADGARISATGGTGLRFAPSGWQLDSDVASGGGDLPPLRLRIRQAGEGAPLSA
                     TGRLDPFVAGDARLAAPRLTFNWEKGAARFDLLLGVDGPLGAGVVRGLTVPVGGSVAG
                     DGTFALDAGCRDVAFRELRQGGFVFDPAHLRLCGSPIASRKRGGAVRIDATVAPVRLT
                     GRSGASPMSLAADRARVTERGFDLANVVAMIGAPERVTHMEVATLQGGFGRQIGGTFA
                     GADGAIANVPLDLKGAAGDWTFAGGTLALKGALKVSDQAPEPRFHPLDAEAVTLDLTG
                     GTIMAAGILRQPSRHADVARVTIAHDLGTGAGHADLAVPGIAFAPKGLQPDQLTPLTL
                     GVIANVAGTVSGQGRIVWGSDGVTSTGIFGTEHLDLAAAFGPVTGIKGQIQFTDLLGL
                     VSAPAQTIHIAELNPGVAVNDGIVHLQLTGNNRVAIEDATFPFAGGNLLLDPATLDFS
                     KAAERRMTFRVKSVDAAAFVQQLDFPNLAATGLFDGELPMIFDDNGGRIEKGYIAARG
                     GGTLAYVGELSSAQIGTMGKLAFDALKAIRYSALDISLDGRLDGEMVSNVRFTGVREA
                     TPEQSLITRLIRNLPFRFNIAIRAPFRGLVGTARTYMDPELLLQSVRPTSPATTPAEP
                     PIQAPVSGVVR"
     gene            complement(266873..269815)
                     /locus_tag="HL653_01200"
     CDS             complement(266873..269815)
                     /locus_tag="HL653_01200"
                     /EC_number="6.1.1.9"
                     /inference="COORDINATES: protein motif:HMM:NF004349.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="valine--tRNA ligase"
                     /protein_id="QJU56580.1"
                     /translation="MTIDKTFDPATIEARWYPHWEQSGLFRPERGEAEPFTIVIPPPN
                     VTGSLHIGHALDNTLQDILVRHARLQGKDALWVVGTDHAGIATQMVVERNLGAQGIKR
                     QELGRDGFIEKVWEWKAESGGQITRQLRRLGASCDWANERFTMDEGFSKAVVKVFVEL
                     YRQGLLYRDKRLVNWDPHFRTAISDLEVETKEINGKFWHLAYPLADGSGTITVATTRP
                     ETLLADMAVAVHPEDERYTALIGKKVKLPITGRLIPIVADEHADPALGSGAVKITPGH
                     DFNDFEVGVRAGIKPAEMLNMLDAEAKITQTADGLIPIDLIGMDRFEARDWIVKLLEE
                     DGILLKVEDRVIQTPYGDRSGVVIEPWLTDQWYVDAKTLAGPALEAVRSGAIRVVPET
                     WKKTWYQWLENIQPWCVSRQLWWGHQIPVWYGPKKTGPRTTVESSDRANLEPFVAATE
                     EEATELARAYYGSEFAVLTSDDAPWTTEPGQGFDVETTVSEQEHYVPVTIHRDPDVLD
                     TWFSSALWPFGTLGWPEQTETLKRHYPNDVLISGFDILFFWDARMAMQGLHFMKEVPW
                     KTLYLHGLVRAPDGSKMSKSKGNTVDPLGLIDKYGADALRFTLAAMESQGRDIKLDEK
                     RVEGYRNFATKLWNAARFAQSNGIGGSTTIEPPKATLAVNKWILGEAVRTIQALDLAL
                     ADLRYDEAANTIYHFVWSQFCDWYLELIKPVLSPGNAPSSVGAEPVEAPSFSSADGEE
                     GSAAPFDCPPAAGAQDRLRQAQGERGGVEADETRAVAGWVLDQILILLHPFMPFITEE
                     LWHALAARDHDIIVAKWPMADARALDPEASAEVEWLIRAVQGIRATRSELNVPPGARL
                     PMYARGAGETTLARLAANAAPLGRMARVEIAEGEAAPGGAAQIVVDEATFVLPLEGVI
                     DLAAEKARLEKAAQAAEKEAASLSGRLGNPSFVEKAKPEAVAKAREDHAAKAAEAERL
                     RAALARLG"
     gene            complement(270016..270381)
                     /locus_tag="HL653_01205"
     CDS             complement(270016..270381)
                     /locus_tag="HL653_01205"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011504180.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator"
                     /protein_id="QJU56581.1"
                     /translation="MNSRKPAVLVVEDEPLILMSTIDAFEEAGFEAIDALDGEQALQR
                     LEERPDIRAIFTDVNMPGRYDGVELAHIAHRLCPQMVVVVTSGKMIVSRDSLPEGGHF
                     LAKPYRSSQVTGLFAHLLN"
     gene            complement(270460..272724)
                     /locus_tag="HL653_01210"
     CDS             complement(270460..272724)
                     /locus_tag="HL653_01210"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017978598.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prolyl oligopeptidase family serine peptidase"
                     /protein_id="QJU56582.1"
                     /translation="MKTILAAAIATVSLVTATTSPAAAPPAASASPATGLTLERLFQS
                     PGLAGPAPRLLKLSPDGKLATLLKNRPEDRDRYDLWAIDTTTGEQRMLVDSEKVGTGA
                     ALSEEEKMRRERLRIGALKGITAYDWAPDGKSLLVPLDGDLYLAGLDGSVRRLTNTPE
                     TEIEAKVSESGRYVSFVRGQNLFAIDLATGKEQQLTTDGKDALSWGTAEFVAQEELNR
                     FSGTWWAPGDQRVAVQRTDESGVKVVSRASIGADGTRVFDQRYPAAGTPNAVVQLWVM
                     NADGTARVQVDLGADPDIYLARVNWARDGKTLYVQRLSRDQKTLDMLKVDAATGKSTL
                     LFSETSKTWINLTDDFRALADGSLIWSSERSGTKHLYRWVAGKWIPLTRGAWTLETDG
                     QSFNAGLIGVDQADHRLFFTANKDDVLESQVYAIDYLKPGEPQRITERGWWNDAQMDR
                     TGQRLIIRRSSPTQPPQYYLADAAGKRLTWISENAVTGDHPYAPYLARHRETVFGTMK
                     AADGSILHWKMIKPTMEPGKHYPVFMEHYGGPHVQTVQRAWANPMGQYLASQGWIYFE
                     IDNRGSANRGRAFEDQIYHAMGTVEVEDQVAAAKWLKTLDYVDPAKVVTYGWSYGGYM
                     TLKMLEAAPGVFAAGIAGAPVTKWELYDTAYTERYLGDPTRLPKVYEKSDALADATAI
                     QDPLLVIHGMADDNVVFENSTMLFARMQEAKVPFEMMVYPGKTHGVSGEGAQTHVWGT
                     ILRFLQRTVETSPH"
     gene            272843..273526
                     /locus_tag="HL653_01215"
     CDS             272843..273526
                     /locus_tag="HL653_01215"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007667053.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56583.1"
                     /translation="MRRLYWAFLFAFAVMVAGFWPTTAGSSVPLGPLRIIHGSLAALW
                     MAMLVAQSFLAGRWKIKWHRRIGWASVAVVPALVVTAFLVVQDGLRHSTYFPRDLRLT
                     LTWIDLWSLILFTGLWGAAIAKRKRWPLHARYAGCTVFVAIIPALGRLLGINIPAIGG
                     LTGALHPSYWIVEAVLIGLIVRDVRKGGHLVPYAITLAGLVFLEATMFAAPHWGWFNA
                     FAEAIGPVG"
     gene            complement(273618..274745)
                     /gene="dnaJ"
                     /locus_tag="HL653_01220"
     CDS             complement(273618..274745)
                     /gene="dnaJ"
                     /locus_tag="HL653_01220"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015457241.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone DnaJ"
                     /protein_id="QJU56584.1"
                     /translation="MADVDYYELLEVERTADDKTIKTSYRRLAMQCHPDRNPGCSDSE
                     AKFKAISVAYDVLKDPQKRAAYDRYGHAAFQNGGGGGGHGAQGFEGFSDIFENIFGEF
                     MGGGGRGGGRSSVLRGADLRYDLEISLEDAFHGRTEQIRVDVAAACDTCHGSGAAEGS
                     APRTCGTCAGHGKVRAQQGFFVVERTCPTCHGRGQTISSPCGACHGEGRVEKTKTLEL
                     KIPRGVDEGTRIRMTGEGEAGARGGPAGDLYVFIHVTRHDLFQRDGTTLFAHAPISIT
                     TAALGGTITVPGLDGAAHEIRIPAGIQSGKQLRQRAAGMPVLNGRGQGDLVIQIDVET
                     PTKLTARQKELLEEFRSTETGEECPQASGFFTFLKDKLAGN"
     gene            complement(274893..276797)
                     /gene="dnaK"
                     /locus_tag="HL653_01225"
     CDS             complement(274893..276797)
                     /gene="dnaK"
                     /locus_tag="HL653_01225"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006956250.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone DnaK"
                     /protein_id="QJU56585.1"
                     /translation="MAKVIGIDLGTTNSCVAVMEGGSPKVIENAEGARTTPSIVAFAK
                     DGERLIGQPAKRQAVTNPDNTIFAVKRLIGRRFDDPVTKKDTELVPYHIVKGANGDAW
                     VQAGGEDYSPSQISAFTLQKMKETAESYLGETVTQAVITVPAYFNDAQRQATKDAGRI
                     AGLEVLRIINEPTAAALAYGLDKDTNKTIAVYDLGGGTFDVSVLEIGDGVFEVKSTNG
                     DTFLGGEDFDAKVVEYLAQGFKASEGIDLTKDRLALQRLKEAAEKAKIELSSTATTEV
                     NLPFITADATGPKHLVKQITRADLERLVEPLITRTIEPMKKALKDAGLSAGDIDEVVL
                     VGGMTRMPKVREAVKAFFGKEPHTGVNPDEVVAIGAAVQAGVLQGDVKDVLLLDVTPL
                     SLGIETLGGIMTKMIDRNTTIPTKKSQTYSTADDNQNAVTIRVFQGEREMAQDNKMLG
                     QFDLVGIPPAPRGVPQIEVTFDIDANGIVNVSAKDKGTGKEQQIKIQASGGLSDSDID
                     QMVKDAEQFAEEDKKRRASAEAKNNAESLIHSTESQLREHGDAVEAGLKSEIEGAIVE
                     ARAAVESNDAEKMTEKANALAQVAMKMGQAIYEKQQAAGGDAAAGAAPGAGQGEDVVD
                     AEFSEVDDNK"
     gene            277009..277458
                     /locus_tag="HL653_01230"
     CDS             277009..277458
                     /locus_tag="HL653_01230"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010164422.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="copper chaperone PCu(A)C"
                     /protein_id="QJU56586.1"
                     /translation="MTRIALLAAALAPLALLGGCDGHPAEPKVTHAWVRLPAVPGRPA
                     AAYFTVSGGRADETLVRVESALAKRIEMHESMGTGGMAMMKPLPSLPLPARSDTRFAP
                     GGKHLMLFDVDPVVTPGTAIPIRFGFASGKTAEAEAKTVAAGDDAPY"
     gene            complement(277653..278744)
                     /locus_tag="HL653_01235"
     CDS             complement(277653..278744)
                     /locus_tag="HL653_01235"
                     /inference="COORDINATES: protein motif:HMM:NF015338.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease/exonuclease/phosphatase"
                     /protein_id="QJU56587.1"
                     /translation="MGRVAKVAFHMMALVPFVFTIGGPSPASAPSPRAAAIAQPADAL
                     SILTYNVEGLPWPVRSGRDEAAARIAERLRGLRAKGAQPHIVVVQEAFGAAQRAIGAH
                     AGYRYIVEGPGADVRNRAAEAAADRTDRAYMASGSRLMGEGSGKWAGSGLLIFSDFPI
                     LGVTSTVFPDHACAGLDCLANKGAMIALVAVPGAPQPIALVATHLNAKTASGVSEARY
                     ARAFARQVDVLGAFLRAHLPPGLPYVMAGDTNIGRGSTRAGQFAAMLGSLARPDGHPP
                     IRTALVACLRRRGGCSVDAPEDARASRDKGKDLQIYAAGSVTALRPTAVTVPFGTEAD
                     GSMLSDHIGYAVRYAVERVPGSGLMIASR"
     gene            complement(279040..279576)
                     /gene="grpE"
                     /locus_tag="HL653_01240"
     CDS             complement(279040..279576)
                     /gene="grpE"
                     /locus_tag="HL653_01240"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010215966.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotide exchange factor GrpE"
                     /protein_id="QJU56588.1"
                     /translation="MTDETTAPEDLREQTAAEAPEVAEHDLTAKLEAEIEELRSKVLY
                     AQAETQNVRRRMEKDAADARAYAATSFARDMLSVSDNMARAIAAIPAAAAENESVKTI
                     VAGIAMTAKELENVFQRHGITKIEAVGHKLDPNKHQAMIELPSDQEPGTIVQEMQAGY
                     MIKDRLLRPAMVGVAKAG"
     gene            complement(279573..280607)
                     /gene="hrcA"
                     /locus_tag="HL653_01245"
     CDS             complement(279573..280607)
                     /gene="hrcA"
                     /locus_tag="HL653_01245"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010126640.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heat-inducible transcriptional repressor HrcA"
                     /protein_id="QJU56589.1"
                     /translation="MTSVPELGQRARDVFRMVVEGYLESGGPVGSRTISRFGGLNLSP
                     ASIRNVMQDLEEMGLLAAPHASAGRMPTETGLRLFVDGMMQTTTLSDEERAAIEAQVR
                     TGPLEEALAATSQVLSGLSACAGIVLVPRHEPVLRQFAFLPLSPGRAVAVLVGADGSV
                     ENRVMDLPLDVPPHALGEAANYMTAMLGGLTLAEAQVRLDDEIALGRSALDQAAQDLV
                     ARGLAVWSEDNSRRPVMIVRGAANLIDPVAAADLERVRQLLDEIEGKEEIARLLDSAR
                     GARAMKIFIGSENKLFALSGSSVIAAPYHGTDGRVVGVVGVIGPTRLNYARVVPMVDF
                     TARTLTRLMA"
     gene            complement(280775..282049)
                     /locus_tag="HL653_01250"
     CDS             complement(280775..282049)
                     /locus_tag="HL653_01250"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007679790.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="QJU56590.1"
                     /translation="MSAIARSLPLSARHRILAVVGVTFVALLVSAGSRAAPGVLMVPL
                     QTAFGWDRATVSASAAIGIVLYGLVGPFAAALMQSFGIRRTMICGLALMSVATFLSLG
                     MSKPWHYVLTWGVLSGIGSGAVASVMGAAVVNRWFATRQGLVMGLLSASTATGALVFL
                     PFIAWLSREGAWQPVAMAVSIACAALIPFVILFLPEHPGDVGTRRLGEHADAEAAPVR
                     RATDPLLAIRTLVMAAKRPVFWLLAGTFFVCGLTTNGLVGTHMIAFCGDHGIPPVQAA
                     GLLSLMGLFDLFGTAASGWLTDRYDPRRLLFVYYGLRGLSLMALPFLDFGAGSLTVFA
                     VFYGLDWIATVPPTVKLTNVAFGERDAPIVFGWVMVGHQLGAATAAFGAGLIRETTGT
                     YLPAFLVAGAIGVLASLVVLMGRVERKPLAVA"
     gene            complement(282046..282420)
                     /locus_tag="HL653_01255"
     CDS             complement(282046..282420)
                     /locus_tag="HL653_01255"
                     /inference="COORDINATES: protein motif:HMM:NF024212.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="QJU56591.1"
                     /translation="MTRFYDEAIAASGLSIGQFSLLRALSRNGPTPLSQFAEQMVMER
                     TSLYRMLAPLEARGLIAVTAGAGRARIAALTEQGRAVMEETRAAWEATQARFVQTLGE
                     EKWRTLHALLAEATHVAEEIAA"
     gene            complement(282651..283289)
                     /locus_tag="HL653_01260"
     CDS             complement(282651..283289)
                     /locus_tag="HL653_01260"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014848356.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="QJU56592.1"
                     /translation="MPEVIFPGPEGRLEGRFNPGPRPRAPVAMILHPHPQAGGTMNNR
                     IVQACYQTFVKRGFATLRFNFRGVGKSQGVFDNGIGELSDAASALDWVQSIHPEAQTT
                     WIAGFSFGAWIGMQLLMRRPEIKGFISIAPPANLYDFTFLAPCPSSGIIIQGEADEVA
                     TPLATQKLVDKLRTQRHITIHHDVIPGANHFFEHEMPQLMTSVDDYLDMRLK"
     gene            283405..284505
                     /locus_tag="HL653_01265"
     CDS             283405..284505
                     /locus_tag="HL653_01265"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007688787.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminotransferase class V-fold PLP-dependent
                     enzyme"
                     /protein_id="QJU60382.1"
                     /translation="MSAPRIYLDHAATTPLSTAAREAMADALGRWANPSSPHAEGRAA
                     RAALEGARSRIKAALGWTHDLIFTSGTTESAQIALTRQSRERPCIVSAVEHASVLRQR
                     ADAIVAPVGADGLVEPLAFGALMHAHPQALVAIQHGNSETGILQRIDEIVEVVDAAGG
                     VLFVDCAQTAGKLPLPPADLIAVSAHKLGGPPGIGALLVRDMGILAPLGGGQERGYRA
                     GTENLPAILGFAAALDPALAGAQPPWLLEQIEWRLALETTIARSGGLPVGGDLLGGTA
                     RTPTIAAYRLPGMSAEAQLIRLDAAGFAVSAGSACSSGSLHTSHVLGAMGLTEAEARE
                     VIRVSFGWSTTRAEVEAFAAAYAQMAGGRRSA"
     gene            284502..285614
                     /locus_tag="HL653_01270"
     CDS             284502..285614
                     /locus_tag="HL653_01270"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011950905.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine desulfurase"
                     /protein_id="QJU56593.1"
                     /translation="MIYLDYQATTPLAPEAREAMRPLMEEAFGNPHSPHRMGREAKAA
                     VEVARERIAAPFGPGGRLAFTSGATEALNWAIKGIATPLRNTRPRIVTTAIEHAAVLD
                     TLGWLATQGHEVIVLPVSPEGIVDLDAAAAAIDDRTALVAAMLVNNEIGTVQPIAELG
                     ALARAAGAVMLCDAVQGYGRVPLPADACDLIALSAHKIHGPKGIGALWLRDGIVPEPL
                     LHGGGQEAGLRSGTLAPALCAGFGMAAKLMGERAGEDALHLARLFVHARSLLDGWTIN
                     GAVDRRYAGNLNIRRDGLDVARLMSDVREVMFSAGSACASGSGRTSHVLRAIGLSDAQ
                     AKSSIRLGFGRYTAEEDLERAIRLILAAAERQKAWA"
     gene            285611..285946
                     /locus_tag="HL653_01275"
     CDS             285611..285946
                     /locus_tag="HL653_01275"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019832980.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2Fe-2S iron-sulfur cluster binding
                     domain-containing protein"
                     /protein_id="QJU56594.1"
                     /translation="MSVTITFVAVDGRTEIVEAAPGSRLLEVAQNAGQPLEGTCEGQM
                     ACSTCHVIVDPADFVRLPRASEEEDDLLDLAAHVTRTSRLACQILLDEALGSLTVRMP
                     AGARDMQGR"
     gene            complement(286136..288934)
                     /locus_tag="HL653_01280"
     CDS             complement(286136..288934)
                     /locus_tag="HL653_01280"
                     /EC_number="2.7.7.59"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010544327.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="[protein-PII] uridylyltransferase"
                     /protein_id="QJU56595.1"
                     /translation="MTTRFDHLPARRAIIDRRAIADALEALPTADATTLRLSATPVLR
                     EALAAGRDEIARRLAESPSSGNEIAASYAFLTDQILRLAYDFTTQRLFPNHHPSAGER
                     LALAAVGGYGRGEMALHSDIDIAFLTPWKQAAWAEQVIESMLYTLWDLGLKVGHSSRS
                     IDEMVRMANGDLTIRTALLEARYIWGDQALYDEAGRRFEKDVMASTARAFVAEKLAER
                     NARHERMGDSRYVVEPNLKEGKGGLRDLHALFWIGKYAYQVRDVGDLVERGLLTDQEL
                     RRFRKAENFLWAVRCHLHILSRRPEDRLTFDVQAEIARRMRYADRPGKSAVERFMQHY
                     FLIAKEVGDLTAMFLAHLDETFAAKGRRFGITLIGRKPRKLEGFVLDRGRLAAPSDTF
                     FAENPVRLLELFALADKHQLEVHPLTLRMAGRDAKLIDNQVRADPVANRHFLQVLASR
                     RDPERVLRTMNEAGVFGRFVPDFGRVVAQMQFDMYHHYTVDEHTLRAIGLLSRIERGL
                     LEEAHPGAAKILSQVVCRRALYVAVLLHDIAKGRGGDHSTLGAEVARKLCPRFGLKPA
                     ETETVAWLVEQHLLMSATAFKRDLADFKTVLDFAERVQSPERLRQLLLLTTVDIRAVG
                     PGVWNDWKRQLLGTLFHAAEEVLRLGHQQTGRNERIKLKQAELGVELGWSRQRFDAYR
                     KRFPDSYWVAEGVDILERNARLISAADAGEKPLSIATQPDPQRGATLVTIYAADHPGL
                     FYRVAGAIHLAGASIIDARIHTTRDGMAIDNLLVQDPFGKPFDDPMRLRRLATAIEDA
                     LANRSQLAAKLATKPSPRTRAEAFVVEPNVLIDNRASNRYTVVEVNAHDRPALLHALA
                     YALFQAKVTIRSAHVATYGTRAVDTFYLTDLLGDKIEGAVRLRTLERLLLAAAGGGEP
                     EPEEEAPKREREKEKVKV"
     gene            complement(289024..289725)
                     /locus_tag="HL653_01285"
     CDS             complement(289024..289725)
                     /locus_tag="HL653_01285"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007405733.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SIMPL domain-containing protein"
                     /protein_id="QJU56596.1"
                     /translation="MFRYATIALAAMTPVAALHAEDGPRLTGTRLDITATGEVMRAPD
                     VATIGAGVVTQAATASQAMADNARRMTATIAALRKAGIADRDIRTASLRLSPQYRYVD
                     NQPPQLTGYQASNQVTVRFREIAKAGGILDALVAAGANQIDGPNFAVDKPEAALDEAR
                     TQALATAKARADLYARAAGLSVKRIVAITESTNVQSPIRPMMAMSLRAKADSTPVEPG
                     EETLGITLQVTFELQ"
     gene            complement(289791..291689)
                     /locus_tag="HL653_01290"
     CDS             complement(289791..291689)
                     /locus_tag="HL653_01290"
                     /inference="COORDINATES: protein
                     motif:HMM:NF012301.1,HMM:NF012722.1,HMM:NF014567.1,
                     HMM:NF017077.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator"
                     /protein_id="QJU56597.1"
                     /translation="MVEATPRKIPLMSLAGLGIVIVAGLIALLIASGVSSSNRWADHS
                     VQVQTRIVELGERLATHDGALRGYMISREPAMRDDMRDSRHDILLRVAELRELLRDNE
                     PQLREIDAVAPLIRQRLIYGEHMSAERDHKPLYAMNLSAAQPGSLPLILAIRQHLGRM
                     FATESALLAARQKQAQQRTALLSIGLVATVLLVVVIAYLTISEAQARSLSIEAAHREA
                     RAAAEAAESEMRAREQVEEQLRHIQKMESIGQLTGGIAHDFNNMLAVVIGSLDMARRR
                     IDDPDRLQRSLASAMEGAGRAASLVSRLLAYSRRQSLAPAAVDPNRLVGDMSNLLGRT
                     LGEGIEVETELAGDIWPTFVDPLQLENAIVNLAVNARDALGGRGRMTIRTGNATLDEG
                     YIRSHPDAAPGDYVMIMVRDFGSGMPPDVLARAFDPFFTTKGVGRGTGLGLSQVFGFV
                     KQSGGHIGIESVVGHGTTIRLFLPRHEAAPAIVREPAPVAGPAPVRGGERILLVEDDD
                     RVRQFSRDAVADLGYVVTAAPDGVAALALIEQSPDYAILFTDVVMPGMGGTELAAAAR
                     EKQPNIRILYTTGYAHEAIAREGLLEPGVDVLLKPFTVAQLAQKLRDVLDKAGPDAVQ
                     AAASGGNA"
     gene            complement(291736..293886)
                     /gene="ligA"
                     /locus_tag="HL653_01295"
     CDS             complement(291736..293886)
                     /gene="ligA"
                     /locus_tag="HL653_01295"
                     /EC_number="6.5.1.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017499913.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent DNA ligase LigA"
                     /protein_id="QJU56598.1"
                     /translation="MSPVELPLESTDREKAAARLEQLAAEIAHHNRLYHDQDAPEISD
                     GDYDALIRENLALEGAFPDLVRADSPNAQVGAEPTSALGKVRHAVRMMSLDNGFSDED
                     IAEFIARVRRYLALPEDAVLALTAEPKIDGLSCSLRYEKGHLVQAATRGDGTTGEDVT
                     ANVRTIADIAQTLSGDDVPDMFEVRGEVYMAKEDFAALNARLLAEAEDPEKARRFANP
                     RNAAAGSLRQKDPAVTASRPLRFLAHGWGEVSALPAETQTGVMRAIERWGLPVSELLT
                     CVDTLEALVGHYRMIEAKRADLPFDIDGVVYKVDRLDWQQRLGFVAKAPRFAIAHKFP
                     AERAQTTLEAIDIQVGRTGKLTPVGRLVPVTVGGVVVSNVTLHNADEIARLGVRPGDR
                     IVLQRAGDVIPQVVDNLTRDEDRAPFVYPDHCPVCGSEAVREEGEVDIRCTGGLICGA
                     QRFERLRHFVSRGALDIEGLGEKTIEEFLALGWIREPADMFRLAAHREELLGREGWKE
                     KSVDNLLAAIEAKRAPDAARLLFGLGIRHVGIVTARDLLKRYTTLPAIRALADELIAL
                     RDNFLRALGEEDGRFRTRMDKAIAELIGVENVGAAVGHALADFFHEPHNVQVWADLLA
                     EVSPPDFIVETQASSVSGKTVVFTGKLETMSRDEAKAQAERLGAKAAGSVSAKTDLVV
                     AGTDAGSKAKKAADLGVRVIDEAGWAEIVRSAGI"
     gene            complement(293873..294886)
                     /locus_tag="HL653_01300"
     CDS             complement(293873..294886)
                     /locus_tag="HL653_01300"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019369966.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arginine N-succinyltransferase"
                     /protein_id="QJU56599.1"
                     /translation="MRAVVRAARSADLESLYEMAKLTGGGFTNLPADRDALAERLAAS
                     EAAYARDEDALGDDVYLLMLEDLETKRIAGTAQIITRTGQKGSFHSYRRTTLTQHSAA
                     FGRSFRAEMLVMTNDLEGCSEVGGLFLHPRYRAGGLGLLLARSRYLFIKHHRARFADK
                     LIAELRGVIDEGGGSPFWDGVGGRFFQMSFREADDYNAVNGNQHLADLMPRHPIYLAM
                     LPETARAVIGVPHGTGRAAMRMLEHEGFIDEGYVDIFEGGPTMTVMVDRLKTIREARE
                     TCVASIGEGGGVRSILAAGRLRDFRASFALLAETVAGLEIDGQAAEALALRPGHEVLH
                     VAR"
     gene            complement(294886..295887)
                     /locus_tag="HL653_01305"
     CDS             complement(294886..295887)
                     /locus_tag="HL653_01305"
                     /inference="COORDINATES: protein motif:HMM:NF016241.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF481 domain-containing protein"
                     /protein_id="QJU56600.1"
                     /translation="MSGAALMMALAGALGPELSFETLPAPRLPYAPEAPVVEQPMLVL
                     APPPPGLPAPVRTMIEAAYKTGNDKTISDVVGLAKDNFPTYIAEINGVAQVQAERLAG
                     VRKEAQEKEQARIMAASFLQIWKGELEAGGSRSTGTTRTTSIYASAKLQRDGIRWRQK
                     FNARLDFQDTDHERTTERWLAAWQPNYKFNDSRYAYGLAQYEHDRFLGIQARGTFGTG
                     VGFLVASRSNLNITLEGGPAIRRTVYIDEANTTRLAGRASISAMWQISPTLTFRQDAA
                     FFFEGDDATASNTTALETKLLGALKAKLSYNLQFERETPTTSRQLDTVTRATLVYGF"
     gene            complement(295884..296363)
                     /locus_tag="HL653_01310"
     CDS             complement(295884..296363)
                     /locus_tag="HL653_01310"
                     /EC_number="3.6.1.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017978927.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA pyrophosphohydrolase"
                     /protein_id="QJU56601.1"
                     /translation="MRDLPYRPAAGIMLLNEAGKVFVARRIDTTAEAWQMPQGGLDPG
                     EDAQAGALRELEEETGIPADKVAVIAEAAEPLLYDLPADLQKKVWGGKYRGQKQHWFL
                     LRFLGRDDEIDLDTKHPEFNAWKWAEPAELPVLIVPFKQQLYRDVLAAFADHLAKPA"
     gene            296515..296928
                     /locus_tag="HL653_01315"
     CDS             296515..296928
                     /locus_tag="HL653_01315"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56602.1"
                     /translation="MRPVDLLAFVFAGLAALPAIAQTPPPAPVPQRRPTNLPGVSPQG
                     NAILTKLDSQGDPQYAQLKHQQTGLKDQLSNAIMVPTIDVDRVAGIMRQMDVVQGAMR
                     TRASERVLAALKALPEADRGPFLRAIAKQVGPAAN"
