LOCUS       CM010635            23189089 bp    DNA     linear   CON 13-SEP-2018
DEFINITION  Brassica rapa cultivar FPsc (B3) chromosome A8, whole genome
            shotgun sequence.
ACCESSION   CM010635 QMKI01000000
VERSION     CM010635.1
DBLINK      BioProject: PRJNA41163
            BioSample: SAMN00004054
KEYWORDS    WGS.
SOURCE      Brassica rapa (field mustard)
  ORGANISM  Brassica rapa
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Brassiceae; Brassica.
REFERENCE   1  (bases 1 to 23189089)
  AUTHORS   Bowman,J., Kohchi,T., Yamato,K., Jenkins,J., Shu,S., Ishizaki,K.,
            Yamaoka,S., Nishihama,R., Nakamura,Y., Berger,F., Adam,C., Aki,S.,
            Althoff,F., Araki,T., Arteaga-Vazquez,M., Balasubrmanian,S.,
            Bauer,D., Boehm,C., Briginshaw,L., Caballero-Perez,J., Catarino,B.,
            Chen,F., Chiyoda,S., Chovatia,M., Davies,K., Delmans,M., Demura,T.,
            Dierschke,T., Dolan,L., Dorantes-Acosta,A., Eklund,D., Florent,S.,
            Flores-Sandoval,E., Fujiyama,A., Fukuzawa,H., Galik,B.,
            Grimanelli,D., Grimwood,J., Grossniklaus,U., Hamada,T.,
            Haseloff,J., Hetherington,A., Higo,A., Hirakawa,Y., Hundley,H.,
            Ikeda,Y., Inoue,K., Inoue,S., Ishida,S., Jia,Q., Kakita,M.,
            Kanazawa,T., Kawai,Y., Kawashima,T., Kennedy,M., Kinose,K.,
            Kinoshita,T., Kohara,Y., Koide,E., Komatsu,K., Kopischke,S.,
            Kubo,M., Kyozuka,J., Lagercrantz,U., Lin,S., Lindquist,E.,
            Lipzen,A., Lu,C., Luna,E., Martienssen,R., Minamino,N.,
            Mizutani,M., Mizutani,M., Mochizuki,N., Monte,I., Mosher,R.,
            Nagasaki,H., Nakagami,H., Naramoto,S., Nishitani,K., Ohtani,M.,
            Okamoto,T., Okumura,M., Phillips,J., Pollak,B., Reinders,A.,
            Roevekamp,M., Sano,R., Sawa,S., Schmid,M., Shirakawa,M., Solano,R.,
            Spunde,A., Suetsugu,N., Sugano,S., Sugiyama,A., Sun,R., Suzuki,Y.,
            Takenaka,M., Takezawa,D., Tomogane,H., Tsuzuki,M., Ueda,T.,
            Umeda,M., Ward,J., Watanabe,Y., Yazaki,K., Yokoyama,R.,
            Yoshitake,Y., Yotsui,I., Zachgo,S. and Schmutz,J.
  TITLE     WGS assembly of Brassica rapa FPsc
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 23189089)
  AUTHORS   Bowman,J., Kohchi,T., Yamato,K., Jenkins,J., Shu,S., Ishizaki,K.,
            Yamaoka,S., Nishihama,R., Nakamura,Y., Berger,F., Adam,C., Aki,S.,
            Althoff,F., Araki,T., Arteaga-Vazquez,M., Balasubrmanian,S.,
            Bauer,D., Boehm,C., Briginshaw,L., Caballero-Perez,J., Catarino,B.,
            Chen,F., Chiyoda,S., Chovatia,M., Davies,K., Delmans,M., Demura,T.,
            Dierschke,T., Dolan,L., Dorantes-Acosta,A., Eklund,D., Florent,S.,
            Flores-Sandoval,E., Fujiyama,A., Fukuzawa,H., Galik,B.,
            Grimanelli,D., Grimwood,J., Grossniklaus,U., Hamada,T.,
            Haseloff,J., Hetherington,A., Higo,A., Hirakawa,Y., Hundley,H.,
            Ikeda,Y., Inoue,K., Inoue,S., Ishida,S., Jia,Q., Kakita,M.,
            Kanazawa,T., Kawai,Y., Kawashima,T., Kennedy,M., Kinose,K.,
            Kinoshita,T., Kohara,Y., Koide,E., Komatsu,K., Kopischke,S.,
            Kubo,M., Kyozuka,J., Lagercrantz,U., Lin,S., Lindquist,E.,
            Lipzen,A., Lu,C., Luna,E., Martienssen,R., Minamino,N.,
            Mizutani,M., Mizutani,M., Mochizuki,N., Monte,I., Mosher,R.,
            Nagasaki,H., Nakagami,H., Naramoto,S., Nishitani,K., Ohtani,M.,
            Okamoto,T., Okumura,M., Phillips,J., Pollak,B., Reinders,A.,
            Roevekamp,M., Sano,R., Sawa,S., Schmid,M., Shirakawa,M., Solano,R.,
            Spunde,A., Suetsugu,N., Sugano,S., Sugiyama,A., Sun,R., Suzuki,Y.,
            Takenaka,M., Takezawa,D., Tomogane,H., Tsuzuki,M., Ueda,T.,
            Umeda,M., Ward,J., Watanabe,Y., Yazaki,K., Yokoyama,R.,
            Yoshitake,Y., Yotsui,I., Zachgo,S. and Schmutz,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (22-JUN-2018) US DOE Joint Genome Institute, 400 Mitchell
            Drive, Walnut Creek, CA 94598, USA
COMMENT     ##Genome-Assembly-Data-START##
            Assembly Method       :: Meraculous v. May_2013
            Assembly Name         :: Brassica_rapa_FPsc_v1.3
            Genome Coverage       :: 155x
            Sequencing Technology :: Illumina Hiseq
            ##Genome-Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..23189089
                     /organism="Brassica rapa"
                     /mol_type="genomic DNA"
                     /cultivar="FPsc (B3)"
                     /db_xref="taxon:3711"
                     /chromosome="A8"
     assembly_gap    1445..11444
                     /estimated_length=unknown
                     /gap_type="between scaffolds"
     gene            <19954..21308
                     /locus_tag="BRARA_H00001"
                     /db_xref="Phytozome:Brara.H00001"
     mRNA            join(<19954..20110,20290..20561,20650..21308)
                     /locus_tag="BRARA_H00001"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00001"
     CDS             join(19954..20110,20290..20561,20650..21150)
                     /locus_tag="BRARA_H00001"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49186.1"
                     /db_xref="Phytozome:Brara.H00001"
                     /translation="MAPMSLPPGFRFHPTDEELVAYYLDRKVNGRTIELEIIPEVDLY
                     KCEPWDLPEKSFLPGNDMEWYFYSTRDKKYPNGSRTNRATRAGYWKATGKDRVVESKK
                     MKMGMKKTLVYYRGRAPHGLRTNWVMHEYRLTHPTSSSSIQESYALCRVFKKNIQIPK
                     RKEEEMTTSVGKEEEEEEKKKWKKYDGETMERESEEVESLKIASAETSSSELTQGILL
                     DEANSSSIFALHFSSSLLDDHDHQLFENYPQLPFHSPLPLQGFPQLSMNEAEIISMDN
                     SKQQDFHYRDSINGTLDEIFSFASSSATLPPAL"
     gene            22640..25126
                     /locus_tag="BRARA_H00002"
                     /db_xref="Phytozome:Brara.H00002"
     mRNA            join(22640..22929,23112..23170,23245..23319,23408..23521,
                     23618..23688,23905..24202,24292..24581,24761..25126)
                     /locus_tag="BRARA_H00002"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00002"
     CDS             join(22851..22929,23112..23170,23245..23319,23408..23521,
                     23618..23688,23905..24202,24292..24581,24761..24818)
                     /locus_tag="BRARA_H00002"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49187.1"
                     /db_xref="Phytozome:Brara.H00002"
                     /translation="MSSNTASSSAGSGDSSAARKNSKRPKYSKFTQQELPACKPILTP
                     GWVISTFLIVSVIFIPLGVISLFASQDVVEIVDRYDNDCIPAPARTNKVAFIQGAAPK
                     SCNRTLTVTKRMKQPIYVYYQLENFYQNHRRYVKSRSDSQLRSPKFENQISACKPEDD
                     AGGKPIVPCGLIAWSLFNDTYTLSRNNTPLAVNKKGIAWKSDKEHKFGNKVFPKNFQK
                     GNLTGGATLNPDIPLSEQEDLIVWMRTAALPTFRKLYGKIETDLENGDTIQVTLQNNY
                     NTYSFSGKKKLVLSTTSWLGGKNDFLGIAYLTVGGICFFLALAFTIMYLVKPRRLGDP
                     SYLSWNRNPGGGR"
     gene            complement(25513..30783)
                     /locus_tag="BRARA_H00003"
                     /db_xref="Phytozome:Brara.H00003"
     mRNA            complement(join(25513..27168,27416..28257,28347..28513,
                     28752..29093,29194..29274,29354..29477,29566..29671,
                     29756..29817,29902..30324,30399..30450,30675..30783))
                     /locus_tag="BRARA_H00003"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00003"
     CDS             complement(join(25727..27168,27416..28257,28347..28513,
                     28752..29093,29194..29274,29354..29477,29566..29671,
                     29756..29817,29902..30324,30399..30445))
                     /locus_tag="BRARA_H00003"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49188.1"
                     /db_xref="Phytozome:Brara.H00003"
                     /translation="MAGSAPEGTQKKLNQVLEGSKMMEEEYPEELRTPPVSLVALFGC
                     AELHSSITNHLHSQQPPINALAFPDFSHLPLLLLAHRDVINNPTSSSFRDPLSSDSSS