     gene            297157..298530
                     /locus_tag="HL653_01320"
     CDS             297157..298530
                     /locus_tag="HL653_01320"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017978944.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyribodipyrimidine photo-lyase"
                     /protein_id="QJU56603.1"
                     /translation="MTAPTLVWFRQDLRLSDQAALAAAASEGPIVALYVLDDDGPGDW
                     RIGGAQRWWLHHSLTALAKSLGRHRIPLILRRGEAVTAVTAVAKESGATRVHALRHIE
                     PWWQAAEEALAGTLDLVLHPGQQLADPGEIRTGAGGRYRIFTPFWRALAATLPPPKPQ
                     PAPKHLHGHGEIRSDRLEDWDLLPTKPDWAKGFDVWTPGEDGAAEAMEDFADRVSAYD
                     HDRNMPSIDGSSRLSPHLHFGEISPAAVWHAAHDAAPHSADPFLREVGWRDFTANLVD
                     QYPKIGRQNGRDAYDRLPWRTGAAADRDFHAWTEGRTGYPIVDAGMRQLWATGWMHNR
                     VRMIAASFLTKHLLLDWRRGERWFWETLVDADYGNNSVNWQWVAGTGIDSNPFGRIMA
                     PLTQSPKFDAADYIRLWVPELRDLPDTTIHDPHGAGCAPKAYPAPLIGHREGRERALA
                     AAAKIKT"
     gene            complement(298657..299367)
                     /locus_tag="HL653_01325"
     CDS             complement(298657..299367)
                     /locus_tag="HL653_01325"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015460155.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SDR family NAD(P)-dependent oxidoreductase"
                     /protein_id="QJU56604.1"
                     /translation="MTRPLENQIALVTGASRGIGAATAKALAAAGAHVLLVARTTGGL
                     EETEEAIHAAGGSSTIAPLDLTDGNSIGRLAEAVAGRWEKLDLLVINAATLGTLSPVP
                     AIDPKEYAKLLTLNVGAPQALIAAFDPLLRKSARARVAAITSSVGARPRAFWGAYGSS
                     KAALENLILSYGEEMQALGDLRVAIVDPGGTATAMRAKAFPGEDPATLKSPDVVGGAI
                     AALLASDFATGHRMRVEG"
     gene            complement(299525..300994)
                     /locus_tag="HL653_01330"
     CDS             complement(299525..300994)
                     /locus_tag="HL653_01330"
                     /EC_number="2.4.2.14"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015460156.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidophosphoribosyltransferase"
                     /protein_id="QJU56605.1"
                     /translation="MLTTNPFETIDGDTLREECGVFGVYDAESASAIAALGLHALQHR
                     GQEAAGVTSWDGHNFHTHRAMGHVAGNFDRDDIIRALPGRVACGHVRYSTTGETALRN
                     VQPLFAELASGGFAIAHNGNISNAMKLRRDLIRTGSIFQSTSDTETIIHLVATSTYRT
                     LIDRFIDALRRVEGAYSLICMTPEGMIACRDPLGIRPLVMGKLGDATIFASETVALDV
                     VGADFVRELEPGELVTVSEAGVRSISPFGKARGRPCVFEHVYFSRPDSVLDGTSVYSV
                     RKAIGAELAKEGPVDADFVIPVPDSGVPAAIGYAQESGIPFELGIIRSHYVGRTFIQP
                     ADNIRHLGVKLKHNANRALIQGKRIVLIDDSIVRGTTSLKIVQMMRDAGATEVHMRIA
                     SPPTRHSCFYGVDTPERAKLLAARMTVQQMADFIHADSLGFISVDGLYRALGEEGRNA
                     AQPTRCDACFTGDYPTPLTDHDAQTVPDQFALLDERVLA"
     gene            301208..301567
                     /gene="hisI"
                     /locus_tag="HL653_01335"
     CDS             301208..301567
                     /gene="hisI"
                     /locus_tag="HL653_01335"
                     /EC_number="3.5.4.19"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015460157.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosyl-AMP cyclohydrolase"
                     /protein_id="QJU60383.1"
                     /translation="MDDRETGTTLMPRWDAAGLVTAVVTHAETGEPLMLAHMNAEALD
                     RTIETGEAWFWSRSRGRLWKKGESSGHVMKVVELRVDCDQDAIWLRAEPHGPACHTNA
                     PTCFYRRLQDGALVRVE"
     gene            complement(301939..303996)
                     /locus_tag="HL653_01340"
     CDS             complement(301939..303996)
                     /locus_tag="HL653_01340"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011952265.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S9 family peptidase"
                     /protein_id="QJU60384.1"
                     /translation="MTPADLPPAPRATRIPHETAVHGITLDDPYHWLKDPLYPEVKDE
                     AVLSYLREENTYFEAAMAPRADLVEAIFQEMKGRMKEDESSVPQKDGEYLYWWAYETG
                     SQYPRRWRKPVAGGPDQLLLDEAAEAEGKAYFRLAAFSVSPDGRLLAWSADESGAERF
                     TLRIRDLATGADVETVSAVTNGGVVWSSDSKALVFTEVNDNWRSYRARLHRLGADPAE
                     AVTLYEEADEGFRVAVGGTQDRQWIQIATGDNQTSEIRMVPAGDPSAEPLLVSPRQVK
                     RQYSVDAAHGIFWILTNDDHVNFRLASADPATPGAWETVIAGSDDTYLTGIASFARHI
                     AVAARIDGLDQLLLRTYEGDTHRVAFPEASYSAGLGNNPEFDPAAYRIGYSSMVTPST
                     VYDYHPAEHRLEVLKVQEVPSGYNPSRYATERLSVPARDGKAIPVSIVYPKGFPKDGS
                     GKVFLYAYGAYGHAIPPSFSTGRLSLLDRGWAYAIAHIRGGDDLGYTWYLQGKATERW
                     NTFHDFSDAAKGLIAQGFAKAGGIAINGGSAGGELMGVVANTDPDLWGAVVADVPFVD
                     VLNTMQDESLPLTPGEWPEWGNPITDPEAFRLILSYSPYENVAAKAYPPMLITGGLND
                     PRVTYWEPAKWAARLRATKTDEALLLLKINMGAGHGGKSGRYEALRERAEAFAFVIDQ
                     MGG"
     gene            304202..305098
                     /locus_tag="HL653_01345"
     CDS             304202..305098
                     /locus_tag="HL653_01345"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012347345.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dienelactone hydrolase family protein"
                     /protein_id="QJU56606.1"
                     /translation="MAEMPESTAFSREILDLFDAFVHGGISRRGFIEKATTLTGSVAA
                     ATTILSALSPDFASAEVIAPADKRITVETVTIPSPQGDGTIKAYVAKPAGTSPKKKKP
                     VVLVVHENRGLNPHIEDIARRLAVDGFIAVAPDALTSLGGYPGTEDEARALFPKLDQA
                     KVQMDFLAAAAYAQALPDGTGKLGAVGFCYGGGIVNMLATKVPTLRAAVPFYGAPPKL
                     EDVPAIKAELLVQHAGNDTRLAGTWPDYDKALTAAGVRHEGFIYPGVEHGFNNDTTPR
                     FNKAAADLAWNRTIALFKRTLA"
     gene            305331..307124
                     /locus_tag="HL653_01350"
     CDS             305331..307124
                     /locus_tag="HL653_01350"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013038804.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminopeptidase P family protein"
                     /protein_id="QJU56607.1"
                     /translation="MSSHTDRLAALRDELARRRLDGFVVPLTDEHMSEYVGAYAQRLA
                     WLTGFEGSAGSAVVLPAEAAIFTDGRYTLQVREQVDGTNWSYQSVPQTSVAQWLGEHA
                     KEGARIGYDPWLHTRGWVIQAAKALRAKGAELIAVETNPVDAVWPDKPLPSAARLVVQ
                     PDDLAGKNSVEKRAEMADWLTAQGADAAVLSALDSIAWTFNVRGADVDRTPVALAYAL
                     VGADGTADLFVAPDKLTDEVRQHLGNAVRLHPRHAFADYLSALGGKRIVADPDRAVAA
                     IFGTLEQAGARILPLRDPAVLPKAIKNGAEMAGHRAAQARDGAALSRFLHWLSVEAPK
                     GGVTEISAQEKLLSFREETGRLRDLSFDTISGAGPNGAVVHYRVSEESNRPLEIDSLY
                     LVDSGGQYQDGTTDVTRTVAIGTPTAEMRDRFTRVLKGHIALATAIFPEGTRGGQLDT
                     LARQFLWAAGLDYAHGTGHGVGAFLAVHEGPQRIAPVGGAFVGGDEPLQAGMILSNEP
                     GYYKTGEYGIRIENLVLVGPREAPGAEKKILGFETLTFAPIDRALIDLDLLTPAERAW
                     MDAYHAKVAEVVGPQLEGAAAEWFSRAVAPL"
     gene            complement(307099..307242)
                     /locus_tag="HL653_01355"
     CDS             complement(307099..307242)
                     /locus_tag="HL653_01355"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015822559.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56608.1"
                     /translation="MAKDDPARAARLAEALRQNLRRRKAQSRDAEAATEGSEAPTEAP
                     PRD"
     gene            307342..307416
                     /locus_tag="HL653_01360"
     tRNA            307342..307416
                     /locus_tag="HL653_01360"
                     /product="tRNA-Thr"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:307374..307376,aa:Thr,seq:ggt)
     gene            complement(307435..307878)
                     /locus_tag="HL653_01365"
     CDS             complement(307435..307878)
                     /locus_tag="HL653_01365"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007823413.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="QJU56609.1"
                     /translation="MIEEFEKRCPVARGLDRVGDAWSMLILRDAGLGITRFDQFRASL
                     GIAPNILTRRLKALTDAGLLERRRYSEHPPRDEYVLTEAGRDFLPVLLVIGAWGRRHH
                     GKGARRIADAETGRTLEPVVVDRETGRPIESFRVSLVDPEESPQA"
     gene            307952..308755
                     /locus_tag="HL653_01370"
     CDS             307952..308755
                     /locus_tag="HL653_01370"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019831025.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SDR family oxidoreductase"
                     /protein_id="QJU56610.1"
                     /translation="MTDKVLGTALVTGASSGIGAVYADRLARRGYDLILVARDAARME
                     ALATTLRDQTGRAVEVLPADLTHAADVAKVADRLATDGAITLLVNNAGMSLNGGLLDN
                     EAPAIERLIALNITAPTLLASAAGKAFVTRGGAIITIASVLALAPEMFDGIYSGSKAY
                     VLNLTLGLAAAHADTKLRVQAVLPGATRTEIWERSGKDVNAFPAEWVMEAGDLVDAAL
                     VGFDKGETVTIPPLADEDQWIAFDTARKAMAPNLSRRDVAERYRVAVDA"
     gene            complement(308880..309818)
                     /gene="argC"
                     /locus_tag="HL653_01375"
     CDS             complement(308880..309818)
                     /gene="argC"
                     /locus_tag="HL653_01375"
                     /EC_number="1.2.1.38"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015460175.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyl-gamma-glutamyl-phosphate reductase"
                     /protein_id="QJU56611.1"
                     /translation="MKIFVDGAVGTTGLEIGERLAGRPELELLTLPEARRKDPAARGD
                     ALNAADIVILCLPDDAAREAVTLLEGSSTKIIDASTAHRIAPGWAYGFPELEPGTTRQ
                     AIGASWRVANPGCYPTGFLALVRPLVRAGLLPAETLLSVNATSGYSGGGKAMIAAFED
                     PADPGATDTAFRTYGMNLGHKHVPEMMVHAGLVHPPIFQPAVAHAYRGMIVEVPLHLH
                     ALPGAPKLADLRAALADAYAGSEIVRVIADAPPLLTLEQLAGTDRLDLFVYGDEKAGQ
                     ARLVAALDNLGKGAAGAAVQNMNLMAGLPEAAGLRL"
     gene            complement(309815..310708)
                     /locus_tag="HL653_01380"
     CDS             complement(309815..310708)
                     /locus_tag="HL653_01380"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010337936.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="C40 family peptidase"
                     /protein_id="QJU60385.1"
                     /translation="MTPSSVSCVTLRPERVRLDGPSRPLDPRVHAFRKDVADIALAGR
                     LFAPHYAAPIRCRLTARFTPVLAGPATDARAVSQLVLGEEFDIFDIVSGWAWGRCVHD
                     DYVGYLPADLLGRPEAPTHRVSVPVALMFSAPDIKAPVLDRWPIGARFSAEADGAFLR
                     TEAGYIHQRHACAIGAARDPLETAAALIGQPYLWGGRGGEGIDCSGLVQVACDFAGIA
                     CPRDSDMQRDSLGTPLADDEPVRAGDAIFFPGHVGLMLDGERLIHANAFAMAVTIEPL
                     VDVVARLHQEPAPILARRRLK"
     gene            complement(310668..311000)
                     /locus_tag="HL653_01385"
     CDS             complement(310668..311000)
                     /locus_tag="HL653_01385"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019514999.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="winged helix-turn-helix transcriptional
                     regulator"
                     /protein_id="QJU56612.1"
                     /translation="MQTLVGYVRSGRPDLTNRQMALLMLVYLTPGPHTVRGLAQALGV
                     SKPVVTRALNTLGALGYLRRERDEADRRNIFIAHTDVGAQFLEGFGGLIDGDADHAIV
                     RQLRHASA"
     gene            complement(311147..312553)
                     /locus_tag="HL653_01390"
     CDS             complement(311147..312553)
                     /locus_tag="HL653_01390"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020818932.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="leucyl aminopeptidase family protein"
                     /protein_id="QJU56613.1"
                     /translation="MTDFASLLVADRGQPATILYKVAKSGFDAWMAGLPQRARTAVAA
                     ARFKAEPGSLVILQGDKVDEWNAAVGVSEEGGPWDLAAAAQRLPEGLYRLAAKEEPGE
                     AALGWLLAQHRFDAYRSAPKPEPVRTLLTSDAAMIPEAIRLATAVARVRDMVDTPSAD
                     MGPAELQAAAEALARANGAACRTIRGDALLEGFPMIHAVGRAAARHREPRLIELEWGD
                     PAHPRIAIVGKGVCFDSGGLDIKPPSGMLLMKKDMGGAAHALALAGLVMESRLPVFLH
                     LLIPAVENAISADAFRPGDVLKSRKGLHVEIGNTDAEGRLILGDALTLACEGEEKART
                     ALVIDFATLTGAARVALGPDLPALFANDDALADALLAGGIAARDPLWRLPLWAPYHDM
                     LKSDVADINNAGAGGFAGSITAALFLERFVVKGVPWAHLDTFAWNPAAKPGRPKGGEA
                     LGLRAAWAMLKARFSPDR"
     gene            complement(312689..313120)
                     /locus_tag="HL653_01395"
     CDS             complement(312689..313120)
                     /locus_tag="HL653_01395"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008066613.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cupin domain-containing protein"
                     /protein_id="QJU56614.1"
                     /translation="MASEAAALIAALGLAPHPEGGWYRETWRADAPEGERPSATAILF
                     LLEAGQRSHWHTVDAAELWFWHSGAPLALLRAPGDDGPVETILLGPDVAAGQSLQGVI
                     PTGHWQAAEARAGWTLVSCVVSPGFRFSGFDLAPPEWRPGS"
     gene            complement(313126..313665)
                     /locus_tag="HL653_01400"
     CDS             complement(313126..313665)
                     /locus_tag="HL653_01400"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004615095.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peroxiredoxin"
                     /protein_id="QJU56615.1"
                     /translation="MKRLAAASAFALLLATPGLASLAVGAKAPDFSTQVSLAGKPMPF
                     NLKQALKKGPVVLYFYPAAFTKGCTIEAHDFAEATADFNKAGATVIGMSADPIETLNK
                     FSVEECRNKFAVGSATAATITAYDVTLPAKPDRSNRTSYVIAPDGKVIFAYSALSPEG
                     HVTGTMQAVKAWRAAHPKG"
     gene            complement(313818..314396)
                     /locus_tag="HL653_01405"
     CDS             complement(313818..314396)
                     /locus_tag="HL653_01405"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56616.1"
                     /translation="MGANAYDEAGRHANGHNTCPIFGGFPPFSLKDYMNRVSFNEVIR
                     LVTTVLSVGGRFGLTFSETVDRVEGALERHFGRSPNGERELQVTARALLRARSRRSEL
                     LGVELFRDPAWDILLDLYANGGEEGMMVSSLCHAASVPPTTALRYVHKLIEVGNLICE
                     DHPQDQRRTMVRLAPHMPERIEQVLSILRSGC"
     gene            314546..317221
                     /gene="acnA"
                     /locus_tag="HL653_01410"
     CDS             314546..317221
                     /gene="acnA"
                     /locus_tag="HL653_01410"
                     /EC_number="4.2.1.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019051759.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aconitate hydratase AcnA"
                     /protein_id="QJU56617.1"
                     /translation="MTAVGQDTLKTRSTLEAAGKTVSYYSLAKAAASIGDISRLPFSM
                     KVLLENLLRFEDGVTVTVEDIEAMVQWLADKTSEREIQYRPARVLMQDFTGVPCVVDL
                     AAMRDAMNALGGDAQKINPLVPVHLVIDHSVMVDEFGTPQAFEDNVELEYQRNSERYE
                     FLKWGSKALDNFKVVPPGTGICHQVNLEHIAQAVWTSVDANGDTVAYPDTCVGTDSHT
                     TMVNGLGVLGWGVGGIEAEAAMLGQPVSMLIPEVVGFKLTGTLKEGITATDLVLTCTQ
                     MLRARGVVGRFVEYFGPGLASLSLADRATLANMAPEYGATCGFFGIDEKTLDYMRLTG
                     REEDQIALTEAYAKEQGLWLSADMADPIFTDTLELDISSVVPSLAGPKRPQDKVILTE
                     VDDVFNADLVKTYKHDGAKRVPVEGKSHDIGDGDVVIAAITSCTNTSNPSVLVAAGLV
                     ARKAAAFGLKPKPWVKTSLAPGSQVVTDYLNKSGLQADLDAVGFNLVGYGCTTCIGNS
                     GPLAEPISKAINGNDIVAASVISGNRNFEGRVSPDVRANFLASPPLVVAYALKGTVTE
                     DFTTTPIGQATDGTDVYLKDIWPTNDEIRATMDANIDRAMFSARYAHVFKGDSKWQAI
                     DVAGSDTYTWNPTSTYVANPPYFEGMSMTPKPVTDIVGARPLAIFADSITTDHISPAG
                     SIKVDSPAGRYLNEHQVSKADFNSYGARRGNHDVMMRGTFANIRIKNEMVPGIEGGMT
                     KGPNGDVLAIYDAAQEYKAQGTPLVVIGGKEYGTGSSRDWAAKGTNLLGVRAVIVESF
                     ERIHRSNLVGMGVLPLQFPEGVDRKTLKLDGSETFTIEGVASLRPRQMVTVGLTRADG
                     TQETFEARCRIDTVNELEYFLNGGILPYVLRKLAA"
     gene            complement(317498..318310)
                     /locus_tag="HL653_01415"
     CDS             complement(317498..318310)
                     /locus_tag="HL653_01415"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010125059.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PEP-CTERM sorting domain-containing protein"
                     /protein_id="QJU56618.1"
                     /translation="MMSRIQGLAVAVTASAIAMAAPASAASFVFDTTGSFITSGAATF
                     SSNTVGGTTLNVRVSAWQATDKSGNTDLDDISAAKLGAWDAGLGVIGKNESTNGNDHQ
                     IDNTGGAVDFVLLQFDQAVSLTSIYRNVFRLDGNSTIDSDAAYWADTRGTLGTDWTKA
                     IALQNYDISEKLWTDIAGGSRASTGTLTGNSDVYGSSAVPTSNVWLVGASFLATDRND
                     GFKIASLTVNYTPQAAVVPEPATWAMFIGGFGLVGGALRRRRSTGGQMVRFG"
     gene            complement(318582..319313)
                     /locus_tag="HL653_01420"
     CDS             complement(318582..319313)
                     /locus_tag="HL653_01420"
                     /inference="COORDINATES: protein motif:HMM:NF019941.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010163095.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PEP-CTERM sorting domain-containing protein"
                     /protein_id="QJU56619.1"
                     /translation="MAFSKIRKFGLVAAGVLGSLAIASAADASVTITGVAFDTPGAIA
                     GTLTYTPPRPDYVVRTDIGRLALTTSTGDTLLSYCIDIFHGLTTGTFDAAAITTTSLT
                     ATQISQLSALLSNGEALVTDANHSAAEQLAIWEIVTEGSNRLNVSSGDFSVSNVNRSA
                     VTLANSYLANVNNGTWIADPSLSLAVLKDSNNQTQLVWGATADRVMGAVPEPATWAMM
                     LVGFGAIGGTLRRKKPAGQTVAIFG"
     gene            complement(319417..320166)
                     /locus_tag="HL653_01425"
     CDS             complement(319417..320166)
                     /locus_tag="HL653_01425"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008830644.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="folate-binding protein YgfZ"
                     /protein_id="QJU56620.1"
                     /translation="MTMTFLADRALIRLSGEDVRGFLQGLVTSDVAGTLPVWAGLLTA
                     QGKALFDFLVWADGDDLLIDCEADQADALARRLTLYRLRRKIEIARDLALGVHWSATE
                     GQGVPDPRLPELGWRWIGPAGEGPGAESLWRAHRLGLGVAEGVAEIGSDKTLWLETNA
                     TELGGVSFTKGCYVGQENTARMNWRQKVNRRLVVRRLEADPGESARIFHPDLGLAVVQ
                     MRVADIAGDPQAILPRWLQDALADAAAHKES"
     gene            320293..321615
                     /locus_tag="HL653_01430"
     CDS             320293..321615
                     /locus_tag="HL653_01430"
                     /EC_number="3.5.2.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010161235.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroorotase"
                     /protein_id="QJU56621.1"
                     /translation="MATYDLILKNGTVWTPGGPVETDVGITDGRFAGLGTGGSAGETI
                     DCTGLTILPGVIDSQVHFREPGLEEKEDLESGSRAAVLGGVTALFEMPNTKPNTDSAE
                     AIADKLARARDRMWCDHAFYVGATAANAEHLGELERLPGTAGVKIFMGASTGDLLVSD
                     DKELARVLAHGRRRVAIHAEDEPRMQARMGERIEGDPASHPVWRDDESAILATRRILA
                     LARASRRPIHVLHITTPAELELLSQHKDIATCEVTPQHLTLAGEEAYPRLGTFAQMNP
                     PIRSGAHRDGLWFWLNQGVPDVLGSDHAPHTLAEKAKPYPASPSGMPGVQTLLPLMLN
                     HVAEGRLSLQRLIELTSAGPQRVFGLTGKGRIAAGYDADVTIVDLKAKWTIEESWLAS
                     RCGWSPFTGMSITGKPVATIIRGRQVMREGQLADRAEGRPIRFDSADW"
     gene            321809..322129
                     /locus_tag="HL653_01435"
     CDS             321809..322129
                     /locus_tag="HL653_01435"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012523168.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3297 family protein"
                     /protein_id="QJU56622.1"
                     /translation="MTDSTNTPPDRLSTDPRSDHYDADALQRGVGIRFKGVEKTNIEE
                     YCVSESWVKMAVGKSRDRFGNPMTMKMSGAVEPYYRDIAGDGETTAAAESDAPKTDDA
                     EQAD"
     gene            322268..323584
                     /locus_tag="HL653_01440"
     CDS             322268..323584
                     /locus_tag="HL653_01440"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010185001.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cystathionine gamma-synthase family protein"
                     /protein_id="QJU56623.1"
                     /translation="MAGGDENEADLTGGSQRRRPRRQLEEIGGRRLSPATLMMGHGFD
                     PALSEGALKPPIFLTSTFVFENAAAGKRHFEGVTGKRPGGAEGLVYSRFNGPNQEILE
                     DRLGIWEGAEEALTFSSGMAAIATLLLAYVKPGDVIVHSAPLYAATETLIGKILGRFG
                     VTWLDFPAGATRAEIDAVLDRAKAQGRVALVYLESPANPTNALVDVEAVVAARDAAFG
                     EDKPPVAIDNTFLGPLWQQPLRQGADIVVYSLTKYAGGHSDLVAGSAVGAKAMIDPIR
                     AMRNTIGTITDPHTAWMLLRSLETLELRMTRASENAAKVCAYLRDHPKVEQVGYLGFL
                     DPASRQADIYRRHCTGAGSTFSLYLKGGEREAFAFLDAMKIAKLAVSLGGTETLASAP
                     AAMTHLSVPDDRKAALGISDNLVRISIGVENADDLIADMEQALAAV"
     gene            complement(323708..325249)
                     /locus_tag="HL653_01445"
     CDS             complement(323708..325249)
                     /locus_tag="HL653_01445"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56624.1"
                     /translation="MAMKEAQEARLLVAGGLLLAILGAVVRLWHVSVTPMWLDEAYSA
                     YAAGKSFGFLWVVVPRYETHPPFYYTLLKLWTLVFGDGLVAERALGLAAGLIAPFVIA
                     WSAGAAAEGLGWEPRRQRLAAFVAFALAALAIPLVEMSREVRPYPVMILVYALAVRAL
                     IGIARVRSEGRRLAGPAFGVYLLCLEWMLWLHNLGPLWAAALGLACLAAFLASRARPA
                     DGGWFVAGHMAVALFYLPALDILLDQAPTWVKSTWLTFGLGGLSDHLPVLYAVPGWQG
                     LAAVVLLILAVAVLAREVRGRRLLAMLLVLAIVPTALSILLSMTVAPVFITRTLTPVA
                     VPWLVLLALGAAGARDKAAWIGAGAALMLVLNMLAVDGQQRAAGPFQNWYGAVAWLQQ
                     RHAPDDLILAYPNEGALPLERALKDKGLDWRVIAVPRPVPAFDADGWHPTGSRGVISL
                     PRPHLEAIARAPEIAQVRRVWLLRLGNTTYDPGDMFLNALRRDRRITGRFVAGPIDII
                     GLELR"
     gene            complement(325305..326297)
                     /gene="mltG"
                     /locus_tag="HL653_01450"
     CDS             complement(325305..326297)
                     /gene="mltG"
                     /locus_tag="HL653_01450"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019051425.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endolytic transglycosylase MltG"
                     /protein_id="QJU56625.1"
                     /translation="MAKRNARGFGCLGFLLLVALVAGGFFWLYVHRNWSGPGPATHPT
                     TLIVPQGSTLADTARELEHLGAVRSTTGFLRFARRFGDSAPIRAGEYEVAPHMSAKDI
                     LALLQTGRTVQRLITIPEGMPSILVFERLAREKVLTGKLPIPEEGTVLPGTYSFQRGE
                     PRKAVLKRMQDAMTQTLDQLWIRRKANTVVNTKEEAITLASIVEKETGVPVERPMVAG
                     VYSNRLRQGMKLQADPTIIYPITKGKPLGRRIKLSEVRAVNDYNTYAMTGLPKGPITN
                     PGRDAIAATLAPAQTDALYFVADGKGGHVFSDTLAEHNANVQRYYRLRRAQGTR"
     gene            complement(326438..327697)
                     /gene="fabF"
                     /locus_tag="HL653_01455"
     CDS             complement(326438..327697)
                     /gene="fabF"
                     /locus_tag="HL653_01455"
                     /EC_number="2.3.1.179"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010216935.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-ketoacyl-ACP synthase II"
                     /protein_id="QJU60386.1"
                     /translation="MRRVVVTGLGLVTPVGADVETAWANILAGKSGAGRITRFDPVGQ
                     KCTIACEVKPADHEYGFDPSKRVDHKVQRQVDPFIVYGIDAAGQALEDAGLTELTEEQ
                     SYRAGISTGAGIGGLPGIESESIVCKEKGPSRVSPHFVHGRLINLISGQVSIKYGLRG
                     PNHAVVTACSTGAHAIGDAARMIAMDDADIMLAGGAEGAICPLGIAGFAQARALSTNF
                     NDTPEKASRPYDKDRDGFVMGEGAGIVVLEEYEHAKARGAKIYCEVVGYGLSGDAYHV
                     TAPHPEGSGAFRSMQMALKKAGLEPKDIDYINAHGTSTPLGDELELGAVRRLFGDAMD
                     TVSMSSTKSMIGHLLGGAGAVESIFCILALRDQIVPPTINLDNPSDNCVGVDLVPHVA
                     KKRPVRAVLNNSFGFGGTNASLVMRAL"
     gene            complement(327930..328166)
                     /locus_tag="HL653_01460"
     CDS             complement(327930..328166)
                     /locus_tag="HL653_01460"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013933352.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl carrier protein"
                     /protein_id="QJU56626.1"
                     /translation="MSETAERVKKIVVEHLGVEPEKVTEEASFIDDLGADSLDIVELV
                     MAFEEEFGVEIPDDAAEKITTVKDAISYIDTHKA"
     gene            complement(328264..329004)
                     /gene="fabG"
                     /locus_tag="HL653_01465"
     CDS             complement(328264..329004)
                     /gene="fabG"
                     /locus_tag="HL653_01465"
                     /EC_number="1.1.1.100"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004212094.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-[acyl-carrier-protein] reductase"
                     /protein_id="QJU56627.1"
                     /translation="MFDLTGMTALVTGASGGIGSAIAKSLAAQGAKVALSGTRIEALE
                     ALAAEIGNGAVAVPCNLGDSASVEALIPAALEALGGKIDILVNNAGITRDNLVMRMKD
                     EEWDQVISVNLEAAFRLIRAAARPMMKARFGRIVTITSVVGTTGNPGQANYAASKGGL
                     TAMSKALAQELASRGITVNCVAPGFIASAMTDALNEQQKGAILGRIPAGALGEGADVA
                     AAVTYLASREAGYVTGQTLHVNGGMAMI"
     gene            complement(328997..329443)
                     /locus_tag="HL653_01470"
     CDS             complement(328997..329443)
                     /locus_tag="HL653_01470"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010403341.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GxxExxY protein"
                     /protein_id="QJU56628.1"
                     /translation="MRDIDLISGDVIDAALRLHRDLGPGRLESVYEALLAAKLERLGY
                     RVARQRAIDIEHDNIRFEGAFRVDLIVDDRLIVEIKSVERLSAVHAKQLLTYLRLTKQ
                     PVGLLINFAGATLREGIRRVVNDHRPLSASASPREPSSSDSRDENV"
     gene            complement(329487..330422)
                     /gene="fabD"
                     /locus_tag="HL653_01475"
     CDS             complement(329487..330422)
                     /gene="fabD"
                     /locus_tag="HL653_01475"
                     /EC_number="2.3.1.39"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017182080.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ACP S-malonyltransferase"
                     /protein_id="QJU56629.1"
                     /translation="MRAFVFPGQGSQAVGMGAALAAASTAARAVFQEVDDALGQNLAR
                     LMAEGPADDLTLTENAQPAIMANAIAALRVLETDGGIRLVDKADFVAGHSLGEYSALC
                     GAQAFDLATTARLLKLRGQAMQAAVPVGEGAMAALLGADYALAEAICAEAAEGEVCQA
                     ANDNGGGQVVISGHKAAVERAMALSKEKGVKRALPLPVSAPFHCALMQPAADAMAEAL
                     AKAAIRAPLVPVYANVTAAPVADPDQIRELLVMQVTGTVRWRESVEAMVAAGVTEFVE
                     FGAKVLGPMIKRIAPDATTTSLVTMADIEAFAAGL"
     gene            complement(330503..331336)
                     /locus_tag="HL653_01480"
     CDS             complement(330503..331336)
                     /locus_tag="HL653_01480"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010164677.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="porin family protein"
                     /protein_id="QJU56630.1"
                     /translation="MSKFILAAAVIATATPAFAQSAEPTNWTGFYVGGRAGYSFQPGD
                     GDETVLFDNNLDGNFGDTVRTTTGANAFSPGFCGGGARSAVAADGCTKDKDSLEFALH
                     AGYDFDLGKVVIGGLAEVGMGYAEDSVTAFSTTPANYTWTRRMAENYGLRARVGYALG
                     AQRNTLVYGTGGVVWAKMDNSFRSSNRANAFQDLSDNTVFGWRAGAGVEQRVHKHLSI
                     GLQYLHTSLKDDGARLRVSRGLQPATNPFILVNANGTDFKRSHSRFATDNISATANFR
                     F"
     gene            331620..332033
                     /gene="rpsF"
                     /locus_tag="HL653_01485"
     CDS             331620..332033
                     /gene="rpsF"
                     /locus_tag="HL653_01485"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016747031.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S6"
                     /protein_id="QJU56631.1"
                     /translation="MALYEHVFLARQDLAQAQVDALAEMVTKIVEEGQGKVVKTETWG
                     LRSIAYRIAKNRKAHYVMLDIDAPTGVVAEIERQLGINEDIIRYMTVRVDALEQGPSA
                     MMRRGDRDRARGERGDRPDRGPREDRPRRDDRDAA"
     gene            332049..332273
                     /locus_tag="HL653_01490"
     CDS             332049..332273
                     /locus_tag="HL653_01490"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006832330.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S18"
                     /protein_id="QJU56632.1"
                     /translation="MARAFFRRRKSCPFSAKDAPRIDYKDVRLLQGFVSERGKIVPSR
                     ITAVSAKKQRELAQAIKRARHLGLLPYLVK"
     gene            332286..332885
                     /gene="rplI"
                     /locus_tag="HL653_01495"
     CDS             332286..332885
                     /gene="rplI"
                     /locus_tag="HL653_01495"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007403461.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L9"
                     /protein_id="QJU56633.1"
                     /translation="MDVILLERVEKLGQIGDVVTVKNGFARNFLLPRKKALRANEANK
                     KVFEANKATIVAENAARRGEAEVASKDIDGKTITLIRQASNTGQLYGSVSARDLAELL
                     AEDGAKVAKNQIVLDKPIKAIGLSEVKIVLHPEVTVSIKVNVARSPEEAEMQAQGVDV
                     MAQMFERDEAGFIEDYDPNAEPGATADVRPDAEEEQEEA"
     gene            complement(333075..334415)
                     /gene="rimO"
                     /locus_tag="HL653_01500"
     CDS             complement(333075..334415)
                     /gene="rimO"
                     /locus_tag="HL653_01500"
                     /EC_number="2.8.4.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010217195.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S12 methylthiotransferase
                     RimO"
                     /protein_id="QJU56634.1"
                     /translation="MATILPSPPKVGMVSLGCPKNLVDSERILTKLRADGYSMSPDYA
                     GADVVLVNTCGFLDSAKEESLEAIGEAIAENGRVIVTGCMGKEAEVIRERFPSVLAVT
                     GAHQYEQVVGAVHDAAPIPPSAYLDLVPANPLGGDLKLTPKHYSYLKISEGCNHRCSF
                     CIIPALRGDLASRRPDAILREAEKLVAAGTRELLVISQDTSAYGLDLRHASYPLKGGG
                     EIRSDMTDLARHLGQLGAWVRLHYVYPYPHVDRVIPLMAEGLVLPYLDIPFQHAAPSV
                     LKAMKRPANEAKVLERIAKWREIAPDIAIRSTFVVGFPGETEADFDYLLQWLEEARLD
                     RVGAFRFEPVAGAAANDLPDPVPEEVKEERYARLMELTARISAEKLEAKVGRTLDVII
                     DEVGGDGATGRSQADAPEIDGQVHLRDAGHLSPGDIVKVEIEEADEHDLFGVPA"
     gene            334466..335602
                     /locus_tag="HL653_01505"
     CDS             334466..335602
                     /locus_tag="HL653_01505"
                     /inference="COORDINATES: protein motif:HMM:NF022732.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3089 domain-containing protein"
                     /protein_id="QJU56635.1"
                     /translation="MPGRSLWFGVTALLAMMPVEAQPATTPPPAIARPDDTPPPPVDY
                     ANPASWMCRPGVDDGTCSANLDAMTVDGGGTRTPKPYKAAADPKIDCFYIYPTASGDS
                     TMFADLLPDAGEKRAVHSQAARLGEACRLFAPLYHQFTGAALRYGMAVEKRTEIPASY
                     TDIPFRDVRAAWRAYLKNDNHGRGVVLIGHSQGAMMLKQLIAAEIDGKPAQKLVVGAY
                     LAGNPDLTTDSFRSLKPCAAPGQTGCIVAWSSYLDTVTSPHIFGAAKPGKTALCVNPA
                     APGGGRGMLKAYLNRPGIAPETDPPYVETIGQMSAECVADAGGTVLRIHIEPSRYADL
                     LTASLGRLSAASPAWGLHTLDVNLVQGNVIDMIEAQAASWTKGH"
     gene            335706..336422
                     /gene="rph"
                     /locus_tag="HL653_01510"
     CDS             335706..336422
                     /gene="rph"
                     /locus_tag="HL653_01510"
                     /EC_number="2.7.7.56"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010215959.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease PH"
                     /protein_id="QJU56636.1"
                     /translation="MRPSGRAPDQMRAITIQPNFTVHAEGSVLIGFGDTKVLVTASVE
                     ERVPPFLRGKGQGWVTAEYGMLPRATHTRGSREAAKGKQSGRTQEIQRLIGRSLRAVV
                     DMELLGERQITIDCDVIQADGGTRTASISGAWVALRIAVDKLLASGALVADPIKAQVA
                     AVSCGIYEGNPVLDLDYIEDSNAHADANFVLLSDGNIAEAQATAEGATYDEEALLRLL
                     RLARIGCGEIFAAQRLAVGK"
     gene            336455..337072
                     /gene="rdgB"
                     /locus_tag="HL653_01515"
     CDS             336455..337072
                     /gene="rdgB"
                     /locus_tag="HL653_01515"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003039473.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RdgB/HAM1 family non-canonical purine NTP
                     pyrophosphatase"
                     /protein_id="QJU60387.1"
                     /translation="MPHRRLAPGKLVIASHNEGKVREIRALLEPYGIEPVSAASLGIP
                     EPEETGTTFFANAELKARYSADLSGMVALADDSGLCVDALGGDPGVYTANWAETEDGT
                     RNWPMAMRKVEDALQAKGPEAGRDAHFVCVLSLCWPDGHVESFEGRAEGTLTWPPRGT
                     VGFGYDPVFVPNGDTRTFAELAPEEKKAISHRADAFRKLVAACLG"
     gene            337132..338319
                     /locus_tag="HL653_01520"
     CDS             337132..338319
                     /locus_tag="HL653_01520"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019368987.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="coproporphyrinogen III oxidase"
                     /protein_id="QJU56637.1"
                     /translation="MATRTHSHVRPEPVEGRAPGESSAAQDALALYVHWPFCVSKCPY
                     CDFNSHVREGVDQDRWRQALLTDLAFEAEIGPKRPLTSIFFGGGTPSLMPPATVAAIL
                     RDAERRFGFTPGIEITLEANPSSVEAARFADLATAGVNRVSLGLQALDDEVLRFLGRA
                     HGVEEGLKALETAQACFDRVSFDLIYARPGQSEAEWAMELERALGFGTGHLSLYQLTI
                     EPGTRFATLAAQGKLAPVDPDHGAALFELTREMTAAAGLPAYEVSNHARPGEESRHNL
                     TYWRYGDYLGVGPGAHGRREGVATVRAKKPENWLSRIDSQTSGIAEEERLDPATQATE
                     ALLMGLRLEEGVSLARCAPAIDPAAMARLIAQGLLERKDDRLRVTPGNVLVLDGILGA
                     LAI"
     gene            complement(338454..339641)
                     /locus_tag="HL653_01525"
     CDS             complement(338454..339641)
                     /locus_tag="HL653_01525"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010215954.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="penicillin-binding protein activator"
                     /protein_id="QJU56638.1"
                     /translation="MADPGHRAQIGGRRNRAATFLALLVAMLLGACTTTGGPRRSAPV
                     PTKAPPTATAPSKQEGLPEDKERHRVALLVPLTGPNAGVGQSIANAAVLALADTKDRS
                     LRVTTYDTGPGAGPAAAKALAEGNALILGPLLGDDVRAVSGPAAARGVPVVSFSNDIA
                     ASADNVWLLGFQPAQSIERVVRFARSKGMTRFAGLVPQGAYGRTASGTLIRVAEAAGG
                     SVVTMQSYDRSAGITAAVAALAKQKFDAVLIADSGRIAVLAVPLLRKQGATGQVMGTE
                     LWNAEPGLNAVAAMSGAWFASVDDRMFGQLQTRYRARYGKTPYRLASLGYDAVLLAVR
                     IARDWKPGAAFPTDRLSDEGGFAGVDGAFRFGANHVAERSLAVHQLGAGGRTVVSAPP
                     TGF"
     gene            339652..340503
                     /gene="rsmI"
                     /locus_tag="HL653_01530"
     CDS             339652..340503
                     /gene="rsmI"
                     /locus_tag="HL653_01530"
                     /EC_number="2.1.1.198"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010404082.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA
                     (cytidine(1402)-2'-O)-methyltransferase"
                     /protein_id="QJU56639.1"
                     /translation="MSFSDPEPLEPGLYIVATPIGNLKDLSPRAADILSRADAIAVED
                     SRVTGGLLRHIGVKRPMIPYHDHSTERVREDLVARLGTQAIALVSDAGTPLISDPGFK
                     LVRAARAAGYAVTTLPGPCAAVAALTLAGLPTDRFLFAGFLPSKAKARDEAIDELGAV
                     RATLLFYESGPRLAASLSALAARLGDREAAVAREISKMFEECVTGTLSELAARYAGAA
                     PKGEIVIVVAPPGEAEPASEADADALLAEALERLPIGKAASEVAQVTGLNRRDLYARA
                     LALKGEA"
     gene            340514..340867
                     /locus_tag="HL653_01535"
     CDS             340514..340867
                     /locus_tag="HL653_01535"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010215951.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YraN family protein"
                     /protein_id="QJU56640.1"
                     /translation="MRDRRASERSGRVAETAAAWWLRLKGWRILARRVRTPVGEVDLI
                     ATRGDLVAFVEVKRRATAAELDFAIDERRLARVAAAAGYLAPRFAGEGQDIRIDVILI
                     APGRALRHIENAWIG"
     gene            341002..341952
                     /gene="gshB"
                     /locus_tag="HL653_01540"
     CDS             341002..341952
                     /gene="gshB"
                     /locus_tag="HL653_01540"
                     /EC_number="6.3.2.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010183620.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione synthase"
                     /protein_id="QJU56641.1"
                     /translation="MSLTVAVQMDPLESINIGGDSTFAIMLGAQARGHALWHYAAGDL
                     SYCDGRLTAPARRIRVQRVAGDHFAVLETKTLDLGADVDVILMRQDPPFDLAYITATH
                     LLERIQHQTLIVNDPASVRNAPEKLFVLDYAEFMPPTLITRGLEEARAFHAEHGEVVV
                     KPLYGNAGSAVFHVARKDANLAALTELFGQVWREPFMVQAFLPDVSKGDKRIVLVDGK
                     PTGALNRLPREGEIRSNLAVGGSGAQADLTPRELEICAAIGPELAKRGLLFVGIDVIA
                     GYLTEINVTSPTGIVAIDRFNGTDTPAIIWDAIEAKLAER"
     gene            342303..344378
                     /locus_tag="HL653_01545"
     CDS             342303..344378
                     /locus_tag="HL653_01545"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017977888.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent receptor"
                     /protein_id="QJU60388.1"
                     /translation="MKAGLLAGAALIPTTAALAEDATPPSGNDIVITAPLSRSREDVI
                     AGVSVMSGTDLVRNMRSTVAETLARTPGVSASSFGPSASRPILRGFQGDRVRVLTDGI
                     GSIDASGASADHAVVINPLLAERIEVVRGPSALLYGSEAIGGVVNVIDTRIPRSIPEN
                     GFRITGQGTYGSAANERSGGLAVDVKAAENLVIHADGSYLKTGNMDIGGYALTPALRR
                     TALATAAAGGDPTGEIDFAGNAAVKNTLPNTRAKTWDAALGATLITETGSLGFSYSHY
                     DSLYGVPIRYATQLGEGQEAPRLDVKQDRLDARAEIDANGSVIEKIRFRIGGGRYRHY
                     ELEQDNSIGTAFYTQGMEGRLELVQAQHGGWRGVVGGQFLYRDFNVVGDEAFLPRNQT
                     DQQGVFTLQQLEMGKLKLEAGARFEHAVAASKPRDDQPQFTRGKRGFDLVSGSIGASY
                     AITPGLRFGVNLSHSERAPSAEELFANGPHGGTEAFEIGDPGLKKESANGAEAVLHVH
                     GRGFDLEASAFYQRFNNYIDDFPTGEIEDGLPVYQSAQADARYYGFEVQGSVDLAHIG
                     DTTFALDGLADYVNAQVISQSPVPRIPPLRVLAGIEAKNGRIFGRAEVERVMKQDRIA
                     AFETETPGYTMVNASIGVHPFADHQGTSIILSANNLTDVVARRATSFLKDYAPLAGRD
                     IRITARFQL"
     gene            complement(344356..345879)
                     /locus_tag="HL653_01550"
     CDS             complement(344356..345879)
                     /locus_tag="HL653_01550"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010544046.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease subunit"
                     /protein_id="QJU56642.1"
                     /translation="MTAALAQLPPLIASHLLLAGAAMLLALAIGLPLGLFAARRPRAG
                     GAILAVAGLIQTIPGLALLALFYPVLLWLSSFAGGAIPALGFLPALLALTLYALLPII
                     RNVVAGLQGIDPAVLQAADGVGMTSRQKLRLVELPLAAPVAMAGIRTAAVWTIGAATL
                     STTIGYPSLGNPIFSGLQTENWSLVLAGCIGAAGLAIATDAVLALIERGLSRRRRAPL
                     LAGIALLVAGLAAALAPSVAPRPQTVVVGAKNFSEQFILARLIGARLEAAGYRVSYRE
                     GLGSAVAFRALAAGDVDVYVDYAGTLWTGAMGRTDTKPRAAMLADMGRWMAAGPKTAI
                     VGPLGFENAYALAMRPGAGISSLADLAARAPNLALGADLEFLDRPEWRAIREAYGLRF
                     RTQRAYNPTFMYRALASKQADVISAFSSDGRIAAEKLVVLSDPKGAVPRYDALLLASP
                     ARAHDARFLAALRPLVNAIPVDAMREANYRVDRDAGKATPEDAASWLAGRIRAGSAR"
     gene            complement(346121..346879)
                     /locus_tag="HL653_01555"
     CDS             complement(346121..346879)
                     /locus_tag="HL653_01555"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019833986.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding cassette domain-containing protein"
                     /protein_id="QJU56643.1"
                     /translation="MADAPPALSYEGVSRVYAGQAAVDGVTLAIAAGSFVALVGASGS
                     GKSTLLRMANRLEAPDAGRVLRDGEDIAALDPVQVRRGTGYSFQNVGLFPHMAVAENI
                     ALPARLAGQGAVDVAAALERVGLPVAYARRMPAQLSGGEQARVGIARALGNEAKLLLM
                     DEPFGALDPVTRDRLGRTVRDLHDALGLTTILVTHDMAEALLLADRVVVMARGRVAGD
                     ATPTAMLAGGAGPEAAALVAVPREQADRLRALGG"
     gene            complement(346872..347165)
                     /locus_tag="HL653_01560"
     CDS             complement(346872..347165)
                     /locus_tag="HL653_01560"
                     /EC_number="4.2.1.96"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011952261.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4a-hydroxytetrahydrobiopterin dehydratase"
                     /protein_id="QJU56644.1"
                     /translation="MTIKRLNEAERALALADLPEWAMDGERDGIRRRFTFPDFVAAFG
                     FMTKVALLAEKADHHPEWSNVWNRVDVLLTTHDAGGLSQRDVTLAAQIDALLG"
     gene            347216..347632
                     /locus_tag="HL653_01565"
     CDS             347216..347632
                     /locus_tag="HL653_01565"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010161371.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metallopeptidase family protein"
                     /protein_id="QJU60389.1"
                     /translation="MARQGQTIAPDAGMIERIARDAIARLPEAFRAHLDNVVLQIEDF
                     ADDETLDALGLEDPFQLSGLYSGRPIGTKSIDDSGTLPDMIHLYRRALLDEWAEGGET
                     LETLVSHVVIHEIGHHFGLSDAQMHALEQEAGHAPE"
     gene            347629..348207
                     /gene="ccmA"
                     /locus_tag="HL653_01570"
     CDS             347629..348207
                     /gene="ccmA"
                     /locus_tag="HL653_01570"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011952263.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heme ABC exporter ATP-binding protein CcmA"
                     /protein_id="QJU56645.1"
                     /translation="MSESARLVLHDIACLRGDRLLFEGLGFALGPGEALLVTGRNGAG
                     KSSLLRMIAGLLPPAAGRIEREGRVALAAEAAALDPDRALGAALRFWAGLDGANDTVL
                     PAAIGTMGLEALEDVPVAMLSTGQRKRAVLARTIAGGADIWLLDEPGNGLDTTALDRL
                     AGAMAAHRAKGGIIVAASHQPIGLVPTREIAL"
     gene            348204..348851
                     /locus_tag="HL653_01575"
     CDS             348204..348851
                     /locus_tag="HL653_01575"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011952264.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heme ABC transporter permease CcmB"
                     /protein_id="QJU56646.1"
                     /translation="MKALVAVGARDLRIAWAQGGAVLPLVFYLLVATLLPFAIGPDKA
                     LLARIGGGLLWTAALLAALMPVERLVAPDLASGTIDQFVVRGMSEEAIGAAKLVAHWI
                     AFGPPLMIATLPAAALLGLDGPTVLRLEVGLAIGTPGLAALALATAALTAGLRGASAL
                     SGLIMLPLAIPLLIFGAGALGEAGAGATKLLAATSLLLVAGTPFAAGAALRAGRG"
     gene            complement(348909..349667)
                     /locus_tag="HL653_01580"
     CDS             complement(348909..349667)
                     /locus_tag="HL653_01580"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010216751.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PEP-CTERM sorting domain-containing protein"
                     /protein_id="QJU56647.1"
                     /translation="MRLAIFAAWAACSIVAPASAATTLSSVSADFSDPVGGNSSFYHY
                     LDTDGRPGSEEIRWGDPGSPNRVDRQSGLRFSYAPAQAIVQGTPFTLGTLTYYNNPVL
                     DAINAVSFSVSPGLTVDGAPLATGPFTFLISVDETPNQNNPATCPYPSNIGCSDKISI
                     KTGAATQVFQLGDQTLTLYIDGFLDAQLVPQSSFIAQEQESTTATLVAHFDLASPVPE
                     PASWAMLVAGFGILGGAMRRSGSRIRFKTVRSPV"
     gene            complement(349705..350670)
                     /locus_tag="HL653_01585"
     CDS             complement(349705..350670)
                     /locus_tag="HL653_01585"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010126101.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class I SAM-dependent rRNA methyltransferase"
                     /protein_id="QJU56648.1"
                     /translation="MKDLLTLVTEPWPDYGLIDSGHGRKLERYGRFRFIRPEPQAMWA
                     PASMSWEADGDFIAASDDEGGGKWHLSRDVPRGGWHMRWEEVRFLAQNTPFRHLAFFP
                     DMAPQWEWMRERTTEGSEMLNLFGYTGVGSLALAAKGAKVTHVDASKKSVEAGKANAF
                     LSDMADRPIRWMVDDAVKFAAREVRRERRYDGIMLDPPKFGRGPDGEVWRLEEHLPGL
                     IAHCRQLLDSESRFLVLTVYAVRMSALAIGALLEQALGDLGGTIEVGEMAVREESRDL
                     LLPTAIFCTVEPITGQSQSKATSSNGKRYVNHLYGVGTMGRGLFA"
     gene            complement(350667..351896)
                     /locus_tag="HL653_01590"
     CDS             complement(350667..351896)
                     /locus_tag="HL653_01590"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015459554.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="insulinase family protein"
                     /protein_id="QJU56649.1"
                     /translation="MSARVHRLANGLTVAVEPMAGVETVAVGLYADAGSRSEEKGLAG
                     LAHMVEHMVFKGAGSRNARQIAEVIEDRGGSINAWTTRDNTAFQARMLADDMVLGLEV
                     ISDLIRAPHFDADELEREKGVVLAELGEARDTPDDIIYDHLQATAFPDQMLGEPVLGH
                     EETIAAIDTAALKGWLDGQYRPEGLVLAAAGKVNEDALLTLAEARFGDLAPGAAPQPA
                     AATFGGGTHHDVRRFDQLHVALGFPGVGLHDASLHALSLFSSAVGGGMSSRLFQEVRE
                     ERGLAYSIYAWAHAYAETGLFGVYCAAGRRDAARALALTREVLARTAETLDQAELDRA
                     RAQAKAGLLMGLESVATRADHLARQIQIHGRIVPPSESVALLDAVTVAQARAAGAAAL
                     SGGEALATVGGKLAKAA"
     gene            complement(351893..353302)
                     /locus_tag="HL653_01595"
     CDS             complement(351893..353302)
                     /locus_tag="HL653_01595"
                     /EC_number="4.2.3.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007710279.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonine synthase"
                     /protein_id="QJU56650.1"
                     /translation="MRYISTRGSAPALDFEGATLAGLASDGGLYVPAAWPSLSSDEIA
                     GLAGLSYADTAAAVMAPFVGEALTPEDLRELCVAAYGRFDHAAVTPLVQLDPSNWLLE
                     LFHGPTLAFKDVALQLLGLLFERFLSTRDTHLTVVGATSGDTGSAAIDALAGRAKVDI
                     FMLHPAGRVSEVQRRQMTTVLSPNVHNIAIEGSFDDAQAMVKAMFAHQSFSGRFQLSA
                     VNSINWARLMAQVVYYFYAAVRLGAPGRPVAFSVPTGNFGDVFAGYVAARMGLPVARL
                     IVATNVNDILHRALSAGDYSVGTVTPTAAPSMDIQVSSNFERLLFDLHGRDGLALAAT
                     MRGFEETKRLAIPQAMIGQASELFTSARIDPDSMALAMRGAWENSGQLLDPHTAIGLA
                     AAHAADLPADVPIVTLATAHPAKFPDAVERGTGQRPQLPARIGDLFDREERYETLPAE
                     LEAVEAYIAERAVPITADA"
     gene            complement(353431..353994)
                     /locus_tag="HL653_01600"
     CDS             complement(353431..353994)
                     /locus_tag="HL653_01600"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017183981.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SURF1 family protein"
                     /protein_id="QJU60390.1"
                     /translation="MIGLGVWQLQRRHEKEALLALYAANIARLPVAVSALLPLDDAGL