                     SPSAAVPSGGILKRDWLLKHRTKVPALVAAFFPSNHISGDPTQWLQVCSNLDTLKSVI
                     RPKNIKLVVVVVQSSPHEVISEDRLLALRKRAELDSKYVLFLNHSELPLSLPRIASAF
                     SDLALSYYREEARRIKSRIEKRSSTSLDLIVRYCFKVAVYAEFRRDWGEALKFYEDAY
                     HSLHEMIGTSTRLPPIQRLVEIKTIAEQLHFKISTLLLHGGKLSEAVIWFHQHKSSYD
                     KVVGSTEYNFLHWEWMSRQFLVFAELLETSSATVQNFSSLNQGTAEIPLTEFEFYPAY
                     YYQLAAHYLQNKKSALELLLSMSVAAQQIGGSSESITPSVYVGQFSQLREKGEALTLH
                     FITDEEYIRYAISEAKRFQGSFEIVAWLKKSYESFTNLKSRRMAAFCAFEIAREYFGL
                     SDPSNAKFFFDIAANLYRQEGWVSLLWEVLGYLRECSRNLGALKAFVELSLEMVALPV
                     TSCDDFGNLRDKTYGPGGPATVSRRESIHREVFTLMCRETELISSTEESGFKLASDSP
                     LHLEIDLVSPLRPVLLASVAFHEQMIKPRALCSITLSLLSHLPLPVEIDHLEVQFNQS
                     TCNFVVRNSQKPLVASPSSTVQSGSQVENEQSLVLVPNNWLRLTYAIKPEQSGKLECL
                     SVLAKLGPRFTICSRAESPAAMEDSPVWKHENCVQSLPTKDPILAVFGQKATQVEEPE
                     PQVDVSLGASGPALVGENFTMPIVVTSKGHAVHSGELKINLVDVGGGGLFSPREAEPF
                     SLESHHVEICGIDGAEGNDESESETGNIKKIQQSFGLVSVPDLEEGESWSCKLEIKWH
                     RAKPVMLFVSLGYLPQGNEANAQKVHIHKSLQIEGKMPLFITNRFMLPYRRDHLLLNR
                     IKPAPDSEDMSSLPLNEKSVLVVSAKNCTEIALKLMCMSIELDDEQGKTSCLIQQGGG
                     GGETSDSANLAPGEEFKKVFTVIPTMRTPKLSLGSVHMKWRRQGDYTEDACVSTKHKL
                     AEVNVDASPLVMSLNCPPYAILGESFTYAITICNQTQLLQEAKFALADAQSFVLSGSH
                     SNTVSVLPKSEHVLSYKLVPLTCGQQQLPKITLTSVRYSAEFQPSTIASSVFVFPSAP
                     QANSTAK"
     gene            30938..33009
                     /locus_tag="BRARA_H00004"
                     /db_xref="Phytozome:Brara.H00004"
     mRNA            join(30938..31346,31416..31475,31548..31796,31880..31956,
                     32050..32126,32206..32338,32460..33009)
                     /locus_tag="BRARA_H00004"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00004"
     CDS             join(30962..31346,31416..31475,31548..31796,31880..31956,
                     32050..32126,32206..32338,32460..32615)
                     /locus_tag="BRARA_H00004"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49189.1"
                     /db_xref="Phytozome:Brara.H00004"
                     /translation="MASLSPSSSCLLRNLILTPSPHPFSRPIFVGGSRRRHLVQRLSA
                     LREWREYEDAVKRKDLAGALRFLKTVQVIDKQAAESINIAAAPALDWEVLDACLNADD
                     MRLVGSAFRFLKDRGLLPNFAKFSNIVLEGPREVTPTVLKSATGLEVNKLAPKKWGLS
                     DSSSIALAAFLGGVSYLLSQDIDLRPNLAAILGLAFLDSLLLGGTCFAQISCFWPPHK
                     RRVIVHEAGHLLVAYLMGCPIRGVILDPIVAMQMGVQGQAGTQFWDQKMESEIAEGRL
                     SGSSFDRYSMVLFAGIAAEALVYGEAEGGENDENLFRSISVLLEPPLSVAQMSNQARW
                     SVLQSYNLLKWHKAAHRAAVEALQVGSPLSIVIRRIEEAMSPSR"
     gene            complement(38019..39306)
                     /locus_tag="BRARA_H00005"
                     /db_xref="Phytozome:Brara.H00005"
     mRNA            complement(join(38019..38820,38910..39039,39130..39306))
                     /locus_tag="BRARA_H00005"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00005"
     CDS             complement(join(38190..38820,38910..39039,39130..39268))
                     /locus_tag="BRARA_H00005"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49190.1"
                     /db_xref="Phytozome:Brara.H00005"
                     /translation="MGKGRAPCCDKSKVKRGPWSPKEDLTLITFIQKHGHHNWRSLPK
                     LAGLMRCGKSCRLRWINYLRPDVKRGNFSKEEEDAIIHFHQTLGNKWSKIASFLPGRT
                     DNEIKNVWNTHLKKRLFPNSSSYSSISCPNDRPTEADQKKNYAIVQEERNSRDNESQD
                     PPSSSHLHGKHMHTKPELHEVNELHEIQLLLDHDDFDDITSAFLQTTETLFPVQPLDS
                     LLQTHTLTGFHNTGGTTQEAIEPQSFDHSQPEIPCGFEETNGEFDLWSQPSPNSEEFD
                     EWLSFMDNQAYFDDFTLFGEVCL"
     gene            complement(<44604..>51088)
                     /locus_tag="BRARA_H00006"
                     /db_xref="Phytozome:Brara.H00006"
     mRNA            complement(join(<44604..44654,50123..>51088))
                     /locus_tag="BRARA_H00006"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00006"
     CDS             complement(join(44604..44654,50123..51088))
                     /locus_tag="BRARA_H00006"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49191.1"
                     /db_xref="Phytozome:Brara.H00006"
                     /translation="MSHRYSREEKKKWIPTRSQTIRKPPVQIPEIDTAALIEENKFTL
                     IGRVTNPATQNTKALVDFFLQHWNVSGRFTGRDLGPLLFQFRFENERDLLTILNKAPF
                     HFKRWMIIVQRWEPVVSEKFPDFLLFWIQINGVPLHYWEDKALRAIGKELGTVEDCIP
                     TQARVRVLINGLNPLEMTRDISLPSGEIIEVEFSYDNLQKHCFRCHSLSHEKDDCPTS
                     ENSRERDRSPNRIGISQRNTMARLDDNRRRYEERKRFKGHQVQHKREAPPSYTRRDYY
                     EDRTTDSRYNSRQHQSYAPVTSEYRRGREDYNPGRSFSRESGARVGKRMHKVDDKCDI
                     VNDT"
     gene            complement(<52233..>53366)
                     /locus_tag="BRARA_H00007"
                     /db_xref="Phytozome:Brara.H00007"
     mRNA            complement(join(<52233..52264,52727..53111,53178..>53366))
                     /locus_tag="BRARA_H00007"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00007"
     CDS             complement(join(52233..52264,52727..53111,53178..53366))
                     /locus_tag="BRARA_H00007"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49192.1"
                     /db_xref="Phytozome:Brara.H00007"
                     /translation="MDSKIYHSQSSSYVGLLNSQQGSVLHENFPYESFQSSVNFGESE
                     IPPPPFSSQQCEDTPVDRTDAVVGNDQKSGTFWKRVREYYAASPHGVEDGEKSEHLHC
                     KQRWHIINDQVNKFCGAYSAAERQISSGESDTDVLKKAHDIFYSDKKSKFNLEHVWCV
                     LRYEQKWFSLNTQKATASSKRKNGETDSSTNDLLKYKDNDA"
     gene            complement(<56228..>57192)
                     /locus_tag="BRARA_H00008"
                     /db_xref="Phytozome:Brara.H00008"
     mRNA            complement(join(<56228..56245,56356..56621,56664..>57192))
                     /locus_tag="BRARA_H00008"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00008"
     CDS             complement(join(56228..56245,56356..56621,56664..57192))
                     /locus_tag="BRARA_H00008"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49193.1"
                     /db_xref="Phytozome:Brara.H00008"
                     /translation="MNGALPVGSVLLTRGLHAEAKCKRCGELKTPLHLFLTCPFAARI
                     WDRIPALFKPDASTVTSVSNLLISNMRMINLPPTGLGTSPIYPWLYWHLWKARNKLIF
                     EDRSWTEAELVLKIIKDARCWEEASQGKRHAQTNKSNPIPAPLPSLQYLNCFTDGAWD
                     PNSGNSGQGWHFTTSSVAPIVAEALAVKAALIDAVTNDFSQLNVFSDSKSLINLLNSS
                     ASTVLFQSVLFDIRALCCRFESISFFFVPRLGNVAADTLAKSALRLLVFQVC"
     gene            <58781..64559
                     /locus_tag="BRARA_H00009"
                     /db_xref="Phytozome:Brara.H00009"
     mRNA            join(<58781..58898,59103..59175,60582..60653,60739..60810,
                     61013..61084,61174..61239,61423..61488,61636..61680,
                     61789..61850,61932..62314,62403..62601,62688..62846,
                     62946..63064,63147..63357,63441..63672,63754..63904,
                     64020..64559)
                     /locus_tag="BRARA_H00009"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00009"
     CDS             join(58781..58898,59103..59175,60582..60653,60739..60810,
                     61013..61084,61174..61239,61423..61488,61636..61680,
                     61789..61850,61932..62314,62403..62601,62688..62846,
                     62946..63064,63147..63357,63441..63672,63754..63904,
                     64020..64403)
                     /locus_tag="BRARA_H00009"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49194.1"
                     /db_xref="Phytozome:Brara.H00009"
                     /translation="MARQRRRSLCLLITVWFLSGSVHVVRAQNRTGATTDPDEARALN
                     SIFAAWRIPAPREWNISGELRLGDISNGSSSLEFFKDMKSLSTLVFRNSNLTGTIPSF