                     FRAVSADCGQVTGWTTAAGHAADGRTGWSHIAACRTGAEGPGLHVDMGVSPSPEAPKG
                     WTGGPVRGRIVWLPDGQPLIAHLFTARAPRTPLIVSDGAAPGLTPTAPPDPESVPNNH
                     LAYAVQWFLFAGVALVIYAVALRRRWR"
     gene            complement(354080..354901)
                     /locus_tag="HL653_01605"
     CDS             complement(354080..354901)
                     /locus_tag="HL653_01605"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004208605.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c oxidase subunit 3"
                     /protein_id="QJU56651.1"
                     /translation="MAGAKSHDYHILPPDPYPILSAFSALILASGGIMYMHSAAYGGF
                     VALAGLGCVLLCMAGWWSRVIREAKAGDHTPVVGLHLRYGMILFIASEVMFFVGWFWA
                     WFDFSLFPSPVEAVGGVWPPKGIEVINPFAFPLLNTMILLCSGTTVTWAHHALLHGDR
                     KGLIQGLWCTILLGMLFSTIQAYEYAHAPFAFKGLNYGAAFFMATGFHGFHVLVGTIF
                     LIVNLVRAYKGDFTPKQHFGFEAAAWYWHFVDVVWLFLFVTIYVWGGWGAPIHAG"
     gene            complement(354934..355500)
                     /locus_tag="HL653_01610"
     CDS             complement(354934..355500)
                     /locus_tag="HL653_01610"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019515277.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c oxidase assembly protein"
                     /protein_id="QJU56652.1"
                     /translation="MAGAAPLLPRGKARTVAGTLLMLVAMTALGFASVPLYRMFCQAT
                     GYNGTARKALNATAPGEVVGKIVNVRFDANVKPGMGWTFEPDDRVKRVAVGARQMAFF
                     TAVNTTDHSITGRASFNVSPDQTGQYFTKIQCFCFTEQTLKPHERVRMPVIFFVDPQF
                     AKDPDTKDISEITLSYTFFPVASPEGSS"
     gene            complement(355619..356533)
                     /locus_tag="HL653_01615"
     CDS             complement(355619..356533)
                     /locus_tag="HL653_01615"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019370707.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protoheme IX farnesyltransferase"
                     /protein_id="QJU56653.1"
                     /translation="MMSSPAFATAQPLPADWRDFLALTKPRVMSLVVFTGLCAMLAAP
                     GHVHPVIGFTAILCVALGAGASGALNQWYEADLDAVMKRTAKRPLPAGRMDRQAALHF
                     GVGLGAFSVLLMGLAVNLLSAVILAGSILFYVLIYTVWLKRRTPQNIVIGGAAGAFPP
                     LIGWAAATGRVDLLPVLMFALVFLWTPPHFWALGLFVRTDYAAAGVPMMPVVAGARAT
                     RTQVFLYSLPMAVVAIAPWPLGLTGAIYGATATILSLLFVGFAARVGLSRIEDQAEMR
                     AERRMFGYSILYLFVIFGALVADRMLLA"
     gene            complement(356931..358484)
                     /locus_tag="HL653_01620"
     CDS             complement(356931..358484)
                     /locus_tag="HL653_01620"
                     /inference="COORDINATES: protein motif:HMM:NF012245.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="QJU56654.1"
                     /translation="MNQVAAMQDVPKEVATLRRVGVRALVGAAWGLLLILSVGGWIAG
                     VDGAGVVLVAGFVANLLPTRAAWRGDHDATTRLLVGTLAFAYPAFGVFLLRGTAWQLD
                     SHLYFLATLAALTVLCDWRPIVLAAGLIAAHHLLLEAIVPAWVFTGGGNIGRVLFHAV
                     AVIFETGFLVYVVEKLRLLMIRQTAARAHSEALAAEAIEARDELQEAMLKAQAAEQAV
                     SDERQRRHAVEAAAGERRRGDMLALAETFQASVLEAVRSVGVASADLDASARSLDGIA
                     QSATRDSEAMARTARRSLEDARDLAMRVRELAGSVSAISGRVSEQARLGGEARAASAS
                     SHRTVAGLSDHSASIGGFVQSIQQIARRTNLLALNATIEAAHAGDAGRGFAVVAQEVK
                     ALARQAGGASSEIQALASAIDSGAGEVNKTLAAIEDSIAQLSGTALAISADVERHGLT
                     ALAAESIADQTALSAADIAAEASGAARAAETTAALSAQVTGAASGLSETARALQQATE
                     RFVEKIKAA"
     gene            complement(358481..358735)
                     /locus_tag="HL653_01625"
     CDS             complement(358481..358735)
                     /locus_tag="HL653_01625"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010161794.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU60391.1"
                     /translation="MAIVGAVGLMVAAPPANGRIMLVPLSADAAHGLVAMAIDRGATL
                     VGPGPLPGSFVVDGRRADLVRGLVRHGIALLAAPAAGCGQ"
     gene            complement(359049..360734)
                     /gene="ctaD"
                     /locus_tag="HL653_01630"
     CDS             complement(359049..360734)
                     /gene="ctaD"
                     /locus_tag="HL653_01630"
                     /EC_number="1.9.3.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010126114.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c oxidase subunit I"
                     /protein_id="QJU56655.1"
                     /translation="MTDIAAHPSHFHAEDEHEHGHHHDADHKPPFFARWFMSTNHKDI
                     GTLYLIFAIVAGIIGGAISGVMRAELAKPGIQILTMAWPLGVGSVATMDEALHHWNVL
                     ITAHGLIMVFFMVMPAMIGGFGNWFVPIMIGAPDMAFPRMNNISFWLLIPSFILLLGS
                     TFVSGGTGLGAGTGWTVYAPLSTTGSSGPAVDMAILSLHLAGASSILGAINFITTILN
                     MRAPGMTLHKMPLFAWSVLVTAFLLLLSLPVLAAAITMLLTDRNFGTTFFDASGGGDP
                     VLYQHLFWFFGHPEVYIMILPGFGIVSHVISTFSRKPIFGYLGMAYAMVAIGVVGFIV
                     WAHHMYTTGLSVNTKMYFTAATMVIAVPTGIKIFSWIATMWEGSLSFKTPMLWAIGFI
                     FMFTVGGVTGVLLANGGIDNYFQDAYYVVAHFHYVLSLGAVFSLFAGFYYWFPKMSGR
                     MYNEVLGQLHFWIFFVGVNVLFFPMHFLGMQGMPRRYPDYPDAYATWNAVASHGYEIM
                     AASMVIFFVNVFWSLFAGRKAGDNPWGEGATTLEWTLSSPPPYHQFEQLPRID"
     gene            complement(360745..362055)
                     /gene="coxB"
                     /locus_tag="HL653_01635"
     CDS             complement(360745..362055)
                     /gene="coxB"
                     /locus_tag="HL653_01635"
                     /EC_number="1.9.3.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010184055.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c oxidase subunit II"
                     /protein_id="QJU56656.1"
                     /translation="MRRPHGIRRSPRLRSCPCLLAWPDRAADRRSGPGSQQGCSTACI
                     SARTGVGIGKIGRKGAEGAPRRDVSVSPLSHARHRGGKRVLLKTVRALILTLLAVLAG
                     AAPTFAQSAPAPAAAVPPVAEASAAPAAAPAPAGAPAEAAAAPAPAPEPVAKVPDIVH
                     AAPTPGIGQPTDSIRLQTQMTPIGEEAVRFHDIILVPMMVVMSVFVLLLLIWVVLRYR
                     AAANPTPSRTSHNTVIEVIWTLFPVLVLVSIAVPSIRLLAHQYHPPKADLTVKVIGNQ
                     WYWTYQYPDNGDFEVVSNLLKEKSEVKPGARFRTDADGPRLLAVDERMVVPAGAVVKV
                     ITTSNDVIHSFAMPAFWVKMDAIPGRLNETWFKVDRPGVYFGQCSELCGARHGYMPIA
                     VEVVSKAQYAQWVASKGGTMPGAKPAAVKTAAATPSSSLTVAQN"
     gene            362010..362594
                     /locus_tag="HL653_01640"
     CDS             362010..362594
                     /locus_tag="HL653_01640"
                     /EC_number="2.4.2.10"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015459544.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="orotate phosphoribosyltransferase"
                     /protein_id="QJU56657.1"
                     /translation="MTEDEVIAEFRAADALLEGHFILSSGLRSPRYLQCARVLMNPAR
                     AAKLTDALAARIPAEIRDQLDAVVSPAMGGVIAGHEMGRALGLDAMFVERPTGTFELR
                     RGFALTPGAKVLMMEDVVTTGLSSREAIRAIEAAGGTVIVAASLVDRSNGRVDLGVPF
                     FPLIRLDVPSYEADALPPELAAIPAIKPGSRAAA"
     gene            362594..363346
                     /locus_tag="HL653_01645"
     CDS             362594..363346
                     /locus_tag="HL653_01645"
                     /EC_number="2.6.99.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003050215.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxine 5'-phosphate synthase"
                     /protein_id="QJU56658.1"
                     /translation="MALTSPLGEPGRLRLGVNIDHVATVRNARGGLTPDPLRAAEIAQ
                     AAGADGITAHLREDRRHIVDADIARLIGGIALPLNFEMAATEDMVEIALRHRPHAACI
                     VPERREEVTTEGGLDAAGQHNRLKPLIARLNDAGIRVSLFIEPDARQIEAAIHLGAPV
                     VEFHTGAYAHAEGEALATELRRLADAAALAARNGIEPHAGHGLTYDNVMPVAAIPQLA
                     ELNIGHFLIGEAIFVGLDASVRRMRELMDAAR"
     gene            363468..363869
                     /locus_tag="HL653_01650"
     CDS             363468..363869
                     /locus_tag="HL653_01650"
                     /EC_number="2.7.8.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010126118.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="holo-ACP synthase"
                     /protein_id="QJU56659.1"
                     /translation="MIIGLGSDLCNIERIQQSLDRFGQRFTHRVFTDIERAKAERRTL
                     TRAGTYAKRFAAKEAFSKAVGTGFKAGVFMHDIGVVNLPSGAPTLALTGGAKARLDAL
                     TPPGHAVTIHLTLTDDHPWAQAFVILEARPL"
     gene            363902..364795
                     /gene="lepB"
                     /locus_tag="HL653_01655"
     CDS             363902..364795
                     /gene="lepB"
                     /locus_tag="HL653_01655"
                     /EC_number="3.4.21.89"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014849236.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal peptidase I"
                     /protein_id="QJU56660.1"
                     /translation="MSDTSPDLAAPPPLAKSKPDPKKTDWWAELRGIVWLVLGVLAVW
                     SFIAKPFYIPSESMMPTLIKGDRLIVTKYPYGWSYVSPSFHVLPFMKGRILGRMPERG
                     DVVILKPPTENSDYIKRVIGLPGDTIEVNRGILSLNGKPVKRVSMGVKMLPIDDNVPC
                     ASPLESQARKTGPDGKDYCELPVFRETLPNGVSYDTVDFGYQPGTGDDYGPVTVPADH
                     VFVMGDNRDESADSRYETWQLGLGGPVAWENLGGRADFITFSYDGSTKIWNPLTWFTA
                     LRGGRAGINLHPSHDAGAPAK"
     gene            364792..365874
                     /locus_tag="HL653_01660"
     CDS             364792..365874
                     /locus_tag="HL653_01660"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003050210.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AI-2E family transporter"
                     /protein_id="QJU56661.1"
                     /translation="MSDGAGTREEAPGPTDNSDPLTLREFKRAIVWVAVVVAVLLLWF
                     LSEPLLLIIGGIVVAQMLDGGVRLLGRILPVGRGIRLAIVATLVAAAMVAFLAFAGTQ
                     LTGQAQALQSVVTHQLQSWMDWAHERGFLPAGSGVSEIGQQLMGSFGKVTAALGTALG
                     ALSSMAMILVLGLFIAMEPRLYERGIAWMLPMANRESFYETTKEMGSTLRRLMAGRLL
                     GMALEGVFVAIALEIVGVPMATLLGILTGLLAFLPNIGAIVSGVLIVLVGFSAGTDTG
                     IWAIVVYVSVQTFDGYVVVPMVARRSVDLPPALVLGCQLLFGALFGILGLALADPMVA
                     MVKVLLEKSSALKAEKAEAAAAEEAA"
     gene            complement(366178..366771)
                     /locus_tag="HL653_01665"
     CDS             complement(366178..366771)
                     /locus_tag="HL653_01665"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017181942.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FKBP-type peptidyl-prolyl cis-trans isomerase"
                     /protein_id="QJU56662.1"
                     /translation="MSEVTAVPLRPVNKAGLAALFTSIGVLIVVGIGSAYATTKAPVM
                     LAMPPAEFLAANAKRSGVKTTASGLEYQVLTAGDGPTPTLADAALVEYKGSLTSGQVF
                     DASKPGQPVPMQIGQVVPGFAEALTLMPKGAKYRVWIPPQLGYGEREAGPIPANSVLV
                     FDITMHEFAAVPQPNAEMMSAPHADGTPGTPPPTTIQ"
     gene            complement(366778..366984)
                     /locus_tag="HL653_01670"
     CDS             complement(366778..366984)
                     /locus_tag="HL653_01670"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010126124.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S21"
                     /protein_id="QJU56663.1"
                     /translation="MQIIVRDNNVDQALRALKKKLQREGVYREMKLRRHYEKPSEKRA
                     RERAAAIRRARKLERKRVERDQAR"
     gene            367280..367840
                     /locus_tag="HL653_01675"
     CDS             367280..367840
                     /locus_tag="HL653_01675"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006959158.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="(2Fe-2S)-binding protein"
                     /protein_id="QJU56664.1"
                     /translation="MTSFTVNGDPVHYKLDPATPLLWALRDASNLTGTKYGCGAGQCG
                     ACTVHVDGVARRSCQVPIGSIEGSFVTTIEGLTADRGHPVQQEWVAAQVPQCGYCQSG
                     MIMAAAALLARTPRPSDEQIDEAITNLCRCGTYPRIRAAIRRAGEALAGGDPISAAPP
                     PKIDPADAAAAVPALSPPAPAAPPKR"
     gene            368001..368840
                     /locus_tag="HL653_01680"
     CDS             368001..368840
                     /locus_tag="HL653_01680"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010187344.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent RNA helicase"
                     /protein_id="QJU60392.1"
                     /translation="MGKLLLAAAVGVSLPAMAVAQRGPDDQDRGGRQERGPDQQRPQQ
                     QQQGQRGFQGARPDQQQRGPQDWQRNRQDPQRAIQEPDRTGRPDRPEGFNRDGGPGRF
                     GAGNPQPGGNDRRDDGRRFDGRPGDNRGEYRPGFNGRPNDPRFGNRPGFDNRPGFDGR
                     RPDDRRWDNGRPSNDRWVGSNWRQDRRYDWRGYRDYNRNQFHIGGYIAPRGWGYGYRR
                     YSVGAVLPSLLWGSGFWLNDPYAYRLPPAYGPYRWVRYYDDVLLIDTRTGRVVDAIPG
                     FFW"
     gene            368933..369406
                     /locus_tag="HL653_01685"
     CDS             368933..369406
                     /locus_tag="HL653_01685"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012049753.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RcnB family protein"
                     /protein_id="QJU56665.1"
                     /translation="MRKLIIAGLMAATLVPTIASAQNRELRHDRQDIREEQRDVNRAI
                     RNGAPPHVVRDQQRDVREARREYREDWRDYRRGNPNVFRGPAYVGPRGYAYRPIAPGY
                     RFDRLYYDRRYWIDPVRYRLPAAAYGRRWVRYGNDVVLVDVRTGRVVTVYNSFFF"
     gene            complement(369760..370707)
                     /locus_tag="HL653_01690"
     CDS             complement(369760..370707)
                     /locus_tag="HL653_01690"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010183509.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isopenicillin N synthase family oxygenase"
                     /protein_id="QJU56666.1"
                     /translation="MATTLETPTVPTVSLADEARDPIGFAQALGGSFERYGFAIVADH
                     GVPPEVIAQADATAKAFFALPDDVKRQYANASGGGQRGYIPFGIETAKGAKAHDLKEF
                     WHVGRELPAGDPLRDVMPDNVWPAEIEDFRRAQLALYDALEDAGRRLLTAIARYLNLP
                     ADFFDATIENGNSVLRLLHYPPMGPDGPSIRAGAHEDINTITLLLGAEEAGLELLDRD
                     GNWLPVQPKPGELAINVGDMLQRLTNNVLRSTTHRVLNPAPERRGFARYSMPFFLHFR
                     PDYLIETLPQCVGPDRPNLYAPITAHDYLYERLREIKLV"
     gene            complement(370765..371592)
                     /locus_tag="HL653_01695"
     CDS             complement(370765..371592)
                     /locus_tag="HL653_01695"
                     /inference="COORDINATES: protein motif:HMM:NF020374.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56667.1"
                     /translation="MDGIQVIQQTGAERLVEALYYGILGRAPDAAGLAVNTKILEGSV
                     DFSLAADMAINFLHSDEAQQKRALAGCREPTHVRVLSLGTHCAAAWAIKSAELKQASY
                     PFDWIFSSADIVLHCLQDDFETFLDAAHYADIDGQACSHRFYMEAYGEHRLFNHRSPL
                     VEGGYDYYRRGVARFRQDVYGGTGSLLFMLGSIDKAAPSRFEALADLLDQRAPHASLL
                     MVSVLPPDEIGRIGFSDLAGRGRHKSLLYRPNSTLGPLEFPRPIDNLMIRALLQSEI"
     gene            complement(371793..373424)
                     /locus_tag="HL653_01700"
     CDS             complement(371793..373424)
                     /locus_tag="HL653_01700"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017977593.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF853 family protein"
                     /protein_id="QJU56668.1"
                     /translation="MSDPTGLFVGATAAGERQMLELKRANRHGLIAGATGTGKTVTLQ
                     GIAEGFSKAGVPVFVADVKGDLAGLAMAGSPTAKTNEAFTARAAEIGMSDWAYADNPV
                     IFWDLFGQAGHPVRTTISEMGPLLLARLMALNDVQEGVLNLVFKVADEQGMLLLDLSD
                     LQAMLAWTAENAADLSARYGNVTRATVGTIQRQLLQLEAQGGDGFFGEPALDVKDMML
                     IDEAGRGTISVLAADKLMAAPKLYATFLLWLLSELFETLPEVGDPDKPKLVFFFDEAH
                     LLFDDAAPALIDKVEQVVRLIRSKGVGVYFITQNPIDVPDDVAGQLGNRVQHKLNAFT
                     PREQKAVTSAAQTFRASPGLDVATAITELKVGEALVSLLQPDGAPAPVSRTLVRPPCS
                     RAGPLTDKERAVMISTSPVAGKYDTPVNRESAAEILSQKAGDAKAAVEKAKADAELAK
                     QQAEAAKAAAAQAKLDAAEQARRDKEAERAAAAQAKAEERARIAAEREAAKPTLTDKM
                     IQSAARSVASSVGRQVAGQLGSQLLRGLLGGLFKR"
     gene            373614..373943
                     /locus_tag="HL653_01705"
     CDS             373614..373943
                     /locus_tag="HL653_01705"
                     /inference="COORDINATES: protein motif:HMM:TIGR01352.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB family protein"
                     /protein_id="QJU56669.1"
                     /translation="MVSVLALLLATAAPGSSADAVREPHPVTANTAAARPGRISLHNN
                     DAGVVRVRLSLGPNGVPTSCTVVKSVAPALDQATCEGMMDRARFEPAPEEMRGALVTE
                     RSVTWWR"
     gene            complement(373995..375545)
                     /locus_tag="HL653_01710"
     CDS             complement(373995..375545)
                     /locus_tag="HL653_01710"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019830995.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Do family serine endopeptidase"
                     /protein_id="QJU56670.1"
                     /translation="MRYAYAITAAMLLGGAAATVTLQQPVGAQVAQNAPSQMAAVAPR
                     GAPMSFADLAAKLQPAVVNISTTQKVQLKQQQQNPFAGTPFDEFFRRFGGQGGQGGGA
                     TPQTREAVSLGSGFIISADGFIVTNNHVISGVPTDQGKVTISSIKVTLTDRKEYTATV
                     VAKDPTSDLAVLKIDAKNLPFVQFGDSTKSRVGDWVIAIGNPFALGGTVTAGIVSAIH
                     RSIGSGPYDRYIQTDAAINQGNSGGPMFDLNGNVIGINTAIYSPTGGNVGIGFAIPAE
                     QAKPVIQQLMKGTPPKRGYFGVVIQPMDDDIAAGLGLPKDVGEIVARVEPGQPAARAG
                     IQQGDVIVKVNGTDVTPDNTLSYIVAGLPVGSRVPVEYIRNGKHATTTAVVTQRPSED
                     QLASAVGDDDEDGPIGNGQDTPAVKNALGVTLQSMSPGIARQIGVPETTTGAVITSVD
                     PSSDAATKGLQPKDIIVAVGQRRVATVQEAAAAVEAAKKAGMKTVLLLVQRGTRPAQY
                     LGVDLTGK"
     gene            complement(375768..376634)
                     /locus_tag="HL653_01715"
     CDS             complement(375768..376634)
                     /locus_tag="HL653_01715"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012048571.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protease modulator HflC"
                     /protein_id="QJU56671.1"
                     /translation="MNGFDSIRRNPIFWGGLVLVVLGVLFSVFLVVPETKQALIVRFG
                     MPKRIANGYDSKEEFGRTGAGIVWRIPGMESVVWVDKRVLDFDMQRQAVLSTDQLRLE
                     VDAFARYRIVDPVRMYVSAGSERRVGEALKPILGSALRNELGKRPFRDLLSPERGEMM
                     EDIKTAVARVAKQYGAEIVDVRIKRADLPDGAPLESAFNRMRTARQQEAKSIEAGARR
                     EAQILMGEADANAARTYAEAYGKDPGFYDFYRAMQSYRATFGTDDDQPRGSSQIILSP
                     DSEYLRQFRGGK"
     gene            complement(376631..377704)
                     /gene="hflK"
                     /locus_tag="HL653_01720"
     CDS             complement(376631..377704)
                     /gene="hflK"
                     /locus_tag="HL653_01720"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009822194.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FtsH protease activity modulator HflK"
                     /protein_id="QJU56672.1"
                     /translation="MDASGRLEEAGAVLNEGGPWGGGSGGGDGAGGGSGGPGRNPWGG
                     GGKPSGKPGPSALDALVRRGRARFGGGGGGAGGNGLPQLPGAIWAWGILGLVLLWMAL
                     TSTHTIGPQQRGVVTRFGKYVGMLQPGLRFSLPAPIDIVTKIDVDNIHVVDIDGGAAG
                     ASGQNLMLTGDENLIDLAYSVRWNIRDPELFMFELSDPEGTIREVAESAMREQISNVT
                     LNAAIGPQRAIIEQRVALRMQELLDEYRAGVAVQGVAIKQADPPGEVMDAFKEVSAAQ
                     QQAQSYLNQARAYATQKTAQAQGEAAAFDSVYQQYKLAPEVTRRRLYYETMEKVLAKT
                     DKTVLEAPGVTPYLPIPPKGASK"
     gene            377776..378780
                     /locus_tag="HL653_01725"
     CDS             377776..378780
                     /locus_tag="HL653_01725"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009822193.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Mrp/NBP35 family ATP-binding protein"
                     /protein_id="QJU56673.1"
                     /translation="MSDLPLLAAALDSVSDPVSGRGLLASGRASAPRLEGGRADVIVD
                     VAGLAAVDRTALEAAVRAALLAVPGVSEARILLTADRPQRRIIAVASGKGGVGKSTVA
                     ANIAVALARRGVKVGLVDADIYGPSQPRLFDAHDRPDAKDKIMFPVPTRWGVPILSMG
                     QLIEPGKAIAWRGPMAAGALSQLVDAHWGQTDVLILDLPPGTGDVQLTMIQKHRPVGA
                     VIVSTPQDLALIDATRAIDLFFKAEIPIVGLVENMAGYACPHCGEISDPFGQGGAEAE
                     AAALGLPFLGRIPLARGIRTASDAGMPPAAGDGPDAAPFHAIAAQIETWLNPSASPVF
                     "
     gene            378894..379322
                     /locus_tag="HL653_01730"
     CDS             378894..379322
                     /locus_tag="HL653_01730"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010123784.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CoA-binding protein"
                     /protein_id="QJU56674.1"
                     /translation="MPLTTDADIAALLAETRTIAVIGASDRPDRPSWGVMRVLQDWGY
                     RILPVNPQITGEHVHGEYVWRDLDQIGEEIDMVDIFRRPQAAGEAVDQAIAIGAKSVW
                     LQIGVINEEAAARAEAAGLKVVMDRCPAIDLPRLGVPKKG"
     gene            complement(379450..380235)
                     /locus_tag="HL653_01735"
     CDS             complement(379450..380235)
                     /locus_tag="HL653_01735"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015459080.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3'(2'),5'-bisphosphate nucleotidase CysQ"
                     /protein_id="QJU56675.1"
                     /translation="MPAPDADLISAIADAAREAGALAARRSSDAYRQWEKVPGHPVCE
                     IDLEVDALLFDRLKRIDPSAAWLSEETADSPERLGVERVWVVDPIDGTRDYLRRRPGW
                     SVSVALVERGQPIVGVLEAPERGETWIAAKGLGATLNGATLRAGDRTTLAGARVPADT
                     LPKVDQDLVAMPRPNSIALRIAMVANDEVDLCASLRWGSEWDIAAAALIAEEAGAAVT
                     DPLGRPIRFNKPVPEVFGILASGRALHPVALERLAERAQAADR"
     gene            complement(380222..381562)
                     /locus_tag="HL653_01740"
     CDS             complement(380222..381562)
                     /locus_tag="HL653_01740"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010126510.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TldD/PmbA family protein"
                     /protein_id="QJU56676.1"
                     /translation="MTSVSEDRVAALVEAARRAGADAADAVYYRSESTQVQVRLGALE
                     DVQRSDGEEIGLRVFVGQRSASVSSSSLTDDAIAALVERAVAMAREAPEDPYAGLAPA
                     DRLLTGAAPEIDGDDGADPAPDRLRELALVAEEAARAVAGVTNSEGAGASAGRTAMAL
                     ATSTGFVRGFSSSGYGLSASVIAGEGASMQRDYAYHSTRHLADLEAPEAIGRRAGERT
                     VARLNPGKLPSGPMPVVFDPRVGSSLIGHLAASVTGSAIARKTSFLLGMLGEQVFARG
                     LFLRDDPHRPRGLRSRAFDGEGLPTQAIDLIDDGVLTTWLLDSASARQLDLAPTGHAT
                     RGGSGAPGAGTSNLYLDKGALSVAELIGDIKTGLFVTELIGQGVNMVTGDYSRGASGF
                     AIRDGQLAEPVAEVTAAGNLKEMFLQMTAADDLVFRRAHDVPTLRVDGMTVAGA"
     gene            complement(381612..382040)
                     /locus_tag="HL653_01745"
     CDS             complement(381612..382040)
                     /locus_tag="HL653_01745"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011087865.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="QJU56677.1"
                     /translation="MDVTIERERIVEVSAPAEPEGAADHNPAACSRVAPILQRIGDKW
                     SILIVMTLAGGPRRFNELKRQIGGISQRMLTLALRGLERDGLVSRHVTPTIPPRVDYA
                     LTELGMSLRAPMMTIGAWANEHYDTIQDARARFDRGEKEA"
     gene            382133..382699
                     /locus_tag="HL653_01750"
     CDS             382133..382699
                     /locus_tag="HL653_01750"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018458327.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FMN-dependent NADH-azoreductase"
                     /protein_id="QJU56678.1"
                     /translation="MKLLHIDSSILGEGSVSRQLTASIVEQFRKADPSIEVITRDLVA
                     EPVPHMTIATLPAANPDLRDDLKQLQSADIVVIGAPMYNFSVPTQLKAWIDRIAIAGE
                     SFRYTETGPEGLLGGRRVIVALSRGGHYGAGTPAESLEHTETYLRSVFGFIGITPEFI
                     AADGIGLGPDARTAAIEKALGDVSALAA"
     gene            complement(382791..383702)
                     /locus_tag="HL653_01755"
     CDS             complement(382791..383702)
                     /locus_tag="HL653_01755"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009820458.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxybenzoate octaprenyltransferase"
                     /protein_id="QJU56679.1"
                     /translation="MPDMIVPDSEGRGLLARLPGRARDLIQLARLDRPIGAWLLFWPG
                     AWAIALAGQAVARWDLILWFALGAVAMRGAGCVYNDIVDRDLDKRVARTAARPLASGR
                     LSLKLAWGWLLALSLVGLIVLLQLERTAQIAALASIAPVAAYPFMKRITWWPQAWLGI
                     VFSWAALVGWPAVTGSIDAPLLWLYGGSIAWVIGYDTIYALQDIEDDALAGVKSSARA
                     LGAHARGGVTGFYAVALACWAMALWRVRPEPLALVGLLPMAAHLLWQVAGLRKEDPAD
                     ALARFRSNRFAGLLMFLACLVVGTTSL"
     gene            383741..384478
                     /locus_tag="HL653_01760"
     CDS             383741..384478
                     /locus_tag="HL653_01760"
                     /EC_number="2.1.1.193"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015459005.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA (uracil(1498)-N(3))-methyltransferase"
                     /protein_id="QJU56680.1"
                     /translation="MPATPAWPPASTPRLFLDQPLSDGALLTLDGAQANYLANVMRLK
                     AGDPVRLFDDRTGEWLAETNDAGRRSVRLRITAKLREREAVPDIWLLFAPLKKDRLHY
                     LIEKATELGAARLQPVLTQRSIVDKPNPERLRAHMIEAAEQCDRTALPELADQEKLTA
                     VLANWPEDRALLFADEAGGQPIASVAPGAAAILIGPEGGFTDEERARIRAHPKAVPIS
                     LGPRILRAETAAAAALAAWMTLYGDWR"
     gene            384475..385353
                     /locus_tag="HL653_01765"
     CDS             384475..385353
                     /locus_tag="HL653_01765"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005420908.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lytic murein transglycosylase"
                     /protein_id="QJU56681.1"
                     /translation="MIPLLAGLALAAAPSPTIVTTDVDRFFRIYGAAQGHPGVADLQA
                     YVDDGSPGLHDFARLRALSGETIEKAIARKPAVYERARSCAPVLPRVRQRLSAALERL
                     AKRYPPATFPPITILIGRNSTGGTTSPTGVLIGLEMLCSADYLEPDIESRFVHVIAHE
                     YAHVQQPGAAVESPDVPLLFVAMIEGGAEFVGELTSGGVSYQHLRRWTKGHEAEILAR
                     FAAERSKTDTSDWLYNGPGDPAHPGDLAYWVGYRIAKAYYSRAADKKRALAEIIAVTP
                     STAETIYQASGLAPGQ"
     gene            385411..386787
                     /locus_tag="HL653_01770"
     CDS             385411..386787
                     /locus_tag="HL653_01770"
                     /EC_number="6.3.2.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019053443.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate--cysteine ligase"
                     /protein_id="QJU56682.1"
                     /translation="MTTRAADTGHDPLIEGRADLIGVFARGEKPKADWRIGTEHEKFV
                     YWNDATHRAPSYAEKGGIHALLIGMTKFGWEPVYEGENIIALSGPDGAISLEPAGQFE
                     LSGAPLDNLHETCAETGRHLAQVKEIGEKLGIGFLGLGFWPDKTRAELPIMPKGRYDI
                     MLRHMPRVGQLGLDMMLRTCTIQTNLDYASEADMVKKFRVSLALQPLATALFANSPFT
                     EGKPNGFLSYRSHIWTDTDPHRTGMLPFVFEDGFGYERYADYMLDVPMYFVFRNGGYI
                     DAAGLSFHDFLDGKLSVLPGETPRIEDWKDHLSTAFPEVRLKSFLEMRGADGGPWNTI
                     CALPAFWVGLLYDDQALDAAWDEVKHWTIEDHNRIREQVPRLGLATKGPRGRTFQELG
                     RRILDIAHAGLAARGRLNASGDNETGFLDPLREIVASGKEPARRLLDLYEGEWSGDLS
                     RIYQDMSF"
     gene            386976..387425
                     /locus_tag="HL653_01775"
     CDS             386976..387425
                     /locus_tag="HL653_01775"
                     /inference="COORDINATES: protein motif:HMM:NF012422.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator transcription factor"
                     /protein_id="QJU56683.1"
                     /translation="MHLVAEGMETKEIARALNISPATVNNQVQTAKTKIGISDRWAAA
                     HALRRHLESSDDRLTNEPQTLSKMGEFLPPQVVSNQGARQPDSIVDTLPKENVAFVTS
                     VRDWPEPSPEQGRRNQHDTYERISMLLVRTVLLLAATVALLWVYGRH"
     gene            387484..387810
                     /locus_tag="HL653_01780"
     CDS             387484..387810
                     /locus_tag="HL653_01780"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56684.1"
                     /translation="MSSFIATDIAVARAIRDVESASTATLRKSAHLITILVDASEARS
                     LSPMQDQDTLARAGRLVTEALAFRAESLNIHRQMAEMGQQLGLPVVSVGDVCQEYLTS
                     GALKAA"
     gene            387865..388401
                     /locus_tag="HL653_01785"
     CDS             387865..388401
                     /locus_tag="HL653_01785"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56685.1"
                     /translation="MSPLLRSVLALCTFLLVCAYALRRGGKPERWAASILLAGMVLTW
                     ALIRHSAQRYHAPEIGVAVADGLTLVALVWLMLRADRYWPGWLAAMQAIVVLSHLAML
                     LRVTDIPGYYKNTIQLWIYPQLAVLATGVLRHRLRTAPGPAERTIGRAAASLWRRARD
                     GAIGTALRRLHHVRPGTD"
     gene            388508..388789
                     /locus_tag="HL653_01790"
     CDS             388508..388789
                     /locus_tag="HL653_01790"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007686850.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="winged helix DNA-binding protein"
                     /protein_id="QJU56686.1"
                     /translation="MLPDQLFADPAWDMLLYLVVAEEEGRRSSISRLCRAAAVPTTTA
                     LRWIGVLESQDLVRRTPHPSDGRIFVVSLTEKGSADMHGLLATYRLRPA"
     gene            complement(388816..388889)
                     /locus_tag="HL653_01795"
     tRNA            complement(388816..388889)
                     /locus_tag="HL653_01795"
                     /product="tRNA-Gly"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:complement(388855..388857),aa:Gly,seq:tcc)
     gene            389024..389109
                     /locus_tag="HL653_01800"
     tRNA            389024..389109
                     /locus_tag="HL653_01800"
                     /product="tRNA-Tyr"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:389058..389060,aa:Tyr,seq:gta)
     gene            complement(389308..390564)
                     /locus_tag="HL653_01805"
     CDS             complement(389308..390564)
                     /locus_tag="HL653_01805"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015338811.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tetratricopeptide repeat-containing protein"
                     /protein_id="QJU60393.1"
                     /translation="MPRLRSLILQDAIPAIDARSEILGLHRVLPMAFNEIDVSGHLQA
                     LADRIVVDARDAAAMMDMSMLLQAHSFADQARSLLDEATRIQKDFCIVHGDGSGIRLL
                     AFVTPGDFMANTPLDFLLNGSNAVLWLHFVDGDTADLRNLPAHDVAFFAIGEANHHGP
                     VLTRMAELLAGWDGPIMNNDPTLIAGLTRDGVSALLDDEPSILVPANRRFPRDALAAV
                     AAGADAMQVLGSAFPLIVRPIGTHAGHGMDKLDDEAAIARYLDGEGSTHFYAAPFIDY
                     RGAEGWFSKQRIVLIDGKPYPSHLALSDHWMVHYLNAGMMENARKRAIEADWMERFDD
                     DFAVRHRAAFEALYRRIGLDYFGIDCAELPDGRLLVFELDVAMVVHDMDDVTVFPYKK
                     PAMQALFDGFVAAAEARRLPVLEYAA"
     gene            complement(390552..392090)
                     /locus_tag="HL653_01810"
     CDS             complement(390552..392090)
                     /locus_tag="HL653_01810"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009205583.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome D ubiquinol oxidase subunit I"
                     /protein_id="QJU60394.1"
                     /translation="MSLQSRVPSVLDREGETVARSRPVPALSPEATTPSATLDPQDWG
                     AVRRQGHRMLDDMFDHLEGLAQQPVWQCAPDHIRAAMRAPLPIEPVDLAEVHAGFRET
                     ILPYGSGNIHPGFMGWVQGGGTPVGMLAEMLAGGLNANLGGRDHMPIAVEQQIVAWMR
                     EIFGFPSTADGLFLTGTSQANFVALLIARTRVCGSGVRTGGVRAGDKLVAYASEGVHG
                     CVPRAMEMAGIGSDNLRRVLTNERGQIDLAALRRQIVRDEADGFRPFLIVGTAGTVNV
                     GAVDDLAGLARIAAEHRIHFHIDGALGALGILSDELAPLFDGIELCDSLAFDFHKWGQ
                     VPYDAGFLLVRDGAWQRETFASPAAYLTRAKTGLAAGEWWPCDTGPDLSRGFRALKTW
                     FTLKTYGVRALGHAMAASCRLARSLAERIAHEPDLVLLAPVELNIVCFGYASRDALDD
                     GAINARIVERLHAIGEVAPSLTTIGGKPAIRAAFVNHRTTEADVDRLVESVLAAGGDL
                     LSRA"
     gene            392371..393117
                     /locus_tag="HL653_01815"
     CDS             392371..393117
                     /locus_tag="HL653_01815"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012048641.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA methyltransferase"
                     /protein_id="QJU56687.1"
                     /translation="MRRGHRPSQPVSGKPRFWGRHAVASALANPERTIRRIWVTREAA
                     AAFGGFPDHIPTSFAEVTDLARLVPGDAPHQGIVIEVDPLDDIWLADLLERGESNQRP
                     LIVLDQVTDPHNVGAVLRSAAAFDALGIVTQDRHAPPEGGALAKAASGALEFVPWVRV
                     VNLARALDEIGEAGFWRIGLTGAGKRTFNDAIGTARVAVVLGAEGEGMRQNTEAHCDE
                     LARLPISPRVESLNISNAAAIALYALATRG"
     gene            complement(393283..393600)
                     /locus_tag="HL653_01820"
     CDS             complement(393283..393600)
                     /locus_tag="HL653_01820"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010162575.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2Fe-2S iron-sulfur cluster binding
                     domain-containing protein"
                     /protein_id="QJU56688.1"
                     /translation="MPKLIVTLRDGSTQEIEGEDGLSVMEVIRDAGIDELLALCGGCC
                     SCATCHIHVDPAFADRLPPMSEDESDLLDSSDTRDETSRLSCQVPFSAAVDGLAIRIA
                     EED"
     gene            393675..394319
                     /locus_tag="HL653_01825"
     CDS             393675..394319
                     /locus_tag="HL653_01825"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010544483.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-3-methyladenine glycosylase 2 family
                     protein"
                     /protein_id="QJU56689.1"
                     /translation="MGLSEGDLRRGLDALAKVEPAFAAGLALHGYPAPRTGVRGHVAL
                     LRTIVGQQVSTASANAIYGRLEALIGPTMDVAVIVATPDESMRAVGLSRQKISYVKSL
                     AELIANGELDLAHLPEDDEEAIAQLTRIKGIGRWSAEIYLLFAEGRPDVWPAGDLAVQ
                     IEIGHLLGHDARPAEKLVRSLSGPWSPHRGALAIFAWHHYGRRLSAKGADKAPI"
     gene            complement(394421..395212)
                     /locus_tag="HL653_01830"
     CDS             complement(394421..395212)
                     /locus_tag="HL653_01830"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014849001.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NTP transferase domain-containing protein"
                     /protein_id="QJU56690.1"
                     /translation="MSEASWTAILLAGQRPGIDPLAHALGESRKAKVKVGGEAMLSRV
                     AKTLLAAPAIGRVVVMAQTPEFLFDGDCAWMAEEPRIGTVHSDSGIATSVAAVAGTAA
                     APWPVLVTTADHPLLTVPMIEAMIAGAGDADVAVGVVGRRTLLAAYPDNRRTWLKFAG
                     EAWSGANLFALQSDRAQVALKLWSEVERDRKKAIKLISHFGPWLAVRAITRTITLDAA
                     MLAVGRKFGMTARPVALPFAEAGIDVDKVSDHELAEAILAAREVH"
     gene            complement(395209..396276)
                     /locus_tag="HL653_01835"
     CDS             complement(395209..396276)
                     /locus_tag="HL653_01835"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007684270.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CDP-alcohol phosphatidyltransferase family
                     protein"
                     /protein_id="QJU56691.1"
                     /translation="MTLPPLVPAGDTDTLIWGMTTRERLRRIAAAQGFALAESAGGGE
                     ALIVDLAYVFDPLWLKYAAARPGTAITRDGVPVIAHVTPGRPDPARLEAIPQETTEVE
                     NQTLRKRERPFMERLTPATVGLIERASYWGAYKGVTDILTKYMWPEWAFHMTRIAARF
                     GITPNQVTTISAVFCVIATWCFFTGDYWPGLAAGLFMMILDTVDGKLARCTITSSAWG
                     NVFDHGMDLVHPPFWWYGWGVGLIAYGRPLSETDFWLSMVAIMGGYVIQRLIEGAFIA
                     LFGIHIHVWRRFDSWFRLITARRNPNMVILTALLAIGRPDWGLLAVAWWTVISLVVHL
                     VQLAQAMFDRARGRPVKSWLE"
     gene            complement(396273..396965)
                     /locus_tag="HL653_01840"
     CDS             complement(396273..396965)
                     /locus_tag="HL653_01840"
                     /inference="COORDINATES: protein
                     motif:HMM:NF012655.1,HMM:NF025605.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR/AcrR family transcriptional regulator"
                     /protein_id="QJU56692.1"
                     /translation="MAPAPGRAGCQQESVLYSIVMSEPIARTKRDERKECRREAIIEI
                     AKRAFLEHGFAATSMSRIAAQCGGSKTTLWSHFPSKEDLFQAFVDKLVGDFAGALDEA
                     LLIGGGTEAALRRFGRVFVAKILSPESLGLKRLLAAEGHRFPEMTRVFYESGPKRTRA
                     RLAIYIASEMAAGHLRQGDSEVAARQFLSLCQAGCFSDMIWHRAGGPSSTPEADVDLA
                     VEGFLRIWGTTE"
     gene            396977..398413
                     /locus_tag="HL653_01845"
     CDS             396977..398413
                     /locus_tag="HL653_01845"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017183859.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="efflux transporter outer membrane subunit"
                     /protein_id="QJU56693.1"
                     /translation="MVSQLSPWRAAAALLATTPLLAACVPNVGPAPQPRSAGSLASAQ
                     AVPASTGQWPGEGWWQAYGDPQLDALIREGLAGSPDIATAAARVARAEGMAQAAGAAL
                     GPNLTANGRAGGTKQSYNNGIPAEFVPKGWNSTGDLSLGLGWDLDLFGRNRATRRAAL
                     DERDAVRIDATAARLTLAASIASAYADLYRLYAERDVTEQASRIRTDSAKLVADRVAN
                     GLDTEGERAQADSQVPATRADIAVLDTSIELVRHQIAALVGAGPDRGLTIARPQLAGL
                     GMAALPANIGIDLVGRRPDVVAARLRVEASNQRVKAAKAAFYPDVSISALIGFQSLGL
                     SNLLKQNSYYGNAAPAVSLPVFDSGQRAGDYRSQRGDYDAAVADYDRTLLTALREVAD
                     AVSNRAGLQREDTDARTALARSETAYKIARLRYEGGLSTYLSVLTAEDAVVAARRRVA
                     DLQARAYTIDIALIRSLGGGFASEQGKG"
     gene            398413..399624
                     /locus_tag="HL653_01850"
     CDS             398413..399624
                     /locus_tag="HL653_01850"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010545811.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HlyD family efflux transporter periplasmic
                     adaptor subunit"
                     /protein_id="QJU56694.1"
                     /translation="MAEDNPKIDASEIPPEVKRQEEASKPAAPAKPEQSQPDPAEQKA
                     KRKRLLTILGIVVGVIAVILLLYHFLIGVRHVSTDNAYVGVDSAQITPLVAGQVAEVR
                     VSNTQFVHRGDILLVIDPADARIAADRAAADLAQTRRQLTQTRSTGSSLSAEVTARDA
                     DIERARAERVSAQADFAKAQTDLSRREKLAGAGAVSGDELTTARNAFATAQARLLVSG
                     AAINQALANKKAALQRLAANEALTEGPTEENPDVASARARYDAAKLDLSRTVIRAPMS
                     GIVAQRNVQVGQRVAPGTAVMMVVPSASMYVDANFKEGQLKKVRVGQPATLSADIYGG
                     SVDYHGKVIGLAGGTGSAFALIPAQNATGNWIKVVQRLPVRIALDPKELADHPLRVGL
                     SMDVDIDVSEH"
     gene            399627..401159
                     /locus_tag="HL653_01855"
     CDS             399627..401159
                     /locus_tag="HL653_01855"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012569163.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DHA2 family efflux MFS transporter permease
                     subunit"
                     /protein_id="QJU56695.1"
                     /translation="MASAAATAPQARPAVNPWLVGVILALSNFMVVLDISIANVSVPH
                     IAGSLAISPDQGTWVITSYSVAEAICVPLTGWLVARFGTVRTYLVAMTGFGIFSVLCG
                     LSTTLGMLVACRIGQGICGGPIMPLTQTLLMAVFPPEKRGQGMGLWAMTTVVAPIAGP
                     LLGGPISDNWSWHWIFFINIPIAIICVGGSFINLKSFETPTRAAPIDKGGMILLVIWV
                     GALQIMLDIGRDHDWFSSDLIKVLAVVAAIGFVAFVIWEMTEEQPAVNLRVFRHRGFT
                     MSVISLSLTYAIFFSAIVVTPQWLQGAMGYTATWSGFVVAWQGLFAVIMSPIVGKLVA
                     KTDPRRIYTIGVLWMGVTMLIRSHWSTDVDYFHLMLPHLLLGIGMPMFFVPVTMIALA
                     AVDPHEVPGAAGLQNFARTLSGAFGTSIATTLWQNGAEAQRSELTNILQPGLYQDQLA
                     QAGFVGERARGLLEQLVMSQGFALSLVHIFQGAAVLLFISSTLVWFAPRPRAAPPPGS
                     AH"
     gene            401356..402063
                     /locus_tag="HL653_01860"
     CDS             401356..402063
                     /locus_tag="HL653_01860"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008601522.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sterol desaturase family protein"
                     /protein_id="QJU60395.1"
                     /translation="MNMRQLVVAFFQYPAIIAYILIAIVAAVVSGLYPTSALQTIAAV
                     ASSILLYPLVWYALHRWVLHSQWMYKVPFLASTWKRIHYDHHQDPNHLEILFGALHTT
                     LPTIFLASAPVGWLIGGLGGAAAAFSSGLLMTCFYEFCHCIQHLAYTPKHPALVMMKQ
                     RHMAHHFHDETGNFGITNFFWDRLFGTMYAKVSERKKSPTVFNLGYTPEVAKRWPKVA
                     ELSGGVATGHPSTRIKH"
     gene            402078..403253
                     /locus_tag="HL653_01865"
     CDS             402078..403253
                     /locus_tag="HL653_01865"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010183837.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase"
                     /protein_id="QJU56696.1"
                     /translation="MATSSATTIRPVVTKADRKAFVNLPFRLYAEDPAWVPPLKDESM
                     GLITPGKNPFFEHAEAQLFLAERGGEIVGRISASIDHAWTPMPADKGGGADSGNWGYL
                     DAEDQETARLLIARAEDWLREKGVKRSIGPISMSIWEEPGLLIRGHDQSPTVMMGHDD
                     KRYEAWVEAAGYAKVKDLHTWELDITRQFPPLIQRIIQSGEKNPRIRIRKVDKSKFAE
                     EAAIILAILNDAWSDNWGFVPFTASEIAFAGKKMKPIIFNDLVRVAELDGEPVAFMMT
                     WPNLNELQADLNGELFPFGFIKLLWRLNGGFSGKPKVNTMRVPLMGVVKRLQASRMAS
                     QLAFMMIEYIRRDSVAYYGSTRGEIGWILEDNQGMNSIAEAIDCTINKTYRIYEKTL"
     gene            403250..403573
                     /locus_tag="HL653_01870"
     CDS             403250..403573
                     /locus_tag="HL653_01870"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019834311.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF167 domain-containing protein"
                     /protein_id="QJU56697.1"
                     /translation="MTALPWAEDGAGLRLAVRVTPKASRGAVAGIIADADGRPLLSIR
                     IAAPPVDGAANAGLIRFLAKQLRLRASDITIASGETGRVKMVRLAGDRETLAERLTAL
                     ANGTG"
     gene            complement(403743..404522)
                     /gene="xth"
                     /locus_tag="HL653_01875"
     CDS             complement(403743..404522)
                     /gene="xth"
                     /locus_tag="HL653_01875"
                     /EC_number="3.1.11.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006963430.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exodeoxyribonuclease III"
                     /protein_id="QJU56698.1"
                     /translation="MKIATFNINGIGARLPRLLEWLEETKPDVACLQELKAPDERFPE
                     MEIRAAGYSAIWHGQKSWNGVAILAREGLDLVETQRGLPNDPDPSHSRYIEAAVGGVI
                     VGGLYLPNGNPQPGPKFDYKLAWFEALLERAQTLFASEQPVVLAGDWNVIPTDHKDDI
                     WDARRMADDALSQPESRAAFRRLIHAGWTDAIRAIHPRGPVYTFWDYTMNAWARDAGF
                     RIDHLLLSPAAADRLADAGVDRDTRGKEKASDHAPVWAVLR"
     gene            complement(404567..404758)
                     /locus_tag="HL653_01880"
     CDS             complement(404567..404758)
                     /locus_tag="HL653_01880"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017977727.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU60396.1"
                     /translation="MVHSWTFVFLICGIFAIARGIADLRRRSFVWGGLGLFAGLLLLL
                     TPVPTDTVKFDLPLQNAQH"
     gene            complement(404769..405101)
                     /gene="erpA"
                     /locus_tag="HL653_01885"
     CDS             complement(404769..405101)
                     /gene="erpA"
                     /locus_tag="HL653_01885"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015457979.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron-sulfur cluster insertion protein ErpA"
                     /protein_id="QJU56699.1"
                     /translation="MSETAIDLTSSAAERVATIATKQGKPAILRLSVEGGGCAGFQYK
                     FGLADTVESEDEVAERDGVRLVVDPVSLDLVRGSAVDFVKSLGGASFQVTNPNAASGC
                     GCGTSFSV"
     gene            complement(405177..405890)
                     /locus_tag="HL653_01890"
     CDS             complement(405177..405890)
                     /locus_tag="HL653_01890"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016746782.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="M23 family metallopeptidase"
                     /protein_id="QJU56700.1"
                     /translation="MTARLKTGFRSFSTLLVAFGLMTAAAPAFADTAAPQVGDKIGDV
                     TDEAALDSIDDAAAVSGGDDAFHAMFMGWKKQDAIGQGVIAVPSAKPINAATFTSGYG
                     VRSDPFRHAAAMHAGIDLAAPQGTAVYATADGIVDKAEWSNGYGNLVEVAHGKGVQTR
                     FGHLSRILVHSGQLVHRGDLIALVGSTGRSTGPHLHYEVRIDGHAVNPVPFLQAGDYV
                     VAMQQRSSDIATGGPDDVD"
     gene            complement(405989..406846)
                     /locus_tag="HL653_01895"
     CDS             complement(405989..406846)
                     /locus_tag="HL653_01895"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011542468.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferritin-like domain-containing protein"
                     /protein_id="QJU56701.1"
                     /translation="MPGTCHSREAPSPCRGGSLGSACRSVLMTGDPYAKVMAARAVAR
                     EWRLGRLAHEFDVAMPDRPARGERPELLPPARMPKRRKGGSIAHRIALLHAIAHIEYV
                     AIDLAVDLVGRFGGQFPRAFADDWMKVAAEEAMHFALIQRRLRQLGAAYGDLPAHDGL
                     WEAAEATAHDAAARLAVVPLVLEARGLDVTPQMIVRLDAAGDGISSRILARIYSDEIN
                     HVATGMKWFESSARDSGVTPAEQWRALVGRYFGGALKPPFNDSARASAGLTPEFYASL
                     AVPEPSAQT"
     gene            complement(406897..407361)
                     /locus_tag="HL653_01900"
     CDS             complement(406897..407361)
                     /locus_tag="HL653_01900"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013079278.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peroxiredoxin"
                     /protein_id="QJU56702.1"
                     /translation="MLNEGDQAPNVTLQAADGSAQPLAALRGDKALVLYFYPKDDTSG
                     CTREAIDFSAQLAAFEAAGAGVLGVSKNSPKDHAKFTAKHALTVPLATDPDGSVCEAF
                     GAWIEKSLYGRKYMGIDRATFLIAADGTIAKIWRKVKVPGHVDAVLAAVKAL"
     gene            complement(407419..410091)
                     /locus_tag="HL653_01905"
     CDS             complement(407419..410091)
                     /locus_tag="HL653_01905"
                     /EC_number="2.7.7.89"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019831641.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional [glutamine synthetase]
                     adenylyltransferase/[glutamine
                     synthetase]-adenylyl-L-tyrosine phosphorylase"
                     /protein_id="QJU60397.1"
                     /translation="MADFGGGIERAEAHAPFLRRLIARRRDVVDRLAGDGLSATLAAA
                     RAESDAESDTALALRRERQAVALSVALADLAGASFETVTRALSDFADHALDRAIHSII
                     EERGGEGAIGFGALALGKQGSRELNYSSDIDPILLFDPATLWCRPREEPGEAAQRIAR
                     RIVELLQQQTGDGYVLRVDLRLRPAAEATPLAVPIGLAISHYETSALPWERAAFIRAR