                     IGEFSSLQQVDLSFNKLGGPIPASLFNLSRLTHLFLGNNTLNGPLPSQKSQTLRNIDV
                     SYNDLSGSLPSWVNLPNLKLNLVANSFSLEGLDKSVLPGLSCLQKDFPCNRGKALYSE
                     FSINCGGPPIRSVSGALFEREDEELGPASFVVSDVQRWAASSVGLFAGSSSNIYIATS
                     QSQFIGTLDSELFQSARLSASSLRYYGLGLENGGYTVTLQFAEIQILGSTSNTWRGLG
                     RRRFDIYVQGRLVETDFDVRRTAGDSTVRAVQRVYKANVTENYLEIHLFWAGKGTCCI
                     PIQGAYGPLISAVSAKSDFTPTVGNRPPSKGKNRTGTIVGVIVGLGLLSILAGVAIFI
                     IRKRRKRYTDDEELLSMDVKPYTFTYSELKSATQDFDPSNKLGEGGFGPVYKGKLNDG
                     REVAVKLLSVGSRQGKGQFVAEIVAISAVQHRNLVKLYGCCYEGDHRLLVYEYLPNGS
                     LDQALFGDKTLHLDWSTRYEICLGVARGLVYLHEEARLRIVHRDVKASNILLDSNLVP
                     KVSDFGLAKLYDDKKTHISTRVAGTIGYLAPEYAMRGHLTEKTDVYAFGVVALELVSG
                     RPNSDENLEDEKRYLLEWAWNLHEKSREVELIDRELTEFNMEEVKRMIGIALLCTQTS
                     HALRPPMSRVVAMLSGDVEVSDVTSKPGYLTDWRFDDTTSSSLSGFQTKETWPSDSLS
                     TSFVAPGSEISPRSADSKPMLGVKINEGR"
     gene            67996..>73337
                     /locus_tag="BRARA_H00010"
                     /db_xref="Phytozome:Brara.H00010"
     mRNA            join(67996..68234,68350..68496,69733..69754,70012..70083,
                     70177..70242,70379..70444,70592..70636,70719..70780,
                     70879..71258,71340..71538,71633..71791,71866..71984,
                     72067..72277,72363..72604,72702..>73199)
                     /locus_tag="BRARA_H00010"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00010"
     CDS             join(68126..68234,68350..68496,69733..69754,70012..70083,
                     70177..70242,70379..70444,70592..70636,70719..70780,
                     70879..71258,71340..71538,71633..71791,71866..71984,
                     72067..72277,72363..72604,72702..73199)
                     /locus_tag="BRARA_H00010"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49195.1"
                     /db_xref="Phytozome:Brara.H00010"
                     /translation="MPTCLHLTVWFILCIFGSIHLVRSQNRTGATTDPDEARALNSIF
                     AAWGKQAPRDWNISGQLCSGVAIGENITIDDKAYNPLIKCDYMTSLSVLDLSFNKLHG
                     PIPASLFNLSQLTHLFLGNNTLNGSLPTQKSQTLSNIDVSYNDLSGIPPSWVNLPNLQ
                     LNLVANNFTLESLDNRVLPGLNCLQKNFPCNRGKALYSDFAINCGGQQIRSASGEVFE
                     REDGALGPASFVVSDEQRWGASNVGLFGGSSNVYIVTLLSQFINTLDSELFQSARLSA
                     SSLRYYGLGLENGGYTVTLQFAEIQIIGSSSNTWRGIGRRRFDIYVQGRLVERDFDIR
                     RTANDSIVRAVEREYKVNVSENYIEIHLFWAGKGTCCIPIQGAYGPLISAVSAKPDFI
                     PTVANKPPSKGNNRTGTILGVIVGLGLLSIIAGVVILIIRKRRKRYTDDEEILNMDVK
                     PYTFSYSELKTATQDFNPSNKLGEGGFGPVYKGNLNDGREVAVKQLSVGSRQGKGHFV
                     AEIVAISTVMHRNLVKLYGCCYEGDHRLLVYEYLPNGSLDQALFGGDKKTLHLDWPTR
                     FEICMGVARGLAYLHEEGSVRIVHRDVKASNILLDSNLVPKVSDFGLAKLYDDKKTHI
                     STKVAGTVYYAMRGHLTEKTDVYAFGIVVLELVSGRGNADESLEGEKRYLLEWAWNLH
                     EKSHQVELIDRELTEFNVEEVKRMIGIALLCTQASHAVRPPMSRVVAMLSGDVEVSEV
                     TSKPIYLPDWRFDDTTRSSFSAFQTKDTGASGSYSTSFVTPAENDFKPMLGVKINEGR
                     "
     mRNA            join(69672..69754,69851..69922,70012..70083,70177..70242,
                     70379..70444,70592..70636,70719..70780,70879..71258,
                     71340..71538,71633..71791,71866..71984,72067..72277,
                     72363..72600,72683..73337)
                     /locus_tag="BRARA_H00010"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00010"
     CDS             join(69735..69754,69851..69922,70012..70083,70177..70242,
                     70379..70444,70592..70636,70719..70780,70879..71258,
                     71340..71538,71633..71791,71866..71984,72067..72277,
                     72363..72600,72683..73199)
                     /locus_tag="BRARA_H00010"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49196.1"
                     /db_xref="Phytozome:Brara.H00010"
                     /translation="MTSLSVLVLRNSNLTGTIPSYIGQFSSLKQVDLSFNKLHGPIPA
                     SLFNLSQLTHLFLGNNTLNGSLPTQKSQTLSNIDVSYNDLSGIPPSWVNLPNLQLNLV
                     ANNFTLESLDNRVLPGLNCLQKNFPCNRGKALYSDFAINCGGQQIRSASGEVFEREDG
                     ALGPASFVVSDEQRWGASNVGLFGGSSNVYIVTLLSQFINTLDSELFQSARLSASSLR
                     YYGLGLENGGYTVTLQFAEIQIIGSSSNTWRGIGRRRFDIYVQGRLVERDFDIRRTAN
                     DSIVRAVEREYKVNVSENYIEIHLFWAGKGTCCIPIQGAYGPLISAVSAKPDFIPTVA
                     NKPPSKGNNRTGTILGVIVGLGLLSIIAGVVILIIRKRRKRYTDDEEILNMDVKPYTF
                     SYSELKTATQDFNPSNKLGEGGFGPVYKGNLNDGREVAVKQLSVGSRQGKGHFVAEIV
                     AISTVMHRNLVKLYGCCYEGDHRLLVYEYLPNGSLDQALFGGDKKTLHLDWPTRFEIC
                     MGVARGLAYLHEEGSVRIVHRDVKASNILLDSNLVPKVSDFGLAKLYDDKKTHISTKV
                     AGTVGYLAPEYAMRGHLTEKTDVYAFGIVVLELVSGRGNADESLEGEKRYLLEWAWNL
                     HEKSHQVELIDRELTEFNVEEVKRMIGIALLCTQASHAVRPPMSRVVAMLSGDVEVSE
                     VTSKPIYLPDWRFDDTTRSSFSAFQTKDTGASGSYSTSFVTPAENDFKPMLGVKINEG
                     R"
     gene            73840..76369
                     /locus_tag="BRARA_H00011"
                     /db_xref="Phytozome:Brara.H00011"
     mRNA            join(73840..74092,74298..74512,74607..74764,74857..75044,
                     75123..75375,75461..75609,75695..75829,75921..76369)
                     /locus_tag="BRARA_H00011"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00011"
     CDS             join(73888..74092,74298..74512,74607..74764,74857..75044,
                     75123..75375,75461..75609,75695..75829,75921..76177)
                     /locus_tag="BRARA_H00011"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49197.1"
                     /db_xref="Phytozome:Brara.H00011"
                     /translation="MAMYLLYESSSGYGLFEAHGLDEIGQNTEAVRSSVSDLSRFGRV
                     VQLTAFHPFESALDALNQVNAVSEGVMTDELRSFLELNLPKVKEGKKPKFSLGTSEPK
                     LGSHILEATKIPCQSNEFVLELLRGVRLHFDRFIKDLKPGDLEKSQLGLAHSYSRAKV
                     KFNVNRVDNMVIQAIFLLDTLDKDINSFAMRVREWYSWHFPELVKIVNDNYLYARVSK
                     MIDDKSKLTEDHIPMLTEVLGDEDKAKEVVEAGKASMGQDLSALDLINVQTFAQKVMD
                     LADYRKKLYDYLVSKMSDIAPNLAALIGEMVAARLISHAGSLTNLAKCPSSTLQILGA
                     EKALFRALKTRGNTPKYGLIFHSSFIGRASAKNKGRIARYLANKCSIASRIDCFADGA
                     TTAFGEKLREQVEERLDFYDKGVAPRKNVDVMKEVIENLQNKDEEGKEAVEASGKKSK
                     KKKAKGEEEEEAVESEKKKKRKMETEEENEKSEKKKKKKSKSAGGDEETDDGLTQSKK
                     KSKKKKSKSEE"
     gene            78606..79894
                     /locus_tag="BRARA_H00012"
                     /db_xref="Phytozome:Brara.H00012"
     mRNA            join(78606..78875,78970..79158,79250..79894)
                     /locus_tag="BRARA_H00012"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00012"
     CDS             join(78696..78875,78970..79158,79250..79642)
                     /locus_tag="BRARA_H00012"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49198.1"
                     /db_xref="Phytozome:Brara.H00012"
                     /translation="MASAASGKVEKGHQLYRDGKYKEALLFYTEALSAAKSKSQKIAL
                     HSNRAACYLKLHDFKQAAEECTWVLELDQKHSGALMLRAQTLVTLKDYHSALFDVTRL
                     LDLNPDSDVYQNLEARLRTQLSLAPIPESEAELEDEDEAQQDTDEQSTRKDESRFESL
                     VSITRDVRNKGEEIVAPKTPEVREDKSKENGSLSNAWQAIPKPKGHSTLDYARWNTVQ
                     NDDSSEDDDSDEDSDEDDQPQYRFRVRTVGVRPVK"
     gene            complement(80392..82385)
                     /locus_tag="BRARA_H00013"
                     /db_xref="Phytozome:Brara.H00013"
     mRNA            complement(join(80392..80704,80801..80863,80936..80986,
                     81069..81153,81251..81314,81403..81592,81670..82385))
                     /locus_tag="BRARA_H00013"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00013"
     CDS             complement(join(80575..80704,80801..80863,80936..80986,
                     81069..81153,81251..81314,81403..81592,81670..82370))