                     AAAGDVALGAGMLTHLRPFVWRRALDFGAIGELRDLSRRIRDHHGKVRVPAPGYDVKR
                     GRGGIREIEFFAQIHQLIHGGREPALRVPATLDALAALAEAGRIDPEEARTLGDTYRL
                     LRTIEHRLQMVEDQQTHRLPEDPAALDNVARLSGYADGGDLIAALAPAAEVVGRIYDG
                     LEPDEAPPLPETRSDLEQALAERGFPDPAHAAKRIETWRKGQARTTRSAAARAALEKV
                     LPTLIAAFAEAADPHTALLRFDDLVARLPSALNLFRLLEAQPNLLGLLVRVLSLAPAL
                     AADLARRASLLDGLIDASALEAQPATDALAAQFAKGEAREDYQGLLDRVRAEVSERRF
                     ALGVQAVAGALDPLAVGAGYARVAEAALRVLAAATVAEFERTHGRIAGGELVILALGR
                     FGGGTLTHASDLDLVYLFTGDFLAESDGAKPLGATHYFNRLASRVSAAMSVPTASGPL
                     YEIDTRLRPSGTQGLLAVSLDSFQRYQAESAWTWEHMALERARPVFGSAQAQAALAAI
                     VEGALRRPHDPAKLAVDVVKMRGDIAAHKPAAGPFDVKAIDGGLIDAEFAVHFLQLRE
                     RIAITPDLARAAATLEGEGLLAAGFADALALLTRMLIVLRLVAPGGAAPAEPSHILVA
                     EACGYSRWEEFLPAYDAARALIGGEWRRLAALGE"
     gene            410172..410342
                     /locus_tag="HL653_01910"
     CDS             410172..410342
                     /locus_tag="HL653_01910"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56703.1"
                     /translation="MGLSVDFASSSEEGDRKPVTVPPPAVYQGVGAALRNSYSAPPIA
                     TEEFRRLLSKLK"
     gene            complement(410491..411117)
                     /locus_tag="HL653_01915"
     CDS             complement(410491..411117)
                     /locus_tag="HL653_01915"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010215711.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sigma-70 family RNA polymerase sigma factor"
                     /protein_id="QJU56704.1"
                     /translation="MTDAQEDVSPPVEHVALSDSEFKTELARVIPHLRAFGRSLSGNR
                     DLADDLVQETLLKAWAARKRFQAGTNMRAWTFIILRNLFLSQMRRARFKGEWDDLTAS
                     KILAAPASQDRHVDLGDLQRALLHLPQPQREALILVGAGGFAYEEAAEICGCAVGTIK
                     SRVARGRVALEQLMSGGDLPSRRLHSNKGDETALQAIMGEVDELSRGR"
     gene            complement(411225..411365)
                     /locus_tag="HL653_01920"
     CDS             complement(411225..411365)
                     /locus_tag="HL653_01920"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015457985.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56705.1"
                     /translation="MAEDKPVHLTRTEARSGSSNHVTRYVLPISLALVILLFAVILRI
                     WW"
     gene            complement(411449..412240)
                     /locus_tag="HL653_01925"
     CDS             complement(411449..412240)
                     /locus_tag="HL653_01925"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010162727.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator"
                     /protein_id="QJU56706.1"
                     /translation="MSLGQDLAPHLPFLRRYARALTGTQQHGDAYVRATLEAIVAAPG
                     DFPRDVDVRLGLYRTFQRIWGSVNEEGGEGEDGDPQAGIANARLAKITPLSRQALLLT
                     QLEGFTPEDAAYLMDASAAEVEEYVRDAVAEIERQTRADVLIIEDEPIIAMDLETIVR
                     DLGHNVTGVAVTRDEAVAQALAQRPGLVLADIQLADDSSGIDAVKDILAEFAVPVIFI
                     TAFPERLLTGERPEPTFLITKPFQRSTVKAAISQALFFDAATIPA"
     gene            412539..412712
                     /locus_tag="HL653_01930"
     CDS             412539..412712
                     /locus_tag="HL653_01930"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006967171.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU60398.1"
                     /translation="MEKKGRGGSGGGGDKSPRKKKPGAPESHVANALKTAYEDAVRED
                     VPDEFIDLLGKLS"
     gene            412760..414298
                     /locus_tag="HL653_01935"
     CDS             412760..414298
                     /locus_tag="HL653_01935"
                     /inference="COORDINATES: protein motif:HMM:NF019205.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
                     /protein_id="QJU56707.1"
                     /translation="MIARLSSGAKMLIIMTVALLPLGIIALFASIQSAHDKRLQHEAD
                     ARLIATAEARQIDLAVVRSANVVRAAAFAAAGGLPECRNALAQASRILGQDTRIAFFG
                     MDGGLRCASAGFRAARLPPPRGNIGIELLLLDPPGGIRFTVGASNGGYGVGETSQAQL
                     IRSLGIATGNQSVMLRQGSARLPLVTAHKAGPLDQRITVSAPFAGGQINLVASIYASA
                     VSAIEILLVLLPILMWAAAAIIGWSVVQGLLLRPLGQLQRSVVQLGTAPLTLPRLQTP
                     ALEITALADSFRDAAEQIATREIALEEGLNRQVRLTREVHHRVKNNLQVVASLIALHA
                     RGSTGDVAAAYASIQRRVDALAVVHRNHYAELEENRGVALRSLIGELTSNLRATAPAE
                     ASHFHIMLDMAAAHVSQDVAVPVAFLITEAVELLMTSAPADPVMISVRTTDKPDRALL
                     SIRAPGFVSEAATEGAARQRFDRIAGGLARQLRSALTQDEDGIRYTIEIGIVPDDESE
                     IPAS"
     gene            414589..414726
                     /locus_tag="HL653_01940"
     CDS             414589..414726
                     /locus_tag="HL653_01940"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002518960.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="entericidin A/B family lipoprotein"
                     /protein_id="QJU56708.1"
                     /translation="MVRKALALALVAGTLLVSACNTVEGAGKDVSSAGKAVSNAADDN
                     K"
     gene            complement(414849..415628)
                     /gene="tatC"
                     /locus_tag="HL653_01945"
     CDS             complement(414849..415628)
                     /gene="tatC"
                     /locus_tag="HL653_01945"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013933393.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="twin-arginine translocase subunit TatC"
                     /protein_id="QJU56709.1"
                     /translation="MSMPDELDDTRAPLLDHLIELRRRLLWCILSLGITFAICLYFAR
                     PIFAFLVHPLVRAGQGKIVYTQIFEAFFVEVKVAFFAAAMLSFPVIANQIWQFVAPGL
                     YKKERNAFLPFLIATPVLFLMGAALAYFVAVPMALHFLLGFQGNLGGIQQEALPSVGN
                     YLTFIMQFLFGFGLAFLVPVLLMLLEQAGLVSRQQLVSLRRYAIVGNTAVAAVLSPPD
                     IGSMIMLGVPLILLYELALIAMWFTERRRKKSDDSTALVES"
     gene            complement(415625..416050)
                     /gene="tatB"
                     /locus_tag="HL653_01950"
     CDS             complement(415625..416050)
                     /gene="tatB"
                     /locus_tag="HL653_01950"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003047786.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="twin-arginine translocase subunit TatB"
                     /protein_id="QJU56710.1"
                     /translation="MFDIAPSELMLVAIVALVVIGPKDLPRAMRVVGQWVGRARGVAR
                     HFRSGFDEMIRQAEMEEMEKKWAAENARIMAEHPASAPPPPEEHDDAHYAMMPLPELP
                     EPVYPQQGHDGHEGGETKPESDGAAKAPTESHQEPPARS"
     gene            complement(416120..417418)
                     /locus_tag="HL653_01955"
     CDS             complement(416120..417418)
                     /locus_tag="HL653_01955"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010543690.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HlyC/CorC family transporter"
                     /protein_id="QJU56711.1"
                     /translation="MAHPFPWFDLAIIIFLMILNGVFAMSELAIVSARKPRLEALARK
                     GRSGARVALVLASDPGKFLSTVQTGITLIGILAGAYSGASLGGPVGELIGTPLGLDAQ
                     TAAQWGFVLVIIGTTYLSLIVGELVPKQFALRQPEAIASIVARPMMWLSRVGAPFVWL
                     LDRSSAFIFRLLRLDREATNHVTAEELHLVVAEASTAGVIDDSERAFISSVVRLADRP
                     VREVMTPRTNVDWIDLDDDADTVREQLLTMQHSRMPVGRGTVDALVGVVQARDLLGAS
                     LADTKPAIETLVRTVPVVPDQMDAMDALTVLREADVPMAFVHDEYGHFDGLVTPVDLL
                     AAIAGAFASNNDEETDPPFFEREDGSWLLSGSASADVLADRLCIDLPDDRDYATVAGF
                     ALSVLRHLPTTGEVFSEEGWRFEIVDMDGRKIDKLLASRE"
     gene            complement(417704..417805)
                     /locus_tag="HL653_01960"
                     /pseudo
     CDS             complement(417704..417805)
                     /locus_tag="HL653_01960"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010543554.1"
                     /note="incomplete; partial on complete genome; missing
                     N-terminus; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="PEPxxWA-CTERM sorting domain-containing protein"
     gene            complement(418980..420047)
                     /locus_tag="HL653_01965"
     CDS             complement(418980..420047)
                     /locus_tag="HL653_01965"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="QJU56712.1"
                     /translation="MFALEEIYDAAFDRARFPTLLERLVHAMGAQAGFIGWSDLDRDA
                     GFQVQFGNDPKWLHAYVETYAPHDIMRPHLHAVPEGVCAPAWDLLQTPEIRESLFYRE
                     YIAPQGIVDNLAVNLIKRPGIVAHLALLRHAPAPRFSEEDCARLAEILPHLRRAIYIQ
                     SHLIRAADHAAGEQAVAGVANSALLLLTADRVLLDADAPLVPLLRLRIGEPIGDGLFG
                     TAVARAIEGGEPVAIEVSPAGEAEPVRLLLEARALETNRFGDLASGPGATCAVHVTRV
                     DRPRIIAFAAIGQLYGLTATELRVLRDAIEAGDITEVGDRLGMARATARTHLHRIYDK
                     TDTRGFAGLSSLAHRFGRIAT"
     gene            420207..420818
                     /locus_tag="HL653_01970"
     CDS             420207..420818
                     /locus_tag="HL653_01970"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007585936.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="trimeric intracellular cation channel family
                     protein"
                     /protein_id="QJU56713.1"
                     /translation="MTNRWLVTTVDLAGTFVLAIHGASVAAAAGLDLLGIVIIAIVSA
                     MGGGIIRDLLVGETPPEALRHWPLITVALAGALLTILFVQQVRTIPEGPLIAIDALGL
                     SLLAVAAAEKSLDYRLTPIAAIMMAAIGGCGGGAMRDVLLMQIPAILRADFLATAAIA
                     GAAVLVVSRRSGLRPVWAAWAGGTTCCLLRLVAVLQGWHLPHL"
     gene            complement(420848..423268)
                     /locus_tag="HL653_01975"
     CDS             complement(420848..423268)
                     /locus_tag="HL653_01975"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019515303.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ligase-associated DNA damage response DEXH box
                     helicase"
                     /protein_id="QJU56714.1"
                     /translation="MSVRSPAPLPPKIAGWFAKRGWAPRRAQMEMLDAARAGRHALLI
                     APTGSGKTMAGFLPSLVALAEEPAQGLHTLYVSPLKALAIDVQRNLLDPITEMGLPIT
                     VETRTGDTPSDRKARQRVKPPNMLLTTPESLSLLLSHADAGFLFESLQTIVVDEVHAF
                     AGGKRGDLLALCMARLQTLAPRMRRVALSATVADPDQYAAWLAPDGDIDAVAQVTGDP
                     GAAPDLAILLPEDRVPWSGHSGRYAAAQVMAEIETHRTTIIFCNTRSLAELIFQDLWA
                     VNEMKLPIGIHHGSLAIEARRKVEAAMADGRLRALVATASLDLGVDWGDVDLVIQMGA
                     PKGSSRLLQRIGRANHRLEDASEAVIVPGNRFEYLEARAALDAVEAGELDHEVFRAGA
                     LDVLAQHVMGCACAAPFAEETLLAEVRSALPYSALSAELFGQVLQFIATGGYALKAYD
                     RFKRLVKGEDGRWRVSHPQFVQQYRMNAGIIVEATMLNVRFKNGRALGKVEEGFAATL
                     SPGDTFFFAGLSLEVIGAEVEDVYVRATARPARIPTYGGARMPISTNLANRVRGYFAE
                     PGQWARFPDDVREWLEMQARRSRLPRPGELLVETFPREGRHYMVVYSFEGWNAHQSLG
                     MLITRRMETAGLKPIGFVASDYAIATYSLEPVTDPAPLFDKDILEHEFVDWVQQSSLL
                     KRAFREVAVIGGLVERQHPGKRKTGRQVSFSTDLIYDVLRKYEPDHLLLRAAWDDARA
                     RMTDVGRLADLLDRAAGTMLHVDLPKVSPLAVPVLVLIGRERVAQGSTEDALLIEAEA
                     LAAEAMAE"
     gene            complement(423385..423585)
                     /locus_tag="HL653_01980"
     CDS             complement(423385..423585)
                     /locus_tag="HL653_01980"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56715.1"
                     /translation="MDGMGLVAAIGGLLLALALLWAVIGNRRRTPEDRRRTEEATRAM
                     KLGIDREDRVADADPSLPSRRP"
     gene            423680..424678
                     /locus_tag="HL653_01985"
     CDS             423680..424678
                     /locus_tag="HL653_01985"
                     /EC_number="3.1.-.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010406585.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ligase-associated DNA damage response
                     exonuclease"
                     /protein_id="QJU60399.1"
                     /translation="MSRIGAWIEPHPQGLYLPSADAWIDPSTPQARALVTHGHADHAR
                     GGHASVLATAETIAIMDARYGPQNGQPVAYGESVRLGDIDVSFVSAGHVLGSAQIVLE
                     KGGERIVVSGDYKRRPDPTCPPFQPVPCDIFITEATFGLPVFRHPDTGSEVDRLLAAL
                     HANPDRCVLVGAYALGKAQRLIMELRGRGHDAPIYLHGAMQRLCDLYRDLGVPLGDLR
                     PATGIKAAEMKGHIVLSPPSALNDRWSRRLPDPITAMASGWMRVRQRAVQRNVELPLV
                     ISDHADWDELTDTITELAPSEVWVTHGREEALVHWCRTHQIKAKALDLVGFEDEDD"
     gene            complement(424814..425509)
                     /locus_tag="HL653_01990"
     CDS             complement(424814..425509)
                     /locus_tag="HL653_01990"
                     /inference="COORDINATES: protein motif:HMM:NF012409.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycoside hydrolase family 19 protein"
                     /protein_id="QJU56716.1"
                     /translation="MTRFDPSGRMDAAFCTSLFAFAADRPPDEVLRAIGAAGAAHLAA
                     YGMTTPARLAEFVAQTAHETGGYRRFEEDLHYSAEGLARTWPGRFALSTKAAVKRPNA
                     LAIRLAGRPEAIANSVYARAAEGNVQPGDGWRYRGRGMLQLTFRNNYRAAGKRLGLDL
                     EARPELAADPATSLLIALDFWRRAGVNVCCDAGDYVGARGLTNCGSRTPNVAPIGLED
                     VAKRRARLLAVLV"
     gene            425726..427630
                     /locus_tag="HL653_01995"
     CDS             425726..427630
                     /locus_tag="HL653_01995"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010219066.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S9 family peptidase"
                     /protein_id="QJU60400.1"
                     /translation="MPLEKAARIFGTRENLYSAALSPDGKKVVLVGSVGARTRLVYVV
                     DLADSQPHPILHSDDNLKLTHCGWAGNDRLVCGFRGLDIAYGQRLGFSRLLSLDPDGK
                     NIKDLTAHTVGEALRISQFTGGIIDWLDGSTPDVLMVRDHVPGFSTGQRGASTRDGYG
                     VDQVNTRSLSVRTIEGADKLADTFITDGQGHVRIMSVRGVANDGMLRGWWDYRYRLAG
                     EERWRPFSHVVLNAKESLRPLAVDGNANVAYALKSLNGRDALYRVRLDETLTSELVYG
                     DPVVDVDDIVTIGRHGRVIGVSYATDRRVVDYFDPDYKTLAAKLSKALPKLPLVSFES
                     ASADESVLLLRASSDTDGGHMFLYQKASRHLTELMPVRPELDGVATATVRSISYPAGD
                     GAMVPAYLTLPPDGADKNLPAIVMPHGGPAARDEWGFDWLAQFFAARGYAVIQPQFRG
                     STGFGDAWYVDNGFKSWKIAVRDVTAAGEWLVKQGIADPAKLAIVGWSYGGYAALQSN
                     VLDPGLFKAVVAIAPVTDLNKVKLEAAGFTNAGIVRAYVGDGPHITEGSPALHADRFR
                     APVLMFHGDQDINVGIGQSAGMDAALKRAGKVSNLVRYPGLDHQLDDSSARIDMLTKA
                     DTFLRDSMGM"
     gene            complement(428317..429699)
                     /locus_tag="HL653_02000"
     CDS             complement(428317..429699)
                     /locus_tag="HL653_02000"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010545852.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphomannomutase/phosphoglucomutase"
                     /protein_id="QJU56717.1"
                     /translation="MTHRFDPTSLREYDIRGIVGKTLGTADAYAIGRGFATHVRRAGG
                     TRVAVGWDGRVSSESLRDELVRGLTESGVDVVRTGLGPTPMLYFAEATLEVDGGIQIT
                     GSHNPADYNGFKMVLQHQPFFGQDIQSIGKMAEDGDWDEGEGEVSDADIEDLYVDRLF
                     AGYSGGEFRIGWDNGNGAGGRVLEKLVAKLPGEHHLLYTEIDGSFPNHHPDPTEEKNL
                     VDLKKLVAEKGLDFGIAFDGDADRIGAIDGEGRVIWGDQILSILAEPVLKAVPGGTII
                     ADVKASQALYDRVAELGGTPLMWKTGHSLIKVKMKETDSPLAGEMSGHIFFRHEWYGF
                     DDALYAAIRLLGAVRASGKTMTELKSAMPELVNTPEMRFQVDESRKFAVVDEVLDRLE
                     ADGAEVNRTDGARVNTADGWWLLRASNTQDVLVARAEAKDEAGLERLMHQIDEQLGLS
                     GIKRGPQASH"
     gene            complement(429751..430164)
                     /locus_tag="HL653_02005"
     CDS             complement(429751..430164)
                     /locus_tag="HL653_02005"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone DnaJ"
                     /protein_id="QJU56718.1"
                     /translation="MMGLALLLAAGIGWWGWKTGRLRAPRAGDVAALVAVLVAVRLFS
                     RGEAVTAVAAIGGACWWAWFRTRNMLRAPADRGMTPERARALLDVPRGASASEIRAAH
                     RRIIQRVHPDAGGSTQLAVEINAARDRLLATHVKR"
     gene            complement(430161..430955)
                     /locus_tag="HL653_02010"
     CDS             complement(430161..430955)
                     /locus_tag="HL653_02010"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012048993.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AAA family ATPase"
                     /protein_id="QJU56719.1"
                     /translation="MPAHRIVFANEKGGSGKSTTAVHVAIALASAGRKVAALDLDTRQ
                     RTLGRYLDNRSAMAKSIGQELATARHETYDPAKSGPIEERIEAMADGMDVIVIDTPGR
                     DDDYVRTAISMADTLVTPINDSFIDLDLIGQVHAETFKVTRPSFYAEIVWDARKARGK
                     RDGATVDWVVLRNRLQHLEARNMRRVASALAELSKRVGFRTIAGLSERVIYRELFPKG
                     LTLLDLGVIGSEAGMGHIAARQELRELIAGLQLPALETAEKVNEPA"
     gene            431142..431423
                     /locus_tag="HL653_02015"
     CDS             431142..431423
                     /locus_tag="HL653_02015"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017501948.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SEL1-like repeat protein"
                     /protein_id="QJU56720.1"
                     /translation="MSNLFGVQGTDSAHKTSSAEAAFELGMAYSSGSGGVPLDLVQAH
                     RWLNVAALCGYRPALAWRAEIAAEMEGKDIVEAQRLARSTIVQIERKAA"
     gene            complement(431560..432690)
                     /locus_tag="HL653_02020"
     CDS             complement(431560..432690)
                     /locus_tag="HL653_02020"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018250636.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase"
                     /protein_id="QJU56721.1"
                     /translation="MEDVVARMAGGIAAFSRSDWDACAGGENPFVSHAFLSALEDSGS
                     AVTRTGWQPVPIAIDDAEGRPAAILPAYAKSHSRGEYVFDHGWAEAWERAGGNYYPKL
                     QIAVPFSPVPGPRLLLRDPALAPALIVAAESVVVQNDLSSAHATFIAPEQVPLFEAAG
                     WLIRTDTQYHWANRGYAGFDDFLGALSSRKRKNIRKERETAREGLQFLHLTGAEIEER
                     HWDAFWHFYQDTGARKWGTPYLTRSFFSLLGERMGDKVVLMLALRDGHPIAGALNLVG
                     GETLYGRYWGCTEEVPCLHFELCYYQAIDVAIARGLKTVEAGAQGEHKLARGYEPTLT
                     YSAHYIPNEGFRRAVEAYLAQEREIVEHNAEALAEEGPYRKG"
     gene            complement(432695..433153)
                     /locus_tag="HL653_02025"
     CDS             complement(432695..433153)
                     /locus_tag="HL653_02025"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015459124.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RidA family protein"
                     /protein_id="QJU56722.1"
                     /translation="MSIDDRLAELGHDLPVAAAPVAAYVPTVLAGGLLHVSGQLPFLD
                     GQLMTGRCGEDRDEVYAQKAAERCGLMLLAQVKAALGSLDTVERVVKLGVFVNSAGGF
                     TAQPKVANGASELMVAVFGDAGKHARSAVGVPVLPLGAVVEIDAIFAVKA"
     gene            complement(433180..433809)
                     /locus_tag="HL653_02030"
     CDS             complement(433180..433809)
                     /locus_tag="HL653_02030"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015459128.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HAD family hydrolase"
                     /protein_id="QJU56723.1"
                     /translation="MSRPLLITDCDEVLLHMVRHMSAWLDEAHAIDFRPTGGFFSKAA
                     RRRSDGSIVSDDELWAFLDGFFATEMPRQTLVPHAREALERIAEVADVVVLTNLGEES
                     LTGRIDQLARFGIEHRVICNGMASKGEPVARLIAEYSPSVAVFVDDLAGHHASVARAA
                     PDVFRLHMIAEPEIAVECGPAPDAHARIDDWAEAVDWVLARFAGHPVAA"
     gene            complement(433806..434108)
                     /locus_tag="HL653_02035"
     CDS             complement(433806..434108)
                     /locus_tag="HL653_02035"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019834016.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3572 domain-containing protein"
                     /protein_id="QJU56724.1"
                     /translation="MPDETITTAKRSIVSHEGEDAPTVALQALSWILDDGGRASRFLA
                     LTGLEPDDLRARISDPALHAAVVAYLAGHEADLIACARDLAIAPEAIQAAARELNA"
     gene            434125..434553
                     /locus_tag="HL653_02040"
     CDS             434125..434553
                     /locus_tag="HL653_02040"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012640499.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator"
                     /protein_id="QJU56725.1"
                     /translation="MAKKVLVVEDNELNLKLFCDLLQAHHFETDPVPDGRAAIERARL
                     FGPDLIVMDIQLPHVSGIELIETLKRDVALSSIPVMAVTAYAAKGDEERIRAAGAEAY
                     ISKPVTVNSFMSAVRKLIDPDALPDPRLAQSAARGLSAPF"
     gene            complement(434690..434926)
                     /locus_tag="HL653_02045"
     CDS             complement(434690..434926)
                     /locus_tag="HL653_02045"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010545163.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56726.1"
                     /translation="MFERLFLAHPRSVGESYGEHMRVAGRVGFLLIGGGIAALIHAVF
                     PRFHQTTGSRLIRRLAAELDGRAPAPAKTDAPTQ"
     gene            complement(435130..435549)
                     /locus_tag="HL653_02050"
     CDS             complement(435130..435549)
                     /locus_tag="HL653_02050"
                     /EC_number="2.5.1.78"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017501105.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="6,7-dimethyl-8-ribityllumazine synthase"
                     /protein_id="QJU56727.1"
                     /translation="MARFLIVEARFYTHLNDMLIEGARAALEEAGHSHELVTVPGALE
                     VPAAIAMAAETGRYDGFVALGVIIRGETYHFEVVANESARGLMALTLDGLPIGNGILT
                     VENEAQALARARRTEKDKGGEAAKAAIAMLGLKEKFS"
     gene            complement(435549..436670)
                     /gene="ribB"
                     /locus_tag="HL653_02055"
     CDS             complement(435549..436670)
                     /gene="ribB"
                     /locus_tag="HL653_02055"
                     /EC_number="4.1.99.12"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015458939.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3,4-dihydroxy-2-butanone-4-phosphate synthase"
                     /protein_id="QJU56728.1"
                     /translation="MPASAEITRLRHAFLSSPEEIIDEARNGRMYILVDDEDRENEGD
                     LIIPAQMATPDAINFMATHGRGLICLAMAKERVDQLGLPLMSRNNGTRHETAFTTSIE
                     ARHGVTTGISAGDRARTIAVAIDAGKGPDEIVTPGHVFPLVARPGGVLVRAGHTEAAV
                     DVSRLAGLNPSGVICEVMKDDGTMARLDDLVAFAQRHALKIGTIRDLIAYRRRYDHLV
                     EKIEEAPFTSDYGGDWKLLTYRDKTDGTHHMVMQKGRVVEGKPTLARVHAISLLDDML
                     GRQGPRKRMLQRAMAEIGREGAGVIVLLVSKAPVQAAPQAEGGEDMDLRSYGIGAQIL
                     ADLGVHEIELLSNAHRHIVAIEGYGINVVGERPIPETLG"
     gene            complement(436654..437268)
                     /locus_tag="HL653_02060"
     CDS             complement(436654..437268)
                     /locus_tag="HL653_02060"
                     /EC_number="2.5.1.9"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010124195.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="riboflavin synthase"
                     /protein_id="QJU56729.1"
                     /translation="MFTGIITDIGTVEAIEQKGDLRVRIGTRYDTQSIDMGASISCSG
                     ACLTVVDKGPGWFAVDVSQETVARTASAVWAEGQRINLERALRVGDELGGHIVTGHVD
                     GVGRIVSAHPVGGSIALTVWVPDDLAGYLAAKGSVALDGISLTVNTVEDGPEGTVIGL
                     NIIPHTAEMTTFATLEPGRPLNIEIDVLARYLGRMEELNHARKR"
     gene            complement(437327..438328)
                     /gene="ribD"
                     /locus_tag="HL653_02065"
     CDS             complement(437327..438328)
                     /gene="ribD"
                     /locus_tag="HL653_02065"
                     /EC_number="1.1.1.193"
                     /EC_number="3.5.4.26"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020818717.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional
                     diaminohydroxyphosphoribosylaminopyrimidine
                     deaminase/5-amino-6-(5-phosphoribosylamino)uracil
                     reductase RibD"
                     /protein_id="QJU56730.1"
                     /translation="MAAALALSERGRGLTAPNPNVGCVIVRDGRVVGRGWTQPGGRPH
                     AEAMALGEAGALAEGATVYATLEPCAHRSPRGPACADSLAAARPARVVAAIGDPDPRT
                     AGEGFARLRAAGIVVESGLLAAEARRAMAGFLMRQAQGRPLVTLKLATSLDGRIALAD
                     GSSRWITGDAARAHVHLERARHEAILVGRGTWEADAPRLDVRLPGLEGRGPRRILLSA
                     RQSRGGGNSDETGGLGSRVRGNDEEVLGGVQEIAALSGVDHLFVEGGAVTAASFLRAD
                     LVDRLLLYRAPILIGDGKPALGDIGLTDLAAAHGRWRLDDARMLGSDRFEAYLRQRN"
     gene            complement(438346..438711)
                     /locus_tag="HL653_02070"
     CDS             complement(438346..438711)
                     /locus_tag="HL653_02070"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56731.1"
                     /translation="MALASSTPYLPRMAYFPRPAKPKALLADLKGMLAANRRHKLVFG
                     AMAIGMTSLIITGFILEARNGVMPGASTIYAADWSENRTDAEIVKQQKIDQKEVNAAK
                     AERRRQFQKVDDAMTRWGF"
     gene            complement(438841..440178)
                     /locus_tag="HL653_02075"
     CDS             complement(438841..440178)
                     /locus_tag="HL653_02075"
                     /EC_number="6.1.1.17"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019369064.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate--tRNA ligase"
                     /protein_id="QJU56732.1"
                     /translation="MTVVTRFAPSPTGRIHVGNIRVALHNWLWARKHGGRFLLRLDDT
                     DRARSTEENAESIRADLRWLGLVPDAETRQSDRFALYEARFEELRAAGRVYPAYETGQ
                     ELDLKRKILAGRGLPPIYDRAALALSEADRASLEAEGRRPHWRFKLDHDAPIHWDDLV
                     RGEQKIDPKLQSDPVIRREDGSWLYMLPSVIDDIDMGVTHVVRGEDHVTNTGLQLQMF
                     AALGAEAPAFAHEALLTGSGGKLSKRLGALGADALRESGIEPLALAALLAKLGTSDPV
                     EPVAEVAPLIEGVDFARFGRAPARFDLDELAAVNARTIHLMPYAAVADRLPEGIGAEA
                     WATIAPNLSTVAEAAEWLPVLSGEIAVPAIGDEDRAYLAEAAAVARTLAWDEGVWPAL
                     TGALKASSGRKGKALFLPLRQALTGMDHGPDMAALLPLIGQDLAVARLERAGA"
     gene            complement(440192..441322)
                     /locus_tag="HL653_02080"
     CDS             complement(440192..441322)
                     /locus_tag="HL653_02080"
                     /inference="COORDINATES: protein motif:HMM:NF013884.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyltransferase"
                     /protein_id="QJU56733.1"
                     /translation="MHKGQERIGYLDGLRGVAILLTAAWHFLGPIYQMHLPYGRAFEW
                     WPGVRYGWAGVNLFFLISGYVIFITLERCTGFVDFILRRWLRLFPAMLVASLILYAAR
                     IPMGDAMPGGYAQPGDLLPGLMLINPVYIRTMGVMAHSLDGAFWSLYVEAAFYIVIGL
                     AFFRIGWARSVALLLVLYALSLIVPVLVHRYHLHWALRPTFFLYHAGFQNFGWFASGA
                     LFLKARQNSDRGLFWMALAIGLCSATTTVLPGGMERSSRAALFAGILFFAAVQQWRWL
                     QDLLAAKGLLWLGFVSYPFYLLHSAIGVGLIAEIAPLMSGVPVILVPLLVLGLMIGLA
                     WIIAARIEPPLVRLLRPVTDAIRRLLGVGASSQTARVSGEPA"
     gene            complement(441394..441957)
                     /locus_tag="HL653_02085"
     CDS             complement(441394..441957)
                     /locus_tag="HL653_02085"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018245551.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR/AcrR family transcriptional regulator"
                     /protein_id="QJU56734.1"
                     /translation="MATTDTKQLILDTAQPMVQAHGYNALSFRDVAAAVGIKSASIHY
                     HFPTKGDLGAALARRYTEAGRAGLARMRESSADVPGLVAGFIGVFRAALANGNRMCLI
                     GIMSAEHDDLPDAVKAEVATFSDVCVAWLRDVLAIDGAADGKTASDRAFAIFGAIQGA
                     QLVARGRRDIALFDRMIETYRATGLIP"
     gene            442068..442754
                     /locus_tag="HL653_02090"
     CDS             442068..442754
                     /locus_tag="HL653_02090"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018493514.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase"
                     /protein_id="QJU56735.1"
                     /translation="MKIYDRAGFPNPSRIRIVVAEKGLEDRVDYVSVDLIGAEHKQAP
                     FLAINPSGKIPVLELEDGTQISESTAITEYLDNLDGTPTLTGTTPREKAMIHMMQKRA
                     EVELMDGVDGYFHYATPGLGDAMIPYTSPDWAGRKEWGERQRDKAVRAMHQFDGMLQT
                     RPYLAGDRFSMADITAFAALNFAGAAGIAIPADCNALTEWRERVSALPSVRNRSGQSF
                     LPEDLRRFGF"
     gene            complement(442867..443382)
                     /locus_tag="HL653_02095"
     CDS             complement(442867..443382)
                     /locus_tag="HL653_02095"
                     /inference="COORDINATES: protein motif:HMM:NF021576.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2306 domain-containing protein"
                     /protein_id="QJU56736.1"
                     /translation="MTSLAATAPIPLPAIPHPLRWLIALTAGIVSALILAALVRHVAT
                     GSPTLSARSIWLPIHLGAAIPIVPLGAWVLVRRKGDRLHRLLGRIWAALMMVVALSSF
                     GLVGMLGHLGPIHILSLAVTVGIPRAVWLARAGQIRAHLRGMVIIYGSAVAAALFAFV
                     PGRVLGAWLFG"
     gene            443516..444319
                     /locus_tag="HL653_02100"
     CDS             443516..444319
                     /locus_tag="HL653_02100"
                     /inference="COORDINATES: protein motif:HMM:NF016296.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LytTR family transcriptional regulator"
                     /protein_id="QJU56737.1"
                     /translation="MARLKDISAELLVMAGLGLILGLLGPFGTFAMPVAARVGIWLAM
                     AIGGYACFRPVIGAGRSLSEQAHLPLTLAMALACIVASVPVTVMTGALFGEGLDPAAL
                     AHSYPYVLLVGGLTTAIQVLLFSRRQPPAAPALATAAIDANAPQPPSDSVPVAAPTPP
                     APQPPATFLDRLPPHLGRDLMCLEMEDHYVRAHTARGSTLILMRMRDAVAEVAGIEGE
                     RVHRSWWVARTAVAATERRDRAILLRLSNGLDVPVARDSVALLRSKGWL"
     gene            444446..445381
                     /locus_tag="HL653_02105"
     CDS             444446..445381
                     /locus_tag="HL653_02105"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011444630.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribose-phosphate pyrophosphokinase"
                     /protein_id="QJU56738.1"
                     /translation="MKLLTGNANRPLAKAIADYLDMPLTDASVRRFADEEVFVEIHEN
                     VRGEDVFVLQSTGYPANDNLMELLICIDALRRASARRITAVVPYFGYARQDRKPGPRT
                     PISAKLVANLITAAGANRVLSVDLHAGQIQGFFDIPTDNLYAAPVMSEDIKARFGDKN
                     LMVVSPDVGGVVRARALAKRLNNAPLAIVDKRRERAGESEVMNIIGDVTGRFCILIDD
                     IVDSAGTLCNAAAALRDAGAEDVVAYVTHGVLSGGAVARVEGSALRELVITDSIAPNV
                     AVAGAQKIRVNTIAPLLAEAVRRIADESSVSSLFD"
     gene            complement(445393..446013)
                     /locus_tag="HL653_02110"
     CDS             complement(445393..446013)
                     /locus_tag="HL653_02110"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56739.1"
                     /translation="MRGGSGGRAIMSLGNIESRVTVGINDEGANMIGFTAALWIALQA
                     AGAVPAPEAEMLEAPLPSGFKIGFADKQSGQTIEERVPVRETVEAWSRMITVQRFSGL
                     ARIGPHAMLEKLGSLMIQACPGAIADPIEDASDGGHVTAAFRVTCPLNPATGKPETML
                     ARAFAGDADIHLVQYAYRAIPSPKEASAATAYLGSVRLKSGSSSGK"
     gene            446144..447907
                     /locus_tag="HL653_02115"
     CDS             446144..447907
                     /locus_tag="HL653_02115"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019014315.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU60401.1"
                     /translation="MAVLLLIAAIGIVTAYGQQRDAQASVGPTFAASLRFPGGNDVVT
                     RVAPFSDEARARGLLPGDRLIAIDGRAIPYFDLDAIQSLLAGPDGSTYRLTVQTGEAS
                     PRTITLTRNSHYIDQAYAGSGLTFAIRSWTVFGFRMLDAVLALATALLLFIRRPTDPV
                     AAMLALCAVPLENGLLFLWPDAGLALTGFSSVRHMLFLTTILIYPNGRFVPRWTIWLT
                     PLIPVIELVSFQSTTVEAAIGLRQLLLFAFLIAAAGAFYLRYRSTPPGAERQQIKLIM
                     LGTVGWVLFGLVSLVLERISAASATVAMSAWFSLASHLAGSFAAIALEAGILLSLLRL
                     RLYDADSLISRSAAYTFLTLLLGPTFAATDKVVQVLSAQSFGENARAMSAGFGAAIAA
                     TLIAPLNKRVRRWTELRFQGEIVALRDDLPKHVGDLREFATLDVLLAGVLDRIRQGIR
                     TRHVAILLRGENGGFHPLTSPGLTGETVLTWAQDWQPEPGNRLEGDRDDPLFPVRIRL
                     GDEEPGMIGWILLGPRPDGSFFGKDERKALAEIAAPIALAIRIVRERDARMAGHIARN
                     RELEERIATLESRLGAFRDSA"
     gene            448070..448837
                     /gene="hisN"
                     /locus_tag="HL653_02120"
     CDS             448070..448837
                     /gene="hisN"
                     /locus_tag="HL653_02120"
                     /EC_number="3.1.3.15"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010123035.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidinol-phosphatase"
                     /protein_id="QJU56740.1"
                     /translation="MTDDDIQLIGRLADAAGAAIRPFFRARFTIETKADASPVTQADR
                     AAETAIRAILEQERPQDGIIGEEYGVTREEAPRQWVIDPIDGTRAFLAGRPLFGTLIA
                     LLEEDRPVLGVIDQPISGERWLGAKGRPTLFNGAPVKTRACATLAAGHMATTGPYLFA
                     PEDQPAFDRLRGEMRDTIWGGDCYNYALVASGHVDLVVESWLKLYDFAALVPVVEGAG
                     GRMTDWQGQPLDRHSDGRVIAAGDPALIEQAVTVLAS"
     gene            complement(448943..451081)
                     /locus_tag="HL653_02125"
     CDS             complement(448943..451081)
                     /locus_tag="HL653_02125"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010409007.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AsmA family protein"
                     /protein_id="QJU56741.1"
                     /translation="MVDLSHPPSARDSSPADAPPPPAPAPVRDPARTAIASVVSVVAT
                     IFGLIFLAWLVLFVTKGRFLKHTFERVASRYMERDIRVAGDFNFYFDPIDVKFLAEGM
                     TVSNPDWAKKPNLFASKLIDTRIETLPLIFGKKQIEWLNLVDGTVDLEWDKAHKRNSW
                     TFAGDTPFQMPLIRRAAVTGTDIHYDDAAMQIFADVHFDPINAKDSRFANNILFTGKG
                     TARGNPFTLNGSQTSPNALMAGGRNQFELHVRAARTSVDVSGTLPAATQIEGADLAVQ
                     VRGRNLRNLFDLAGIAVPDTRAYRLRSHLTKRGQDYEFTRIAGSYGNSDIGGAMTVTV
                     PRTGTEDRLFLKADLASRLVDMIDIGPFIGYNPDKLATQGATAAATTQHARGAYPRIL
                     PDAPLRVDAIKAFDAKVTYKVADIRQPFVPISNILLGLDLDHSLMKLSPLNFDMAGGH
                     VDSDISINARQPAIVTDYDIRMSPTPMGKLLARFGVNDSGTTGTIKARVKMTGTGNTV
                     RDSLATSNGRIAVILPRGTFWTSYTQLSEFDIGTFVQKMFEKKLKEPVQINCGLIGFT
                     VRDGIAAADPILIDTSKNVMTAKGGFSFKDELLSFAFRADAKKFSVFSGQSPVGIGGH
                     FAAPSFQIVTPELLLRGGVGVALGVLTPPAALLAFVDPGDAKAAACGPVLAGANAAAQ
                     RTLKGEPRKDIGKGKSADVKAEKDKKPIKL"
     gene            451236..451439
                     /gene="rpmI"
                     /locus_tag="HL653_02130"
     CDS             451236..451439
                     /gene="rpmI"
                     /locus_tag="HL653_02130"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007689506.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L35"
                     /protein_id="QJU56742.1"
                     /translation="MPKLKTKSGVKKRFKLTATGLLKHGVAGKRHRLMSHNAKYIRQN
                     RGTSVLSDADTATVKRWAPYGLK"
     gene            451453..451830
                     /gene="rplT"
                     /locus_tag="HL653_02135"
     CDS             451453..451830
                     /gene="rplT"
                     /locus_tag="HL653_02135"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019834127.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L20"
                     /protein_id="QJU56743.1"
                     /translation="MARVKRGVTTHAKHKRILEDAKGYYGRRKNTIRIARQAVEKAGQ
                     YAYRDRKVNKRNFRALWIQRINAAVRTEGLTYGVFMHGLKLAGIDLDRKVLADLAMNE
                     AATFSAIVAQAKAALPEDARVAA"
     gene            451940..452359
                     /locus_tag="HL653_02140"
     CDS             451940..452359
                     /locus_tag="HL653_02140"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017502635.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GIY-YIG nuclease family protein"
                     /protein_id="QJU56744.1"
                     /translation="MERAPVVYILASARAGTLYIGVTSNLLQRLHQHREGLIPGFTSR
                     YGVARLVWFEMHGDMASAIGREKQLKKWNRAWKLSLIEERNPHWEDLAVTMLGLDPLD
                     TSSPSFPRKRESTDMRLQQDGLPSMDPRFRGDDEDLL"
     gene            452356..453450
                     /gene="pheS"
                     /locus_tag="HL653_02145"
     CDS             452356..453450
                     /gene="pheS"
                     /locus_tag="HL653_02145"
                     /EC_number="6.1.1.20"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004208920.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phenylalanine--tRNA ligase subunit alpha"
                     /protein_id="QJU56745.1"
                     /translation="MSDVQTLSASLVDEVRSAADADTLEAIRVRALGKSGTITALLKT
                     LGAMSPEERQEKGPAIQGLRAAVADAIAERKAALDQAALDARLASERLDMSLPVGAGA
                     QGSVHPVSQVMDELAEIFADLGFAVATGPEIEDDWHNFTALNIPETHPARAMHDTFYF
                     PDVDAEGRRMLLRTHTSPVQIRTMKDAEPPIRIIAPGRVYRSDSDATHTPMFHQIEGL
                     VIDRGIHLGHLRWTLETFLKAFFERDDIVLRLRPSYFPFTEPSVEVDVGYSIEKGRRV
                     IGGDPTGPNGGWMEVLGSGMVHPKVIAAAGLDPAEWQGFAFGTGVDRLAMLKYGMDDL
                     RAFFDGDLRWLRHYGFRALDVPTLSGGVGA"
     gene            453447..455819
                     /locus_tag="HL653_02150"
     CDS             453447..455819
                     /locus_tag="HL653_02150"
                     /EC_number="6.1.1.20"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012048643.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phenylalanine--tRNA ligase subunit beta"
                     /protein_id="QJU56746.1"
                     /translation="MKFTLSWLKEHLDTEADVSAIADALTRIGLEVESVEDPAIRLRG
                     FTIARVLTAAAHPQADKLQVLTVDAGDGKPPLQVVCGAPNARAGLVGIFGQPGAVVPA
                     NGMELRVAAIRGVESNGMMCSLRELELGESHDGIVELPNDAPVGTLYADYAGLADPVI
                     DIAVTPNRQDCMGVRGIARDLAAAGLGRLKPLDVPTIRSDVALPVTIATQDPEGCPAF
                     FGRAVLGVTNGASPDWMQRRLIAVGQRPISALVDITNYVMLDHGRPLHVYDLAKLSGG
                     LVARKAKAGETVLALNGKSYDLDETMTVIADDAHVHDIGGIMGGEESGVSETTTDVLI
                     ECAYFTPETIARTGGKLGLTSDARARFERGVDPAFLGDGLALATRLVTEICGGKPTEA
                     MEAGEPPLGRHTFKYEPAATLRLAGIEVAPDRQRAILQSLGFGVDGSWTVSAPSWRRD
                     VDGVADIVEEIVRIEGLDNVPSVALPRSEGVAKPTATAEQKLERGMRRAAAARGLDEA
                     ITWSFLSEADAAAFGGSAWTLANPISADMKAMRPSLLPGLIAAARRNRARGAASIRLF
                     EIGRRYLKEGERATLGLLLVGDRAARDWRTGKPGGFDALDAKAEVVALLAAAGAPADR
                     LQVMEVTGTIWHPGRSASLRLGPKTILAELGELHPSLLKTLDLDAPAVAAEIYLDAIP
                     ARRESGRMRTAYAPPPLQAVTRDFAFLAPRTMAADSLLRAIRGADKTAIVDVALFDLF
                     EGAGLAEGETSLAVSVTLQPGEKSFTDAELQAISAKIVAAAEKAGAKLRG"
     gene            complement(455981..456568)
                     /gene="metW"
                     /locus_tag="HL653_02155"
     CDS             complement(455981..456568)
                     /gene="metW"
                     /locus_tag="HL653_02155"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007711841.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine biosynthesis protein MetW"
                     /protein_id="QJU56747.1"
                     /translation="MSLRPDLQIIANNVDRGARVLDIGCGDGELMASLRDLCGVDARG
                     LELDPANVSLAVGRGLSVVQGDVETDLAYYPDNAFDYAILSQTLQTARSPDRVLSELL
                     RIGSRAFVSFPNFGFWRVRASFLFGGRMPVTPALPVSWYETENIHQLTIDDFRAFIAE
                     RRVTVEGEWFLSGARAVKGGAANLRAEHAVFLLRK"
     gene            complement(456565..457002)
                     /locus_tag="HL653_02160"
     CDS             complement(456565..457002)
                     /locus_tag="HL653_02160"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010161515.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="QJU56748.1"
                     /translation="MTFTLSDDKMLLDVARIHDWLANSYWSPGIARELVEKAIAGSHC
                     VGAYDAAGAQIGFARMITDHATFAWLADVFVDESTRGQGVGRAMVGWFLDRPDYAAMR
                     RVGLVTADAHGVYQALGFHAVLRPDRYMERLSPEAAALLKAAS"
     gene            complement(456999..458114)
                     /locus_tag="HL653_02165"
     CDS             complement(456999..458114)
                     /locus_tag="HL653_02165"
                     /EC_number="2.3.1.31"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010161516.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="homoserine O-acetyltransferase"
                     /protein_id="QJU60402.1"
                     /translation="MDDQRFGLSRLVTLSGPLLLDGGASLTSIDIAYETYGTLNADGS
                     NAILICHALTGDQHVASVHPRTGKPGWWSRMVGDGKPIDPARHFIICSNVLGSCMGSS
                     GPAAIDPATGAPYAMRFPVITLRDMVRAQALLLDHLGIWSLAAVVGGSMGGMQVLEWA
                     ATYPARVRSAVVIASAARHSAQNIAFHEVGRQAVMADPNWRGGNYYGTGEGPSAGLAV
                     ARMAAHITYLSEAGLTGKFGRRLQARDAKTFGFDADFQVESYLRHQGLAFVDRFDANS
                     YLYITRAMDYFDLAEEHGGRLADAFKGSKARFCLVSFDTDWLYPTAESRAIVHALNAT
                     GAAASFVELSAPYGHDSFLLDVPELYRVVDGFLRANA"
     gene            458304..459410
                     /locus_tag="HL653_02170"
     CDS             458304..459410
                     /locus_tag="HL653_02170"
                     /EC_number="2.6.1.9"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015458812.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidinol-phosphate transaminase"
                     /protein_id="QJU56749.1"
                     /translation="MNAPVAKPWIAEIAPYVPGRSTSDDGRKMTKLSSNENPLGTSPA
                     ARAAFAEAAQNLQVYPDGAAIALREAIGRHYGLEPDRIIHGTGSDEVLHLATGAFAGL
                     GDEVLYVRYGFSVYPIAARRVGAVPVEAPDKDYATDVDALLAAVTEKTRVVFVANPNN
                     PTGTYTSRAELARLHAGLPKDCLLVIDQAYTEYLDAEDEDGGLELARTQSNVIVTRTF
                     SKIFGLAAGRIGWGYGPMPVIDAMQRIRAPFNVATGGLDAAIAALGDMDFVATSKAHN
                     DQWRGWFAQEIASLGNAGLRAVPSKANFILVLFEGPLSAETAYKGLMARGLATRWLPG
                     QGLPHALRITIGEEEAMRGVMAGLREMVAEAKAA"
     gene            459410..460318
                     /locus_tag="HL653_02175"
     CDS             459410..460318
                     /locus_tag="HL653_02175"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010545847.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prephenate/arogenate dehydrogenase family
                     protein"
                     /protein_id="QJU56750.1"
                     /translation="MLPFARVTILGLGLIGSSIARGIRATMPTVRVTGYDADPAVRAR
                     AREIDLCDDIADTAGTAAIDADLVMLCVPVGAMGAAAQAIAADVPADAIISDVGGAKV
                     SVGTAIREALPNNVVVPGHPVAGTEHCGPDSGFATLFKGRWCILTPEGDTDPTAVMRV
                     SALWEKLGAQVEIMDARHHDLVLAVTSHVPHLIAYSIVGTASDLEEVTQSEVIKYSAG
                     GFRDFTRIAASDPTMWRDVFLNNREAVLEILQRLTEDVTMLQRAIRWGDGDALFDLFT
                     RTRAIRRSIIEQGQDDARPDFGRSHE"
     gene            460468..461760
                     /locus_tag="HL653_02180"
     CDS             460468..461760
                     /locus_tag="HL653_02180"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010543109.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="homoserine dehydrogenase"
                     /protein_id="QJU56751.1"
                     /translation="MTNPLRIALAGLGTVGAGVVKLLDANAALIERRAGRAIQITAVS
                     ARDRTRDRGVDLGRFAWVDDATQLADRDDVDVVVELVGGSDGPALTLARSTLAAGKSF
                     VTANKAMLAHHGLELAQAAEAKNVALKYEAAVAGGIPVIKGLREGAAANEIHHVFGIL
                     NGTCNYILSTMESAGRDFGDVLAEAQALGYAEADPSFDIDGVDAAHKLSILASLAFGA
                     TVDFDAVAITGIRHVKAADIAEAAALGYKIRLVGLGEATSKGLFQRVHPCLVPVDHPL
                     AHVTGSLNAVVAEGNYVGRLLFQGRGAGEGPTASAVVADLVDIARGEYGPAFGMPVAS
                     LTNLPAAPAGERRGRAYLRFTVVDKPGVLAELTAAMRDAGVSIESLIQRGPAADGGVL
                     IVLVTHEGPEQSVAHALEKLEGSPSVIGQPMLMHILEA"
     gene            complement(461915..462307)
                     /locus_tag="HL653_02185"
     CDS             complement(461915..462307)
                     /locus_tag="HL653_02185"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56752.1"
                     /translation="MRMVAVTIALVSAAPAFAQTAGPPAPVAAKTTPAEQAIEAYQKS
                     EQPRAAPVRCRSRGGGDTVTVCGVREGARAPLPNDQSIRDGSRTAIGELPSTAGIRYT
                     NPVGIMPRTGAQVTLRGDGKITGKGMGQ"
     gene            complement(462374..462934)
                     /locus_tag="HL653_02190"
     CDS             complement(462374..462934)
                     /locus_tag="HL653_02190"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56753.1"
                     /translation="MRMVWVTIALLMTAPAFAQTAGPPVPVEPKQSPAEQAISYAHRD
                     DALPPPSPPGQTCRKADGSISTACGVKEGARPPDTPCHNNAGEIVVCGVTGRSPERIP
                     LPDERGPGSHPGEIRQADVGQGPFPPRPGTTVARFGMGKTAKTRNATLKMIYEQDAAK
                     QAAAAKAAGDQGKADQAEVRATAPPQ"
     gene            complement(463001..463558)
                     /locus_tag="HL653_02195"
     CDS             complement(463001..463558)
                     /locus_tag="HL653_02195"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56754.1"
                     /translation="MSRFVPLLIALIGASPALASVAGPPVPVVPKQTPFQQAVAFAHR
                     DDPIPPAPTPVSCKNAKGETSTACGVKDGARPPSIPCRRKDGEIVVCAIVGRSPDRIP
                     LPDERGPAHHPGEFARADVGQGPFPPRPGITLITFGMSKAVKMRNETLKMIYAQEAAE
                     QAAADRAAKQAEVDQAVITAAAAPR"
     gene            complement(463648..464055)
                     /locus_tag="HL653_02200"
     CDS             complement(463648..464055)
                     /locus_tag="HL653_02200"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010336504.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU60403.1"
                     /translation="MARLGNAFLDRTLPKAEWTHAAHFATTLWLIAARPEIVAERDMP
                     ALIRAYNASVGGVNDDHTGYHETITQASIRAARAFLVERPHDEPLHEAVDALMAGPLG
                     RSDWPLAYWTRERLFSVEARRGWIAPDLPAFPF"
     gene            464304..465347
                     /gene="glpX"
                     /locus_tag="HL653_02205"
     CDS             464304..465347
                     /gene="glpX"
                     /locus_tag="HL653_02205"
                     /EC_number="3.1.3.11"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020178424.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class II fructose-bisphosphatase"
                     /protein_id="QJU56755.1"
                     /translation="MPAALLDKVTWPPYPGLIPAVRSKRVEVTASKALDRVLVLEMVR
                     VTEAAAIAASSLVGRGDEKAADHVAVEAMRKAFNELDFDGTVVIGEGERDEAPMLYIG
                     EKVGKASPGSPKIDIALDPLEGTTLTAKAYPNALAVLAIAEEGGLLNAPDVYMEKLAI
                     GPGYEKGLVSLTKTPTENIKALAAAKGVAANEIIACVLDRPRHEALIAELRALGVGIM
                     LIPDGDVAGVIACTDPDTTIDIYFGSGGAPEGVLAAAALACVGGQFQGKLLFRNDDER
                     GRAAKWGVTDLDKIYELEDLVKGDAIFAATGVTDGSLLEGVKVRKGVITTESIVMRAS
                     SGTVRRVKGEHRR"
     gene            465539..466405
                     /locus_tag="HL653_02210"
     CDS             465539..466405
                     /locus_tag="HL653_02210"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007404865.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)-dependent oxidoreductase"
                     /protein_id="QJU56756.1"