                     /locus_tag="BRARA_H00013"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49199.1"
                     /db_xref="Phytozome:Brara.H00013"
                     /translation="MSNNIVVLDNGGGLIKAGQGGERDPLVVIPNCLFKPLSSKKFIY
                     PPPLSDLDVDIDLTSAAVRRPIDRGYLINPDLQRDIWSHLFSSLLRITPTSSSLLLTE
                     PPLSIPSVQRATDELVFEDFGFSSLYLANPQSLVHLYEASRQPGSILSRTQCSLVVDC
                     GFSFTHAVPVLHNFTLNYAVKRIDLGGKAFTNYLKELVSYRSINVMDQTFLMDDAKEK
                     LCFVSLDLHRDLNLARERRTGNVLKSTYVLPDGVTHTKGYVKDPQSAKSFLTLGLSDG
                     GANTVMDKVDVEKKKADMNKNEIDLTNERFLVPETLFQPADLGMNQAGIAECIVRAVS
                     SCHSYLQPVLYQSIILTGGSTLFPQLKERLERELRPLVPDHFDVKITTQEDPILGVWR
                     GGSLLASSPDFESMCVTKAEYEELGSARCRRRFFH"
     gene            complement(82533..85709)
                     /locus_tag="BRARA_H00014"
                     /db_xref="Phytozome:Brara.H00014"
     mRNA            complement(join(82533..83377,83475..83580,83687..83727,
                     83814..83869,83956..84002,84095..84172,84254..84568,
                     84650..84700,84812..84929,85000..85104,85202..85309,
                     85574..85709))
                     /locus_tag="BRARA_H00014"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00014"
     CDS             complement(join(82791..83377,83475..83580,83687..83727,
                     83814..83869,83956..84002,84095..84172,84254..84568,
                     84650..84700,84812..84929,85000..85104,85202..85299))
                     /locus_tag="BRARA_H00014"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49200.1"
                     /db_xref="Phytozome:Brara.H00014"
                     /translation="MSVLIVTSLGDIVIDLHSSKCPLTCKNFLKLCKIKYYNGCLFHT
                     VQKDFTAQTGDPTGTGLGGDSIYKFLYGEQARFFGDEIHLDLKHSKTGTVAMASAGEN
                     LNASQFYFTLRDDLDYLDGKHTVFGEIAEGLDTLTRINEAYVDAKNRPYKNIRIKHTY
                     ILEDPFEDPTQLADMIPDASPEGKPKEEVEVDVRLEDDWVPMDEQLGAHELEEIIRAK
                     AAHSSAVVLESIGDIPEAEVKPPENVLFVCKLNPVTEDEDLHTIFSRFGTVISADVIR
                     DFKTGDSLCYAFIEFEEKAACEEAYNKMDNALIDDRRIHVDFSQSVSKLWSQFRQKDS
                     QKGKGNGCFKCGSTDHVAKDCVGGGNQASKFIVKDQNRQHGGGEGYDMVFEGDIAERP
                     KREKSHDKDKIRRRSPHGYGEGKRQDRDEGRSPGGYDEGKRRDKDEGRSGRVYGEGKR
                     RDRDEGDTEDKAASKYDGRRDDREDVRERDRRYDDGVSREKKQRERNERESREDEERR
                     RRRRHEEMRDDRWSDKGRRRERRDR"
     gene            139847..144532
                     /locus_tag="BRARA_H00015"
                     /db_xref="Phytozome:Brara.H00015"
     mRNA            join(139847..140193,143599..144532)
                     /locus_tag="BRARA_H00015"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00015"
     CDS             join(139992..140193,143599..144362)
                     /locus_tag="BRARA_H00015"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49201.1"
                     /db_xref="Phytozome:Brara.H00015"
                     /translation="MESEEEKESSISMVEAKLPPGFRFHPKDDELVCDYLMARSLGHN
                     TKQPPPLLLIQVDLNKCEPWDIPKTACVGGKDWYFYSQRDRKYATGLRTNRATATGYW
                     KATGKDRAILRKGKLVGMRKTLVFYQGRAPRGRKTDWVMHEFRLQGSFDPPTLNSPEV
                     QEEDWVLCRVFHKNTQGDNMGSCFDETVSASLPPLMDSYINFDQEPSSYLGHDQHFFT
                     NEQVPCFSNLSQNQTIHSNLTESVSELETPCKNPIPLFTGGSSPAMLPGLDSFSSSDQ
                     MVLKALLSQLTKIDGGIEVKESQSYGEGSSESLLTDIAIPSTAWN"
     gene            complement(<146192..>147160)
                     /locus_tag="BRARA_H00016"
                     /db_xref="Phytozome:Brara.H00016"
     mRNA            complement(<146192..>147160)
                     /locus_tag="BRARA_H00016"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00016"
     CDS             complement(146192..147160)
                     /locus_tag="BRARA_H00016"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49202.1"
                     /db_xref="Phytozome:Brara.H00016"
                     /translation="MAPCIDTSRSTGKALLCQDDDSRFHYINLFPGRISRSPITITSS
                     LVPDFDRDDGDVWFKMLDEAKSDVEQEPVLSSYYHSSITSHRSLESALANILSVKLST
                     LALPSNTLFELFISVLEESPAIIESAKQDLLAAKERDPACVSYVHCFLSFKGFLACQA
                     HRIAHKLWAQDRKILALLIQNRVSEAFAVDIHPGAKIGKGVLLDHATAVVIGETAVVG
                     DNVSILHGVTLGGTGKQCGDRHPKIGDGVLIGAGTCVLGNITIGEGAKVGSGSVVLKD
                     VPPHTTAVGNPARLIGGKENPKMLDKIPGLSMDQTSYLTEWSDYVI"
     gene            150290..154503
                     /locus_tag="BRARA_H00017"
                     /db_xref="Phytozome:Brara.H00017"
     mRNA            join(150290..150669,150741..150919,150997..151101,
                     151174..151245,151350..151497,151635..151717,
                     151944..151999,152088..152224,152342..152432,
                     152526..152591,152683..152905,153032..153133,
                     153265..153350,153416..153538,153670..153739,
                     153832..153923,154008..154112,154211..154503)
                     /locus_tag="BRARA_H00017"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00017"
     CDS             join(150344..150669,150741..150919,150997..151101,
                     151174..151245,151350..151497,151635..151717,
                     151944..151999,152088..152224,152342..152432,
                     152526..152591,152683..152905,153032..153133,
                     153265..153350,153416..153538,153670..153739,
                     153832..153923,154008..154112,154211..154339)
                     /locus_tag="BRARA_H00017"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49203.1"
                     /db_xref="Phytozome:Brara.H00017"
                     /translation="MAVLTSLTRFPSSFLSSNARHLFLSPSSPSFSIKRRFNLFSFKP
                     SRSFAPMSSSSSSAPLQEKITAPYGSWKSPITADIVSGASKRLGGTAVDSRGRLVWLE
                     SRPNESGRGVLVVEGEKEAIDITPKELAVRTLTQEYGGGAFRISDDQLVFSNYKDQRL
                     YTQHILHKDSSPKPITPDYGSPAVTYADGVFDSRFHRYITVREDGRQDTSNPITTIVE
                     VNLSGDTLDEPKVLVSGNDFYAFPRLDPNCERLAWIEWTHPNMPWDKAQLWVGYISEA
                     GNIDKRVCVAGCDPEYVESPTEPKWSPRGELFFVTDRKNGFWNIHKWIESTNEVVSVY
                     PLDAEFAKPLWVFGTNSYEIIECSEEKNIIACSYRQKGKSYLGILDDSKGSCSLLDIP
                     LTDYDNITLGNQCLYVEGASAVLPPSVAKVTLDQHKTKALSSEIVWSSSPDVLKYKAF
                     FSVPELIEFPTEVPGQNAYAYYYPPTNPLYNASMEEKPPLLVKSHGGPTAESRGSLNL
                     NIQYWTSRGWAFVDVNYGGSTGYGREYRERLLRRWGIVDVDDCCGCAKYLVSSGKADV
                     KRLCISGGSAGGYTTLAALAFRDVFKAGASLYGVADLKMLKEEGHKFESRYIDNLVGE
                     EKDFYERSPINFVDRFSCPIILFQGLEDKVVTPDQSRKIYQALKEKGLPVALVEYEGE
                     QHGFRKAENIKYTLEQQMVFFARVVGGFQVADDISPLKIDNFDTSSDA"
     gene            complement(<156504..157108)
                     /locus_tag="BRARA_H00018"
                     /db_xref="Phytozome:Brara.H00018"
     mRNA            complement(join(<156504..156513,156550..156789,
                     156875..157108))
                     /locus_tag="BRARA_H00018"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00018"
     CDS             complement(join(156504..156513,156550..156789,
                     156875..157032))
                     /locus_tag="BRARA_H00018"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49204.1"
                     /db_xref="Phytozome:Brara.H00018"
                     /translation="MNLGELNKVWEIKALKKKPKEEEARKILEKVANQVQPIMTRRKW
                     RVKLLSEFCPTNPRLLGVNVNRGVHVKLRLRRVNHDGDFLSYHQVLDTMLHELCHNAH
                     GPHNASFYKLWDELRKVLSFASSDVFCNGRISC"
     gene            <157402..>159204
                     /locus_tag="BRARA_H00019"
                     /db_xref="Phytozome:Brara.H00019"
     mRNA            <157402..>159204
                     /locus_tag="BRARA_H00019"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00019"
     CDS             157402..159204
                     /locus_tag="BRARA_H00019"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49205.1"
                     /db_xref="Phytozome:Brara.H00019"
                     /translation="MSKARDFLKTETCNEVAAVIDALFKSQESSEYKSARALYECCVA
                     HFADFLTLKLLKAYRNCSTSSLLRFRMIYLLSQATTELRSRNFQFSPSALRDVKPLVI
                     SCLEMEETRESDIKILRRIVSFVAYNVGMLEEGGWEELNGCILGLTDTSPCRAFHVFL
                     DVPAVCDDFITLPVIQRVYDEAELVLLNAERVGVQDWVLAFQTVVKIGVHAADSEMES
                     TLMERIRKLADDAVKKGKGEFVDRGLQDLKTFLARDGTLSKYNKEQRSFVAELAFKIA
                     SCRHESKKERKKVKSEISSVLRKPNMYGHDDDDDDNDHIAGGFEIDWCNHLSTLSSPL
                     EILRIFAVTDLEESSREVAIRRLNLLLSDHTTKKVVIEVSVMRQLQPLLISCLKEDRL
                     SVSDSMFKLLGEVVFHVANEVLSNKEEDTWFDLWDYIVSQCKTQFEKAVYIFQSLTMM
                     LDDMDILIPVIDVLLPEINTRLNPPVQLLLVEDNSCWVLAFVGAFCAAVHLVEVTSHA
                     DSVKEITLKMIDSVRELVERGGMEVGVVRRAFTDLEKVVKKQVKWYSKSDYGFVKGLL
                     SRLYAIKAMKMESRMVLWRINAIVERGVHDDLKE"
     gene            complement(<159382..>160804)
                     /locus_tag="BRARA_H00020"
                     /db_xref="Phytozome:Brara.H00020"
     mRNA            complement(join(<159382..159675,159817..159885,
                     159920..159921,159959..160223,160362..160596,
                     160602..>160804))
                     /locus_tag="BRARA_H00020"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00020"
     CDS             complement(join(159382..159675,159817..159885,
                     159920..159921,159959..160223,160362..160596,
                     160602..160804))
                     /locus_tag="BRARA_H00020"
                     /artificial_location="low-quality sequence region"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49206.1"
                     /db_xref="Phytozome:Brara.H00020"
                     /translation="MAPRKVETGGRDLISSLPDELLSEILYLLPTQTAASTSILSKRW
                     KNLLPLVHNLDFDKSTMVFASLISRTLVLLGDSPIHKFSLEWKSEKAQHLIYPLIYNA
                     LQREVLELHLISPKRQFVPSELFFSKTLVKLTLTLGCFARRNDNLVLDQQVWGSSIKR
                     ITTFYRSCGLDDYSCFIFKTPSLVFLDYSSYVAQDYLVQFDDSLVEARLDIRLWKYYD
                     HVLPLPISYGYQLSKHGERGWQVLPLLLRKSPNLETLIINGLVHKITNLCGDVCVCDH
                     GKMMRSCCLLSCRVKVLKVYGYEGSCGELNQMRHFLKNLRFLKLVKVKVQEQVNYLSL
                     TNDLTKLLSTASSSNCKIQFI"
     gene            complement(164092..165277)
                     /locus_tag="BRARA_H00021"
                     /db_xref="Phytozome:Brara.H00021"
     mRNA            complement(join(164092..164670,164754..165277))
                     /locus_tag="BRARA_H00021"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00021"
     CDS             complement(join(164171..164670,164754..165222))
                     /locus_tag="BRARA_H00021"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49207.1"
                     /db_xref="Phytozome:Brara.H00021"
                     /translation="MSRPLVFFFLFLVLVVPCLSHGGGGDQDDDEAPPAKSSDLKSKS
                     LITVKIACLVIIFVLTFISGVSPYFLKWSQAFLVLGTQFAGGVFLATALMHFLSDADE
                     TFTDLLTAEGESEPSPAYPFAYMLACAGYMLTMLADSVIAHVYSKTPSKDVELQGAEK
                     PNQGLGIGDSILLIVALCFHSVFEGIAIGISETKADAWRALWTITLHKVFAAIAMGIA
                     LLRMIPDRPLFSSIMYSFAFAISSPIGVAIGIVIDATTQGRVADWIFAVSMSLACGVF
                     VYVSVNHLLAKGYLPNKKVNVDEPRFKFLAVLSGVVVIAIVMIWDT"
     gene            complement(167902..170237)
                     /locus_tag="BRARA_H00022"
                     /db_xref="Phytozome:Brara.H00022"
     mRNA            complement(join(167902..168222,168301..168403,
                     168493..168649,168727..168825,168903..169007,
                     169165..169281,169358..169419,169522..169558,
                     169664..169761,169844..170237))
                     /locus_tag="BRARA_H00022"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00022"
     CDS             complement(join(168180..168222,168301..168403,
                     168493..168649,168727..168825,168903..169007,
                     169165..169281,169358..169419,169522..169558,
                     169664..169761,169844..170156))
                     /locus_tag="BRARA_H00022"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49208.1"
                     /db_xref="Phytozome:Brara.H00022"
                     /translation="MASSNAIRSRLVPSLLKLRSRNPRRALFSTEASSSSNPSSKVSS
                     SSQQQSIFSDFPPPNHLPPPPPPEAAAEALGKERKGLKYLSNGLIWAFTGATAAIGYT
                     SYAYTLDEVNEKTKSFRESAMKPPPPALDSSSAIDKYQAMLYSAAIKVPARAIEMYLE
                     LREQVEEHVKGFTEPLSEKLLPDLHPSEQNVVYTLVLDLNETLLYTDWKRERGWRTFK
                     RPGVDAFLEHLGKFYEIVVYSDQMDMYVYPVCEKLDPNGYIRYKLARGATKYENGKHY
                     RDLSKLNRDPKRILYVSGNAFDTSLQPENCVPIKPYKLESDDTALVDLIPFLEYVARN
                     GPADIRPVLASYERKDVAKEFLERSIEYQKRMQGQRQGRLWRR"
     gene            174769..175981
                     /locus_tag="BRARA_H00023"
                     /db_xref="Phytozome:Brara.H00023"
     mRNA            join(174769..174869,174947..175092,175191..175542,
                     175614..175659,175737..175981)
                     /locus_tag="BRARA_H00023"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00023"
     CDS             join(174854..174869,174947..175092,175191..175542,
                     175614..175659,175737..175785)
                     /locus_tag="BRARA_H00023"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49209.1"
                     /db_xref="Phytozome:Brara.H00023"
                     /translation="MGEFEGWNRWVEPAFLLWKPEDPDYERPVYDPEKAKFTAQEELD
                     RMREEVNQSDGFDIDFDYYRCVFNYHRAYLDDVEFGEFGNEPETTGDFLTRLAQKSLE
                     DNNAKEKREFEFVRLVKSNFHFSAGLMFLITFEVIDPYDGKIKPFQARVRYLNDTFTE
                     YIFCRPKPNIGVKYYGNAKTNVAKKQRLESELLYATSMVSSE"
     gene            complement(176528..>178584)
                     /locus_tag="BRARA_H00024"
                     /db_xref="Phytozome:Brara.H00024"
     mRNA            complement(join(176528..176595,176679..176755,
                     176831..177055,177146..177280,177363..177562,
                     178078..178168,178441..>178584))
                     /locus_tag="BRARA_H00024"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00024"
     CDS             complement(join(176726..176755,176831..177055,
                     177146..177280,177363..177562,178078..178168,
                     178441..178584))
                     /locus_tag="BRARA_H00024"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49210.1"
                     /db_xref="Phytozome:Brara.H00024"
                     /translation="MEEEEDDDEVYSYGGGKGYKANKRKTKKKKEKPTQPQKLVPSDD
                     NFPTDLEEGTTQTELDWLTKRNGALRNVTDQGNRPLHMLVGLIDKVDTTGGLQNLEHL
                     RSFMINWGAVLEEDCDCPQLALESKKDSSKPKPVLCTKKKKAKQTRTFKVKDLIILKE
                     VDEKELMRLVNLGPVAVTIDVHTAFSTFKGDGIYTGPTNKCRKLDRHMLLVYGYGTDK
                     LTGIHYWRVQNSAGLTWGMNGYGKIVRQISRGTEANKSLFTSVIYPQLLDHYEGQK"
     gene            complement(193888..196669)
                     /locus_tag="BRARA_H00025"
                     /db_xref="Phytozome:Brara.H00025"
     mRNA            complement(join(193888..194576,194642..194989,
                     195109..195312,195401..195613,195685..195801,
                     195878..196669))
                     /locus_tag="BRARA_H00025"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00025"
     CDS             complement(join(194028..194576,194642..194989,
                     195109..195312,195401..195613,195685..195801,
                     195878..196645))
                     /locus_tag="BRARA_H00025"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49211.1"
                     /db_xref="Phytozome:Brara.H00025"
                     /translation="MMRKGDDRFRAVHEDEPLFITGRRTGRVIAYRVFSASVFFCICW
                     IWLYRVTAPVEVDENRTGLVRFVWLVMLVTEIWFGLYWIVMQSPRWNPVWRFTFTDRL
                     SRRYGDDLPRLDVFVCTADPVIEPPLMVVNTVLSVAALDYPPEKLAVYLSDDGGSELT
                     FYALAEAAEFAKVWVPYCKRFNVEPRSPAAYLTCKASGFDSAETEEVARLYKEMAARI