                     /translation="MRVALLGIGNMGAPIGRNILKAGHDLIVWNRSPDKAAPLVAEGA
                     TLAATPAAATVEAEIVCTMLADDRGVEAVTFGEEGLLSADPRKLHVGFSTISLALARR
                     LAEAQGDLYISAPVFGRPPAAAAAQLSVVTAGASESIARAQPIFDAIGQKIFVVGAEA
                     PAANLVKLCGNFMIMSAIEAMGEAMALAAKNGLDKQALFDVLTGTLFGAPVYKNYGPA
                     LIAGEYRPAGFPAPLGLKDMNLVAEAAGGARVPMPLLGVIRDHLLQTIGREGDDVDWA
                     AIGKAISDNAGL"
     gene            466632..467741
                     /locus_tag="HL653_02215"
     CDS             466632..467741
                     /locus_tag="HL653_02215"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008602987.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56757.1"
                     /translation="MNKVAFLFLGETLLIPHLWPIAEALAEAAPDLPIDLWVSTSIHE
                     EMLSRWSRAYPSMRLRRAPGYRPLPGLAAGTNPPLPAKIPMLARLAPLLLGTRVAVCA
                     EQTSLWIPRALSFHPTRFVRTAHGAGSINARSDPRQRAATLLFEPSETERQAFIRHGV
                     RPERIVVTGYIKASFRHRTPAAHLFPEARPILLYTPHWQRHRSSWWEWGRQIVGHLAE
                     QTRFNVILAPHQRLVERDPGLREVLAGVSHLPHIHADLDSFAMVDGSYTAAADLYLGD
                     TSSQVVEYMVRPRPCLFLNAQKIDWRATDDHDFWNCGDVIDDLAALPAALDDATKRHS
                     HYAALQQSFAENALGDTSGKAPAISAKYLISLLSA"
     gene            complement(468209..468595)
                     /gene="rplS"
                     /locus_tag="HL653_02220"
     CDS             complement(468209..468595)
                     /gene="rplS"
                     /locus_tag="HL653_02220"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015456924.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L19"
                     /protein_id="QJU56758.1"
                     /translation="MNLIQQLEAEQIAALTAKRPIPEFRPGDTLKVGVKVVEGERTRV
                     QSYEGVCIARSNKGMGSSFTVRKISFGEGVERVFPLYSPNIDSIDVVRKGVVRRAKLY
                     YLRGRTGKAARIAERRDNREKVSVEA"
     gene            complement(468597..469325)
                     /gene="trmD"
                     /locus_tag="HL653_02225"
     CDS             complement(468597..469325)
                     /gene="trmD"
                     /locus_tag="HL653_02225"
                     /EC_number="2.1.1.228"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011445065.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA (guanosine(37)-N1)-methyltransferase TrmD"
                     /protein_id="QJU56759.1"
                     /translation="MFSATVLTLYPEMFPGPLGVSLAGRALSEGKWSLDAVQIRDFAT
                     DKHRSVDDTPAGGGSGMVLRADVVAAAIDATAQPGVPLLAMTPRGAPLTQARVRALAA
                     GPGVAILCGRFEGFDQRLFEARQIEEVSIGDYVLSGGETAAIVLLDACVRLLPGVMGA
                     ASSGDEESFESGLLEYPHYTRPQMWEGRTIPEVLRSGDHAAIKAWRQSMAEIDTRLRR
                     PDLWERHIGARVQSPSGARQKKDE"
     gene            complement(469490..470998)
                     /locus_tag="HL653_02230"
     CDS             complement(469490..470998)
                     /locus_tag="HL653_02230"
                     /inference="COORDINATES: protein motif:HMM:NF012371.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-lactamase family protein"
                     /protein_id="QJU56760.1"
                     /translation="MLARCTLLFAMMLFAVTPATSAAPEKNGPDKAALEEVDRIFDTW
                     AIDAHVPGLVYGLVVDGKLVHVRGGGLQDMVARKPVTPDSLFRIASMSKAFTALAILK
                     LRDEGRIVLDAPAETYVPELKGWTYPTADSPKITVRNLLTHSAGFVEDNPWGDRQQVM
                     PEAEFTAVLKAGVPFARAPGLGMEYSNFGYATLGRIVSNVSGIRYEEYIRKTFMVPLG
                     MASSGYDIFAGPQGRRVIGYRWQDNGYVREPDMKDGAFGAMGGVETSAQDYAKWVEFL
                     LSAWPARDGADTGPVKRATVREIVTGANFVGAGMRNAAYGGAPCRQASAYGMAWRVID
                     DCDLGRVVTHTGGYPGYGSVVMLLPDKGVGLFAFASKTYAGASLPAYRAMLALNKAGV
                     LAADRTMPVSGGLATAYEAARAVWRTGGIEAAPVANNVLMDRDAPRWKTLVEGLKKEV
                     GTCDADAAITPVSAMEGKFVWTCEHGRIAGRVQRAPTPEVKLQALEFAVQAP"
     gene            complement(471049..471330)
                     /locus_tag="HL653_02235"
     CDS             complement(471049..471330)
                     /locus_tag="HL653_02235"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56761.1"
                     /translation="MTLDTFFLLLVPTYLVLIAYGQVGARKRRLAPRMRGITAAIRVM
                     LPPVVLIGTLAWEGDTGLLRAWLPVVIGMAVAGAIVAAAVEVVAPRVGA"
     gene            complement(471327..471719)
                     /locus_tag="HL653_02240"
     CDS             complement(471327..471719)
                     /locus_tag="HL653_02240"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011542991.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II toxin-antitoxin system VapC family
                     toxin"
                     /protein_id="QJU56762.1"
                     /translation="MKYLFDSNILIAAMMAGDTRLQARMAECDEGDIVTSAVVYAEVA
                     HGCMHGKQPALDYLDTFVEEVAVLPFDRAASVAYARLPFVRGSYDRLIAAHALSLGLT
                     LITANERDFADVPDLQVENWMLPPDSSA"
     gene            complement(471716..472012)
                     /locus_tag="HL653_02245"
     CDS             complement(471716..472012)
                     /locus_tag="HL653_02245"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017670228.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AbrB/MazE/SpoVT family DNA-binding
                     domain-containing protein"
                     /protein_id="QJU56763.1"
                     /translation="MSEEYRAKVFKSGNSLALRLPKALGLEEGAEMLLREERGRYIVE
                     PVEKPKRKINLEKIWGIGKHLDLKPITPEDRVFEHRPLLWDDPEWVASVTKREP"
     gene            complement(472043..472510)
                     /gene="rimM"
                     /locus_tag="HL653_02250"
     CDS             complement(472043..472510)
                     /gene="rimM"
                     /locus_tag="HL653_02250"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010543280.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA processing protein RimM"
                     /protein_id="QJU60404.1"
                     /translation="MVTLAVIIGAHGIAGECRLKLFTDDLKAYPGIRAGGRDLRLLSL
                     RHGANGAIARFDGVADRNAAELLRGTELSVPRSSLPALPPGEYYHIDLIGLPCVSDAG
                     EPLGHVAAVENFGAGDVIEIARAGGGTFMVPMNTDAVPDWNGERLVVDAAFVA"
     gene            complement(472603..473019)
                     /gene="rpsP"
                     /locus_tag="HL653_02255"
     CDS             complement(472603..473019)
                     /gene="rpsP"
                     /locus_tag="HL653_02255"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012048865.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S16"
                     /protein_id="QJU56764.1"
                     /translation="MSVSIRLSRGGSKKRPYYRIVVANSRAPRDGAFIEKIGTYNPLL
                     AKDDEKRVVLNGERAKHWLSVGAQPTDRVARFLDAAGLKERAARSNPKKGEPGEKAKE
                     RAEERAEKLAAAEAAANPPAPEAPAEEAAAEETTEA"
     gene            complement(473157..474629)
                     /gene="ffh"
                     /locus_tag="HL653_02260"
     CDS             complement(473157..474629)
                     /gene="ffh"
                     /locus_tag="HL653_02260"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012048864.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal recognition particle protein"
                     /protein_id="QJU56765.1"
                     /translation="MFDSLSDRLSATFDRLRGRGALTETDVREAMREVRIALLEADVA
                     LPVVREFVDKATEAAVGQNVLKSVTPGQQVVKIVHDALVEMLGAEASELLLEVTPPAI
                     VMMVGLQGSGKTTTTAKIAKRLKERGAKKVLMASLDVNRPAAQEQLAVLGTQADVQTL
                     PIVAGQQPVEIARRALQSAKLQGFDVLMLDTAGRLHVDQALMDEMKAVADIATPHEIL
                     LVVDALTGQDAVNVAKSFTDQVPLTGVVLTRMDGDARGGAALSMRAVTGRPIKFVGTG
                     EKLDGLEAFHPERVAGRILGMGDVVSLVERAAETIKVEEAEALARRMDEGKFDLNDLR
                     SQLNQMKRMGGLSGLASMLPGVKQVKQAMASGAADDKHLVRLEAIMSSMTAKERAKPE
                     IIAAKRKIRIAKGSGTTVQEVNKLLKMHQEMAGMMKKMKKMGGLKGLAKLFGGGGGDL
                     NAMMEGAGLPPGGLPNMPGLPGGGNPQGLPPGFQNFLKKR"
     gene            complement(474829..475644)
                     /locus_tag="HL653_02265"
     CDS             complement(474829..475644)
                     /locus_tag="HL653_02265"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015457303.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transglutaminase family protein"
                     /protein_id="QJU56766.1"
                     /translation="MRLFVKHRSEYRFSEPQARLVQLLRLTPGNHAGQSIVSWRIDVD
                     RDARLKSSRDGYGNETTMLYLDGPLERIALEVSGEVLTDDRAGMLIGAVETLPPVYYL
                     QSTPLTKGDEALADHVAALGLPADPQARAHALAEAIEDLLAPAEADPATDHSAAARFA
                     ARAADPQGHAHVLIAAARALRLPARYVAGHLYRPDAPEGHAAHGWAEIWVDGYGWIGF
                     DSFEGQCPTESYVRVAIGLDHREAAPISGLRIGGGHEALAIDVHVGPQPARQD"
     gene            complement(475827..476762)
                     /locus_tag="HL653_02270"
     CDS             complement(475827..476762)
                     /locus_tag="HL653_02270"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011951368.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-E domain-containing protein"
                     /protein_id="QJU56767.1"
                     /translation="MLSRTAASLYWIGRYVERAEFTARLIEATVRLDALSARPAGATA
                     WESALLVVAADQGFAATGVELNPRNVSAYLTLAVNNPSSIRSCLDAARWNAKSVRTAL
                     TRDAWETINRAWLGLRNVTDMGDLRSALAVIEKIRAETRGFEGALHRMLRNEAYAFLG
                     LGAAMERADNTARLIDVKYHLLLPEGEQVGGVIDRDQWTTILHTVSANTAYRWLYHDE
                     LKPWLVTDMLILKSELPRSLAGSADEVLGHLAFIGRRLGRQGEADRLARQRQAMLART
                     SIDSVFQQGLHEYLEAFLVENARLDRTIAAQFRFG"
     gene            complement(476762..478255)
                     /locus_tag="HL653_02275"
     CDS             complement(476762..478255)
                     /locus_tag="HL653_02275"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011951367.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="circularly permuted type 2 ATP-grasp protein"
                     /protein_id="QJU56768.1"
                     /translation="MSVPTAFDEIFGNSGDQPRAEFAALGAWLEETPDSELDRRQQAA
                     EAAFRQLGITFAVYGNDDSAERIIPFDIVPRIFTATEWSRLKEGLVQRVEAINAFLAD
                     IYGERKILADGVLPQELVLANPQFRGFLSGQKPPHGVFAHICGIDLVRTGADEFWVLE
                     DNARTPSGVSYMLENREAMLRLCPELFHRFNVCPVDRYPDQLRDTLRSVAPRGRGSEP
                     VCVLLTPGHFNSAFYEHSFLADSMGVELVEPADLEVDDDIVWMRTIDGRVRVDVIYRR
                     IDDDYIDPLVFRPDSLLGVPGLIAAYLAGNVALVNAPGTGIADDKAIYSYMPEIVKYY
                     SGGEAKLPNVETYRCREPGALQYTLDNLEKLVVKLVDGSGGYGMLVGPTATRAQIEDF
                     RAALKAEPHRYIAQPTLALSTVPTLTEKGIAPRHVDFRPFVLTGSDGVHIVPGGLTRV
                     ALKEGSLVVNSSQGGGTKDSLILSDTPECLLPPRGGQSQSQGQGGQG"
     gene            complement(478428..480914)
                     /locus_tag="HL653_02280"
     CDS             complement(478428..480914)
                     /locus_tag="HL653_02280"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017978224.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PhoX family phosphatase"
                     /protein_id="QJU56769.1"
                     /translation="MTDHSAAGHYDDGLIDTNTTANPTIHEIVDQRYSRRQTLFGGIS
                     ALTVATLGGMVTACGGDNDAPGLGAGTVVNAGAAMTTSSGKAVTLTGSTANATAGADA
                     WTQVSGPTVTFDTRTGTTATFIAPSVSASTVLTFRYAATGSSGAITADTTVTVTPAVL
                     GFTAVAKSLDDVVKVPEGYSVTVLYRLGDPINTATAAFANNGTDTGYSARAGDHHDGM
                     SYFGLAATGSAPDPTSNLRGLLVMNHENINQPYLHPNGATTVGGARPEGEALKEMECH
                     GISVVEITRGSATGTWSYVQAGALNRRITPLTPMTFTGPVAGSAGLRTSFSPTGVAGR
                     GTINNCANGYMPWGTYITCEENWAGYFRRDTGDVAARGGATAKANVSLARYGIPENRA
                     GNYGWATVTPADTTSTIYRRWNITTLAGAAADGTGDYRNEASQFGWVVEIDPFTNTSV
                     PRKRTALGRMNHEGCWVGRTVVGVRPAFYMGDDAQNEYIYKFVSATPWVAADATPTDR
                     LATGDKYLNTGTLYVAKFNADGTGTWLPLIFGQGGVTAANPTYAFADQADVLINARLA
                     ADVLGATRMDRPEWTAINPVSGEMYCTLTNNSSRTVANTDTANPRAYTDPRINGTVTN
                     GNANGHIIRLRETGDTTEATTFAWDIYAFGAGSDLNPTNINLSGLDATNDFSSPDGLW
                     FGRTSNPTGLVSPVMWIETDDGAYTDVTNCMLLAAQPGSVNDGATRTITNTIGATTGT
                     QSTRVGKVPGTSLRRFLVGCKECEITGIDSTPDGRSIFVNIQHPGENGTPSNITSNWP
                     ANQSGTAAPGVRPRSATIVITKNDGGVVGL"
     gene            complement(481159..481854)
                     /locus_tag="HL653_02285"
     CDS             complement(481159..481854)
                     /locus_tag="HL653_02285"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015457307.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator transcription factor"
                     /protein_id="QJU56770.1"
                     /translation="MRVLLIEDDPTTARSIELMLGAEGINVYTTDLGEEGLDLGKLYD
                     YDLIALDLNLPDMNGYEVLKKLRVSRVQTPVLILSGTSETDAKVRALGFGADDYVTKP
                     FHREELVARIHAIVRRSKGHSQSVIRTGKLAVNLDAKTVEVDGSRVHLTGKEYAMLEL
                     LSLRKGTTLTKEMFLNHLYGGMDEPELKIIDVFICKLRKKLSLACSGENYIETVWGRG
                     YVLREPEEVAQVA"
     gene            482031..482711
                     /locus_tag="HL653_02290"
     CDS             482031..482711
                     /locus_tag="HL653_02290"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007679337.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RluA family pseudouridine synthase"
                     /protein_id="QJU56771.1"
                     /translation="MSLPIIYEDAESLVIDKPAGLPVDHPRAGGESLEARLDELRLGF
                     ARAPAAVHRLDRDTSGCLLLARNPKALRRFAAAFEAREVAKSYLAIVTGDVPDEGEID
                     LPLTKTSSAEAGWRIIPSRAGKPARTHWQRLATAGDHRLLLLTPETGRTHQLRVHLAS
                     GLDRPIVGDAVYGAAHPGGMMLHAWRLVVPRAGKPPIRAEAPLPARFAAFGFGPESLE
                     GIAFDGLA"
     gene            482698..483108
                     /gene="arfB"
                     /locus_tag="HL653_02295"
     CDS             482698..483108
                     /gene="arfB"
                     /locus_tag="HL653_02295"
                     /EC_number="3.1.1.29"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010163153.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminoacyl-tRNA hydrolase"
                     /protein_id="QJU56772.1"
                     /translation="MASPEPPPLPESALEERFLAATGPGGQNVNKVATACQLRLDVYA
                     LRLAPDVYDRLKTLAGTRWSAGSILVTARRFRTREANREDARKRLAQMVADAHIRPER
                     RVKTKPSKAAKARRVEAKSQRGAIKQGRARPRIE"
     gene            483122..483619
                     /locus_tag="HL653_02300"
     CDS             483122..483619
                     /locus_tag="HL653_02300"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007405479.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GAF domain-containing protein"
                     /protein_id="QJU56773.1"
                     /translation="MYQFDIAATDKPALYREMEQALDALVTGEPDAIANMANAAALLW
                     EYLPDLNWAGFYRNVRDELVLGPFQGKAACIRIPFGKGVCGAAAATRATQRVEDVHAF
                     PGHIACDAASASELVVPIVHDGRLIGVLDLDSPTPGRFDAEDQAGCERLVARLAPALA
                     GALAA"
     gene            483665..483838
                     /locus_tag="HL653_02305"
     CDS             483665..483838
                     /locus_tag="HL653_02305"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56774.1"
                     /translation="MTMLRPLLPLLMLIPFIAISGAVRAATPAETARQAPIHAQAPFV
                     VSDDARAGSRTAR"
     gene            complement(483974..484645)
                     /locus_tag="HL653_02310"
     CDS             complement(483974..484645)
                     /locus_tag="HL653_02310"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013847938.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase family protein"
                     /protein_id="QJU56775.1"
                     /translation="MWQLYQFPLCPFSRKVRLLLGEKGEGCELIRESPWEQRDEFIDM
                     NPAGQTPVLIDKGSGLPLIDSSAICEYLEETIERASMLPGTSANRAEIRRVTAWFDHK
                     FHDEVVRPLMFERMEKRLVHRLSPDAKILREAMRAANSHLDYVDWMLDHRRWMAGPLF
                     SLADLAAAAHISVADYLGGIDWRGHERTRHWYSGMKSRPSFRPLLAERMEVIGPPDHY
                     DKLDF"
     gene            complement(484771..484959)
                     /locus_tag="HL653_02315"
     CDS             complement(484771..484959)
                     /locus_tag="HL653_02315"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56776.1"
                     /translation="MANNNATGGGNNAGQGDRNQQQDRNQQADRQQNQQTREQTDRDR
                     KDGDKVGRSDQQGGTHNR"
     gene            485190..485720
                     /locus_tag="HL653_02320"
     CDS             485190..485720
                     /locus_tag="HL653_02320"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017184457.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fasciclin domain-containing protein"
                     /protein_id="QJU60405.1"
                     /translation="MTMMALAATALTPAAFAANPMVGGAAMYPTKTIVDNAVNSKDHT
                     TLVAAVKAAGLVETLSGPGPFTVFAPTNAAFAKLPAGTVDTLVKPENKATLTGILTYH
                     VVSGAMTSKDIAAAIKKGGGKATLTTVQGEPLTAWMKGNMLVLTDAKGGNSTVTIKDV
                     MQSNGVIHVVDTVLMP"
     gene            complement(485899..487113)
                     /locus_tag="HL653_02325"
     CDS             complement(485899..487113)
                     /locus_tag="HL653_02325"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019834239.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatidylserine/phosphatidylglycerophosphate/
                     cardiolipin synthase family protein"
                     /protein_id="QJU56777.1"
                     /translation="MRDAPEVNVEGGGEAGASAGGVKDGVSFEVEGNRLTPLIAGSVR
                     LEALIALIDGARHSLRLLYYIYCDDESGRRVRAAMDAALLRGVDVRLIVDGFGSSVPA
                     HFFDELTRDGADVCRFLPRFGRRYLLRNHQKLALADEERVIIGGFNIQDDYFEDRTGW
                     RDLGLLVEGPAAKRLVGYFDALAEWTHQPKARMRDLRAALGKWSEHKKRHVRWLLGGP
                     TRKLSPWARTVKQEIQRARRLDIISAYFAPHPLMMRRIERVAERGGVSRVITPSKADH
                     RVAIAAARHLFRRMLKRGVRVFEYQPQKLHTKLYVIDDVVHIGSANFDMRSLFLNLEL
                     MLRIEDPAFAAHMRHYFEGEMADSRAITPDLLGKASLLDRLRWSIGYFVMAVLDVSVT
                     RRLNFGGEKQEF"
     gene            487165..487506
                     /locus_tag="HL653_02330"
     CDS             487165..487506
                     /locus_tag="HL653_02330"
                     /EC_number="2.7.7.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004208279.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit omega"
                     /protein_id="QJU56778.1"
                     /translation="MARVTVEDCVDKIPNRFDLVLLAAQRARQISGGAELTIDRDRDK
                     NPVVALREIAEETVIPTELKELVVSGLQRVQIDDEDAPDAVGSLTASAEALRLTAAAP
                     PRNQSLGADYE"
     gene            487634..489760
                     /locus_tag="HL653_02335"
     CDS             487634..489760
                     /locus_tag="HL653_02335"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013934404.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional (p)ppGpp
                     synthetase/guanosine-3',5'-bis(diphosphate)
                     3'-pyrophosphohydrolase"
                     /protein_id="QJU56779.1"
                     /translation="MLRQYELVDRVLSYDPNADEALLNRAYVFSMAAHGSQVRASGDP
                     YFSHPIEVAGILTDLHLDDETIATAILHDTIEDTVATQEEIEAKFGASVARLVDGVTK
                     LSKIEAQSESERAAENFRKFLLAMSDDIRVLLVKLADRLHNMRTLHHIPKPEKRRRIA
                     RETMDIYAPLAERIGMYGFMSEMQTLAFRELEPEAYASITKRMEQLREGAGDRISRIT
                     SGLKLLVGQKGITAEVQGREKQPFSIWRKLAERHVSFEQLTDIMAFRLIVDDIEQCYQ
                     ALGIIHRRWPTIPGRFKDYISTPKRNGYRSLHTAVIHSERVRIEIQIRTHEMHEQAEN
                     GVAAHWAYKQGQPLRGDSYGSWVKDLVDLVDSASSPEELLENARMAMYQDRIFAFTPA
                     GELIQLPKNATPVDFAYAVHTDLGDQTVGAKVNGRVVPLRTTLNNGDQVQILKSKAQE
                     PQAAWESFAVTAKARAAIRRYVRQKEQADAIALGRQFYDQIVARLPAQLAPDALVQAL
                     KRLRLPDADKLMGMIARRRVTDAQVMEALMPGSTSDGQIATKPVAQPGTTISIKGLTP
                     GVAFTLAPCCTPVPGDRIVGVRLPHAPVEVHAIECPVLANAPEEDWIDLAWGDGSEGG
                     TVRLQVVVKNEPGSLGVMAGIFGAQGANIVNLTLAQRDQGFHVFQVLIEVHDLQHLTR
                     ILASLRAADAVVRAERMEPAVAAAAE"
     gene            489920..490255
                     /locus_tag="HL653_02340"
     CDS             489920..490255
                     /locus_tag="HL653_02340"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="QJU56780.1"
                     /translation="MKALLACMAACISVGASAQMTAMNGIMTDPSNHIIPQGLEGRGT
                     GVAETPTMRQQKLDRAIALRAEATALLAQDGGTLTPAHTAYLRRKACDILANQAKSGG
                     LAPSGACRS"
     gene            complement(490280..490738)
                     /gene="nusB"
                     /locus_tag="HL653_02345"
     CDS             complement(490280..490738)
                     /gene="nusB"
                     /locus_tag="HL653_02345"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014077833.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription antitermination factor NusB"
                     /protein_id="QJU56781.1"
                     /translation="MSGANNSRSRSRSAARLAAVQALYQQEMESTPLARLLDEFHTHR
                     LGAEIDDERYERAEVAFFDDIVRGVSARAEEIDAIVEAHLAAGWNLARLDRPLRQILR
                     AGTYELMARIDVPTAAVITEYVDVADAFYEKRETGFVNGILDKIGRKVRA"
     gene            complement(490735..492018)
                     /gene="hisD"
                     /locus_tag="HL653_02350"
     CDS             complement(490735..492018)
                     /gene="hisD"
                     /locus_tag="HL653_02350"
                     /EC_number="1.1.1.23"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010543219.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidinol dehydrogenase"
                     /protein_id="QJU56782.1"
                     /translation="MIRLTSTAPDFAAAFDALVNARREADEDVSRDVAAIVAAVRAKG
                     DEAVRDYTARFDRHDLDAGGWEIDRATRRAALDGLDTDLRAALELAAERITAYHAAQR
                     PADRDEMDAAGVRLGARWRPVDAAGLYVPGGRAAYPSSVLMNAIPAKAAGVGRLTMVT
                     PTPGGEINPLVLAAAEIAGVDDIFRIGGAQAIAALAYGTSKVQPVDVIVGPGNAWVAE
                     AKRQLFGVVGIDMVAGPSEIVVVADGANDPVWIAADLLSQAEHDPTSQSILFTDDAAF
                     ADAVAAEVDAQLARLQTGPTARAAWDSNGAILVVPTLEEAMPLVDRLAAEHLELAVAD
                     PDALFARVRHAGSVFLGRHTPEAVGDYVAGPNHVLPTGRRARFSSGLSVLDFMKRTSF
                     IACTEASLRAIGPAAVALAHAEGLPAHAASVEVRL"
     gene            complement(492064..492729)
                     /locus_tag="HL653_02355"
     CDS             complement(492064..492729)
                     /locus_tag="HL653_02355"
                     /EC_number="2.4.2.17"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010215436.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP phosphoribosyltransferase"
                     /protein_id="QJU56783.1"
                     /translation="MSAPLIIAVPKGRILSEVMPLFAQAGIRPEPAFSDEGSRALRFA
                     TDRADIGLIRVRAFDVATFVAHGAAQIGVVGSDVLMEFDYSELYAPVDLDIGHCRLSV
                     AEPADMAAKDDPRGWSHVRVATKYPNVTRRHFEARGVQAECVKLNGAMEIAPVLGLSN
                     RIVDLVSSGRTLAENGLVEVERIADVSARLIVNRAAFKTRAAQILPLIEAFRAAVETK
                     NAA"
     gene            492778..493845
                     /locus_tag="HL653_02360"
     CDS             492778..493845
                     /locus_tag="HL653_02360"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010543221.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2332 domain-containing protein"
                     /protein_id="QJU56784.1"
                     /translation="MADEARNRESFRWQADFCAKSGMTIITRVCQGLADALDRTSRTG
                     ARVLDWPGEPIADALPLRLVGGLHALHRARSAPALAPVFEGVATEPAAIAAMI