                     ETAARLGIIPDEARLKYGDGFSQWDSHATRRNHGTILQILVDGRKGNTVTVPTLVYLS
                     REKRPEHHHHFKAGSMNALIRVSSKITCGRIILNLDCDMYSNNSKSARDALCILLDEK
                     EGKKIAFVQFPQCFENLTKNDLYASMMRVGYDVEFNGLDGNGGPLYIGTGCFHRRDVI
                     CGRTYGEVEVEEEEESEYISETEMIKALASCTYEENSQWGKEMGVKYGCPAEDVITGL
                     EIKCRGWKSAYLNPKKKAFVGVAPTNLHQMLVQQRRWSEGNFQVLLSEYSPVWYGQGK
                     IGLGLILGYCCYCLWAPSSVPVLLYSVLTSLCLLKGIPLFPKVWSSWWFIPFGYVTVA
                     ANAYSLVEFLWCGGTLRGWWNDQRMWLYRRTSSFLFGLIDTIKKKLGVSESAFVITAK
                     VAEEEAAERYEKEVMEFGVESPIFLLLGTLGMLNLFCLATAIMRLVMTSREDVQTMGL
                     QFVITGVLVVLNWPLYEGMLLRRDKGKMPMTVTVNSFVLALSACTCVAFL"
     gene            complement(197656..200155)
                     /locus_tag="BRARA_H00026"
                     /db_xref="Phytozome:Brara.H00026"
     mRNA            complement(join(197656..198181,198257..198439,
                     198525..198620,198711..198770,198852..198905,
                     199013..199090,199169..199222,199319..199402,
                     199717..199748,199840..200155))
                     /locus_tag="BRARA_H00026"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00026"
     CDS             complement(join(197897..198181,198257..198439,
                     198525..198620,198711..198770,198852..198905,
                     199013..199090,199169..199222,199319..199402,
                     199717..199748,199840..199894))
                     /locus_tag="BRARA_H00026"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49212.1"
                     /db_xref="Phytozome:Brara.H00026"
                     /translation="MGTASEEAVKQLRTLMEDVDDESLRESYRNIHQGYPTETLLRFL
                     KARDYNVHKSHQMLLDCLQWRTQNEIDNILNKPIVPVELYRGIRDSQLVGLSGYSKEG
                     LPVIAIGVGLSTYDKASVHYYIQSHIQMNEYRDRVVLPSATKKQGRPICTCLKVLDMS
                     GLKLSALSQIKLMTAITTIDDLNYPEKTETYYIVNVPYIFSACWKTIKPLLQERTKKK
                     IQVLKGCGKDELLKVMDYESLPHFCRREGSGSGRHISNGTVDNCFSLDHSFHKELYDY
                     VHQQALVKGSSAPIRHGSVHVRFPEPDTEGTKIFDTLESEFQKLGNDHKT"
     gene            complement(204721..208326)
                     /locus_tag="BRARA_H00027"
                     /db_xref="Phytozome:Brara.H00027"
     mRNA            complement(join(204721..205201,205289..205444,
                     205513..205606,205688..205748,205828..205888,
                     205953..206036,206116..206310,206404..206483,
                     206602..206698,206837..206955,207113..207182,
                     207301..207392,207469..208326))
                     /locus_tag="BRARA_H00027"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00027"
     CDS             complement(join(205052..205201,205289..205444,
                     205513..205606,205688..205748,205828..205888,
                     205953..206036,206116..206310,206404..206483,
                     206602..206698,206837..206955,207113..207182,
                     207301..207392,207469..207619))
                     /locus_tag="BRARA_H00027"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49213.1"
                     /db_xref="Phytozome:Brara.H00027"
                     /translation="MASKLAVDAIETSTKVHFSGFHFDSARSNHMAASAEEQEEEQQH
                     GQPFVIGVAGGAASGKTTVCDMIMQQLHDQRAVVVNQDSFYHNVNEKELARVHDYNFD
                     HPDAFDTEQLLCSMEKLRKGQAVDIPNYDFKSYKNNVFPPRRVNPSDVIILEGILIFH
                     DPRVRDLMNMKIFVDADADVRLARRIKRDTVEKGRDIATVLDQYSKFVKPAFEDFILP
                     TKKYADIIIPRGGDNHVAIDLIVQHIRTKLGQHDLCKIYPNLYVIQSTFQIRGMHTLI
                     RDSKTTKHDFIFYSDRLIRLVVEHGLGHLPFTEKQVVTPTGSVYSGVDFCKRLCGVSV
                     IRSGESMENALRACCKGIKLGKILIHREGDNGQQLRYEKLPSDISERHVLLLDPILGT
                     GNSAVQAIRLLISKGVPESNIIFLNLISAPQGVNVVCKRFPRIKIVTSEIELGLNDEF
                     RVVPGMGEFGDRYFGTDDE"
     gene            209390..210025
                     /locus_tag="BRARA_H00028"
                     /db_xref="Phytozome:Brara.H00028"
     mRNA            209390..210025
                     /locus_tag="BRARA_H00028"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00028"
     CDS             209406..209882
                     /locus_tag="BRARA_H00028"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49214.1"
                     /db_xref="Phytozome:Brara.H00028"
                     /translation="MFSSSIRSIIVTGLHRTPILKSPANPPRLFTSVPRYFHSSSTRF
                     SDSRIAMSSADKTGSNTGAIENRASRIKEKLEKELEPVELVIEDVSYQHAGHAGMKGR
                     GTDEETHFNVKIVSKGFEGMNLVKRHRLVYDLLREELDSGLHALSIVSKTPSESTR"
     gene            210538..212481
                     /locus_tag="BRARA_H00029"
                     /db_xref="Phytozome:Brara.H00029"
     mRNA            join(210538..210779,210940..211138,211223..212481)
                     /locus_tag="BRARA_H00029"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00029"
     CDS             join(210593..210779,210940..211138,211223..212117)
                     /locus_tag="BRARA_H00029"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49215.1"
                     /db_xref="Phytozome:Brara.H00029"
                     /translation="MATIRELSRLIRDHGDEQVWITHYSSKHQILLVGEGDFSFSCSL
                     ATRFRSASNICASSLDSYDEVVRKYKKARSNLETLKRLGASLLHGVDATKLQLHPHLN
                     CRRFDRIIFNFPHAGFHGKETDSSLIKKHRELVFGFLHSASHMVRADGEVHVSHKNKP
                     PFCHWKLEELASKCSLALTQCVAFEKSDYPGYENKRGDGSRCDMPFLLGECSTFKFRV
                     SRVAKEIYAEKLKAREMKERESKWQRPALTFGLSYHQDSNLTQGHDPLVQSRQRTSPL
                     FPYQEHRCSQFEDAIVSSIRATQSPTTFNHVRFQENSKQVRYTERSSRDFPFQPSLHP
                     QEERSFFECSSRFEGVPLDIYVRRMQSTLTQTSFPHLYTGESPERRRQEPLFQSSNRL
                     NGVSHEIYNGERGRSMLTSHSFPHPYTGDHKKEA"
     gene            <213122..>213816
                     /locus_tag="BRARA_H00030"
                     /db_xref="Phytozome:Brara.H00030"
     mRNA            join(<213122..213127,213262..213343,213443..>213816)
                     /locus_tag="BRARA_H00030"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00030"
     CDS             join(213122..213127,213262..213343,213443..213816)
                     /locus_tag="BRARA_H00030"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49216.1"
                     /db_xref="Phytozome:Brara.H00030"
                     /translation="MRQRIVLKMDMSESEKSIKKAMKIASGASGVRSVSIKGQNDQLV
                     IVGEGIDTAELTRELRKKVCHATIVTVQAAPPPPPPPQQQQKQPVQPYLMEHNNEMAP
                     ARRCICEIPNSGYCGFCRSMRETPYQMVASPYPPPVMYGGYREDPDNCRIM"
     gene            <215520..>216041
                     /locus_tag="BRARA_H00031"
                     /db_xref="Phytozome:Brara.H00031"
     mRNA            <215520..>216041
                     /locus_tag="BRARA_H00031"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00031"
     CDS             215520..216041
                     /locus_tag="BRARA_H00031"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49217.1"
                     /db_xref="Phytozome:Brara.H00031"
                     /translation="MKQFSRLLFIFILYLSYVNADSNLITDLCKHCDDPKLCLSSIET
                     RPESGEFAATTNQIEIIAISAASANASSTSAYIKEMLSREDLEPATESTLEDCQKNYQ
                     DAVEQLDDSISAMLLDAHADVDVWLNAAISAIESCSNELESGAGNDAELSQRNKVFFK
                     LCKNALVINKMLT"
     gene            218978..221056
                     /locus_tag="BRARA_H00032"
                     /db_xref="Phytozome:Brara.H00032"
     mRNA            join(218978..219607,219778..219926,220004..220122,
                     220194..221056)
                     /locus_tag="BRARA_H00032"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00032"
     CDS             join(219489..219607,219778..219926,220004..220122,
                     220194..220796)
                     /locus_tag="BRARA_H00032"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49218.1"
                     /db_xref="Phytozome:Brara.H00032"
                     /translation="MTDSAYRVDTISRLAQWRILNLSSSTYRKSDPFKMGLWNWHLSV
                     EKSKMLLNVKLYPEVSSLSRENPPVASFVLRVVSSTGERKAFTHPEVIDKRIKTNEDF
                     LWTIEVPLTGKIIIDVEFLDLKVLSQDSGEFYSIWADGSTQNQSEVTAVTSLGRMLTE
                     SIYTDITINASDGSIGAHRAVLAARSPVFRSMFLHDLKEKELSAINIPDMPLEACRAF
                     LSYIYGNIQNEDFLTHRLALLQAADKYDIADLKDACHMSLVEDIDTKNVLERLQNAYL
                     YQLPELKASCMRYLVKFGKIFEIREEFNVFMQCADRDLISEVFHEVLTTWKGF"
     gene            complement(<222895..>224202)
                     /locus_tag="BRARA_H00033"
                     /db_xref="Phytozome:Brara.H00033"
     mRNA            complement(<222895..>224202)
                     /locus_tag="BRARA_H00033"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00033"
     CDS             complement(222895..224202)
                     /locus_tag="BRARA_H00033"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49219.1"
                     /db_xref="Phytozome:Brara.H00033"
                     /translation="MGPCRPCRLRGSYGAHGTYSLRRPNRPYGRPNIKRKIIRRLPEM
                     EMEMRIPMHVVTEEVLTRMPAKSLMRFKCVSKLWSSLISSPYFKDRFLTVPTRQRPHL
                     FMCLQDVNDHSSSVTLSLVPDANSDDTPSSSSSFVVDHTIPRMRGGYICQNLRGFMCY
                     DLWQKPRIFNPATRQLVTLPPAFNPNTTKGTVSYYFGHDPITDQYKVVCSVGVRLTDT
                     QEVRSHHRVFVLKPGGGGSWRKAYRLPPPDFIPHIAARGGVCINGVIYYLGWTAADSC
                     MLVTFHIRSHDFKMIQVPLPEELPPPAKMKNVCLVEYGGKVTVVDQASLRDKGRLDLW
                     ALEDAANQKWSSKRLVVKPSQLDFVRNTEFVVRGTSRNGKVFLIPTDLVSPFQILCYD
                     LQSNHMRKIDIKGVPDHWFSKDKSTVEVMLMDHSETLMSLMNT"
     gene            complement(<224820..>225026)
                     /locus_tag="BRARA_H00034"
                     /db_xref="Phytozome:Brara.H00034"
     mRNA            complement(<224820..>225026)
                     /locus_tag="BRARA_H00034"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00034"
     CDS             complement(224820..225026)
                     /locus_tag="BRARA_H00034"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49220.1"
                     /db_xref="Phytozome:Brara.H00034"
                     /translation="MCCGRICMLCTCLVLVVVAIGLVFGFGVFKNGYHKIHDTVHLDC
                     DPRLGCNGSSSRRAYGFVPPPNRF"
     gene            230440..234275
                     /locus_tag="BRARA_H00035"
                     /db_xref="Phytozome:Brara.H00035"
     mRNA            join(230440..230702,230799..231040,231119..231209,
                     231308..231356,231451..231542,231643..231750,
                     231865..232410,232493..232634,232716..232783,
                     232859..232993,233084..233301,233391..233777,
                     234205..234275)
                     /locus_tag="BRARA_H00035"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00035"
     CDS             join(230512..230702,230799..231040,231119..231209,
                     231308..231356,231451..231542,231643..231750,
                     231865..232410,232493..232634,232716..232783,
                     232859..232993,233084..233301,233391..233773)
                     /locus_tag="BRARA_H00035"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49221.1"
                     /db_xref="Phytozome:Brara.H00035"
                     /translation="MTVGAGISVSNSDLVVLGHRVLRGVPENVVVTPASGNSLIDGAF
                     IGVSSDQTGSHRVFPLGKLEELRFMCVFRFKLWWMTQRMGTHGKEIPFETQFLIVEAN
                     GGSDLEGDHPASYVVFLPILEGDFRAVLQGNQSNELEICLESGDPTVDQFKGDHLVFV
                     AAGSDPFDVITKAVKAVEQHLQTFSHRERKKMPDMLNWFGWCTWDAFYTNVTASDVKQ
                     GLQSLEAGGIPPKFVIIDDGWQSVSMDDTGVEFNADNAANFANRLTHIKENYKFQKDG
                     REGHRVEDPALSLRHVITDIKSNNSLKYVYVWHALTGYWGGVKPGVSGMEHYESKVSY
                     PVSSPGVMSNQNCESLESITKNGLGLVNPEKVFTFYNDLHSYLASVGIDGVKVDVQNI
                     LETLGAGHGGRVKLAKKYHHALEASISRNFPDNGIISCMSHNTDGLYSAKKTAVIRAS
                     DDFWPRDPASHTIHIASVAYNTLFLGEFMQPDWDMFHSLHPMAEYHAAARAVGGCAIY
                     VSDKPGQHDFNLLRKLVLPDGSILRAKLPGRPTSDCFFSDPVRDNKSLMKIWNLNDFT
                     GVIGVFNCQGAGWCKKEKRYMIHDQQPGTISGYVRTNDVHYLHKVAAFEWTGDSVVYS
                     HLRGELVYLPKGTSLPITLKSREYEVFTVVPVKEYSNGTKFAPVGLIEMFNSGGAIVS
                     LRCDDDGTNCVVKMKLRGSGLVGVYSSVGRPRSVTVDSEEVEYRCDGESGMVTFTLGV
                     PEKELYLWDVVIQL"
     gene            <235120..>237296
                     /locus_tag="BRARA_H00036"
                     /db_xref="Phytozome:Brara.H00036"
     mRNA            join(<235120..235347,235430..235497,235583..235611,
                     235697..235893,236087..236290,236413..236535,
                     236628..236744,236841..236894,236980..237096,
                     237198..>237296)
                     /locus_tag="BRARA_H00036"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00036"
     CDS             join(235120..235347,235430..235497,235583..235611,
                     235697..235893,236087..236290,236413..236535,
                     236628..236744,236841..236894,236980..237096,
                     237198..237296)
                     /locus_tag="BRARA_H00036"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49222.1"
                     /db_xref="Phytozome:Brara.H00036"
                     /translation="MEFDDEAEHRRLFRVETNSPQRKAVFSLEQGGSLPGKTTKNSVI
                     QSFKIVILSNKLNLLLPFGPLAILVHYLTDNKGWFFLLSLLGITPLAERLGYATEQLA
                     CYTGPTVGGLLNATFGNVTELIISIIALKNGMIRVVQLTLLGSILSNMLLVLGCSFFC
                     GGIVFSRKQQVFDKGNAVLNSGMLLIAVMSLLFPTLLHYTHSEVHAASSELVLSRSTS
                     CIMLVAYAAYLFFQLKSQPSFLTESEETWDDDEVPEISKWEAIIWLLIFTAWVSLLSG
                     YLVDAIEGASVSWNVPISFISVILLPIVGNAAEHAGAIMFAMKDKLDLSLGVAIGSSI
                     QISMFAVPFCVVISWMMGEQMDLNFQLFETATLFISVIVVAFFLQEGTSNYFKGLMLI
                     LSYLIVAASFFVHQDPDQG"
     gene            250083..>254139
                     /locus_tag="BRARA_H00037"
                     /db_xref="Phytozome:Brara.H00037"
     mRNA            join(250083..250277,250547..250744,250863..250974,
                     251092..251401,251493..251592,251684..251743,
                     253956..254030,254119..>254139)
                     /locus_tag="BRARA_H00037"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00037"
     CDS             join(250914..250974,251092..251401,251493..251592,
                     251684..251743,253956..254030,254119..254139)
                     /locus_tag="BRARA_H00037"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49223.1"
                     /db_xref="Phytozome:Brara.H00037"
                     /translation="MSSLSALHQPESFPFDRDMSGVEENGALDEIRERRSDFEISEED
                     ERRRSKIGSLKKKAINASTKFTHSLKKRGKKKIDYRFPPVVSIEDVRDEKEESVVLEF
                     RRNLLERDLLPPRHDEYHTLLRFLKARDFNIEKTIQMWEDMLRWRKEYGTDTILEDFE
                     FQELEEVLQYYPQGYHGVLHATVVKQMEITEMLESLRESQLHRRRLFC"
     gene            260135..>262335
                     /locus_tag="BRARA_H00038"
                     /db_xref="Phytozome:Brara.H00038"
     mRNA            join(260135..260293,260437..260604,260727..260813,
                     260977..261111,261195..261305,261385..261476,
                     261555..261660,261750..261836,261922..>262335)
                     /locus_tag="BRARA_H00038"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00038"
     CDS             join(260147..260293,260437..260604,260727..260813,
                     260977..261111,261195..261305,261385..261476,
                     261555..261660,261750..261836,261922..262335)
                     /locus_tag="BRARA_H00038"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49224.1"
                     /db_xref="Phytozome:Brara.H00038"
                     /translation="MSNYQAEEDAAYMDHVDDDMEDVDDDLDDNFHGDDMAASDSDVD
                     EFDYSSNKIADTSAEQARKGKDIQGIPWDRLSITREKYRQTRLDQYKNYENVPNSGNS
                     SGKDCMVTQKGAIFYDFWRNSRSIKSSILHFQLRNLVWATSKHDVYLMSQFLVSQYST
                     LTSGKHEILNVQGHVSPSEKHPGSLLEGFTKTQVSTLAVKDKFLVAGGFQGELICKHL
                     DRPGVSFCSRTTYDDNAITNAIEIYNKPSGALHFTASNNDCGVRDFDMETYQLVNYFR
                     FPWPVNHISMSPDGKLLTIVGDNPEGLLVDPNTGKTLETLAGHLDFSFASAWHPDGLT
                     FSTGNQDKTCRVWDIRNLSKSVAVLRGNLGAIRSIRYTSDGKYMAMAEPADFVHVYDV
                     SKGYETEQEIDFFGEISGISCSPDTEALFIGVWDRTYGSLLEYGRHHNYSYLDSFM"
     gene            263078..263957
                     /locus_tag="BRARA_H00039"
                     /db_xref="Phytozome:Brara.H00039"
     mRNA            263078..263957
                     /locus_tag="BRARA_H00039"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00039"
     CDS             263130..263615
                     /locus_tag="BRARA_H00039"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49225.1"
                     /db_xref="Phytozome:Brara.H00039"
                     /translation="MAATSASALLSPTTFSTVISQKNPNSISFHGLRPLRLGGSSALP
                     KLSTTSGRRSSSSAVVRAELSPSVVISLSTGLSLFLGRFVFFNFQRENVAKQVPEQNG
                     KTHFEAGDDRAKEYVSLLKSNDPVGFNIVDVLAWGSIGHIVAYYVLATSSNGYDPSFF
                     G"
     gene            268775..269834
                     /locus_tag="BRARA_H00040"
                     /db_xref="Phytozome:Brara.H00040"
     mRNA            join(268775..268970,269074..269122,269276..269834)
                     /locus_tag="BRARA_H00040"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00040"
     CDS             join(268920..268970,269074..269122,269276..269622)
                     /locus_tag="BRARA_H00040"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49226.1"
                     /db_xref="Phytozome:Brara.H00040"
                     /translation="MEQTFIMIKPDGVQRGLVGKIICRFEQKGFTLKGLKLITVDRPF
                     AEKHYQDLSAKPFFSGLVDYIISGPVVAMIWEGKNVVLTGRKIIGATNPAASEPGTIR
                     GDFAIDIGRNIIHGSDSVESANKECALWFPDGPVNWQSSLHSWIYE"
     gene            270277..274409
                     /locus_tag="BRARA_H00041"
                     /db_xref="Phytozome:Brara.H00041"
     mRNA            join(270277..270876,270962..271364,271831..271890,
                     272858..272925,273231..273656,273734..273966,
                     274101..274409)
                     /locus_tag="BRARA_H00041"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00041"
     CDS             join(270445..270876,270962..271364,271831..271890,
                     272858..272925,273231..273656,273734..273966,
                     274101..274182)
                     /locus_tag="BRARA_H00041"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49227.1"
                     /db_xref="Phytozome:Brara.H00041"
                     /translation="MSSGGEYNEDRHLLRSTDGDEVVNGRGEGDLDVESQSPAIRNST
                     GGVRNLLKHLDRRFSLSGRRLSFKRLENIRVDRSHHHPSSSSPLSAAGEEDGVDDRDD
                     EYGFDEGNDVLGDSAPPEWALLLIGCLIGVAAGICVAGFNKGVHVIHEWSWAGTPNEG
                     AAWLRLQRLADTWHRILLIPVTGGVIVGMMHGLLEILDQIRQSTSSQGQGVDLLAGIF
                     PVIKAIQAAVTLGTGCSLGPEGPSVDIGKSCANGFALMMENNRERRIALTAAGAASGI
                     ASGFNAAVAGCFFAIETVLRPLLPLTSVLLLFELTKDYRILLPLMGAVGLAIWVPSVV
                     NQDKESDSSEGRNAGRGYSTLSPSHLKTEGIWRRTDNANSLELTVMENPDHKSFLDEE
                     TILDDLKVLRVMPKNYVKVCLGTTLREARNILKDSHQNCLVVVDEDDFLAGILTHGDI
                     RRCLSNKVSPIVDENTCTVSSVCTKKITYRGQERGLITCYPDTTVGVAKELMEARGVK
                     QLPVVKRGEVSHKGKKRKLLGLLHYDSIWTFLRDEMSRRRSINERRKDKYEEVGAANV
                     H"
     mRNA            join(272842..272925,273231..273656,273734..273966,
                     274101..274409)
                     /locus_tag="BRARA_H00041"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00041"
     CDS             join(272848..272925,273231..273656,273734..273966,
                     274101..274182)
                     /locus_tag="BRARA_H00041"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49228.1"
                     /db_xref="Phytozome:Brara.H00041"
                     /translation="MCSVPLTSVLLLFELTKDYRILLPLMGAVGLAIWVPSVVNQDKE
                     SDSSEGRNAGRGYSTLSPSHLKTEGIWRRTDNANSLELTVMENPDHKSFLDEETILDD
                     LKVLRVMPKNYVKVCLGTTLREARNILKDSHQNCLVVVDEDDFLAGILTHGDIRRCLS
                     NKVSPIVDENTCTVSSVCTKKITYRGQERGLITCYPDTTVGVAKELMEARGVKQLPVV
                     KRGEVSHKGKKRKLLGLLHYDSIWTFLRDEMSRRRSINERRKDKYEEVGAANVH"
     gene            277998..283017
                     /locus_tag="BRARA_H00042"
                     /db_xref="Phytozome:Brara.H00042"
     mRNA            join(277998..278350,278478..283017)
                     /locus_tag="BRARA_H00042"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00042"
     CDS             278599..282096
                     /locus_tag="BRARA_H00042"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49229.1"
                     /db_xref="Phytozome:Brara.H00042"
                     /translation="MKLLSLIICFSATLIVMTTHGKRLISDENNSYETALLTAFKQTS
                     VKSDPNNILGNWKHVSGRGSCSWRGVSCSDYGRVIGLDLRNGGLTGTLNLVNLTALTS
                     LQNLYLQGNDFSSGSVSSSSGDGCYLQNLDLSSNSLSDYSMVDYIFSTCTNLVSVNFS
                     NNKLTGKLGSPPSSKALTTVDLSYNILSEDIPESFIPASLKYLDLTHNNFSGDFSDLS
                     FGFCGNLTFLSLSQNNISGDHFPLSLTNCKLLETLNISRNNLVGKIPGGGEYWGIFQN
                     LKHLSLAHNRFSGEIPPELSRLCRTLETLDLSGNSLSGELPPPFAACVSLQSLNLGNN
                     FLSGEFLTTVVSKIQGIAYLYVAYNNISGSVPSSLTNCTNLRVLDLSSNGFTGNLPSG
                     FCSYSPLLEKLLMANNYLSGTVPMELGMCKSLKTIDLSFNALTGPIPNEVWMLPNLSD
                     LVMWANNLTGRIPEGVCVKGGNLETLILNNNLLTGSIPDSISKCTNMIWISLSSNRLT
                     GTIPSGIGYLTKLAILQLGNNSLSGSVPPQLGDCKSLIWLDLNSNNLTGPLPGELASQ
                     AGLVMPGSVSGKQFAFVRNEGGTDCRGAGGLVEFEDIRAERLERFPMVHSCPATRIYS
                     GMTMYTFYANGSMIYFDVSYNSVSGFIPPSYGNMGYLQVLNLGHNRLTGTIPDSLGGL
                     KAIGVLDLSHNDLQGYIPGSLGSLSFLSDLDVSNNNLTGPIPFGGQLTTFPVTRYANN
                     SGLCGVPLRPCGSAPRRPVTAQVHPKKQTVATAVIAGIAFSFMCLVMLVMALYRAWKV
                     QKKEQKREKFIESLPTSGSCSWKLSSVPEPLSINVATFEKPLRKLTFAHLLEATNGFS
                     AETMIGSGGFGEVYKAQLKDGSTVAIKKLIRITGQGDREFMAEMETIGKIKHRNLVPL
                     LGYCKIGEERLLVYEYMKWGSLETVLHEVSRKGGVFLNWAARKKIAVGAARGLAFLHH
                     SCIPHIIHRDMKSSNVLLDENLEARVSDFGMARLVSALDTHLSVSTLAGTPGYVPPEY
                     YQSFRCTAKGDVYSYGVILLELLSGKKPIDPGEFGEDNNLVGWAKQLYREKRGVEILD
                     QELVTEKSGDVELFHYLKIASQCLDDRPFKRPTMIQVMAMFKELKADSAEEDDSLDEF
                     SLKETPLVEESREIRSLKI"
     gene            <315855..>318464
                     /locus_tag="BRARA_H00043"
                     /db_xref="Phytozome:Brara.H00043"
     mRNA            join(<315855..316217,316432..316573,317338..317590,
                     317670..317822,318032..>318464)
                     /locus_tag="BRARA_H00043"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00043"
     CDS             join(315855..316217,316432..316573,317338..317590,
                     317670..317822,318032..318464)
                     /locus_tag="BRARA_H00043"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49230.1"
                     /db_xref="Phytozome:Brara.H00043"
                     /translation="MSDWSGNSIEIWNPPKMSDCDGIVRAMLEQTDNGLNSISQIFPK
                     TNLSTNHQSEQRSSLGERVSSRIRFNVPPLETENIMSPFAVSRSQTNVPSPLIAVSPG
                     FSPSALLQSPKKFSNSFSQHIIQSRVANDGPPEMVESSGGDYATTTIFNNDVPHQPMN
                     FDHMPHHEGFYDIPTEQSVYVPSHESHADLIGAPLVTSFESDEVANETDIMNIISLDS
                     EDEDEDYKEDEEYKEDENVDEEDDSVDELPPRKRRKYEVSDMFGAKRTRKDERVILRM
                     ECEEDNPDDGYQWRKYGRKIVNGNSNPRSYYKCTYGGCNVKKHVERGADDVKLLVVTY
                     DGKHNHPIPTGRSSNRSGPRNRSGFSVSQTPRLGRLPSSSSACQYCYSSLEPHPDMAL
                     LYMTGLSKLQSFPVNHNHGFMYRHDEPIIDRVIPDGTEVYNGMKDRLLPNFGFNF"
     gene            complement(363607..366674)
                     /locus_tag="BRARA_H00044"
                     /db_xref="Phytozome:Brara.H00044"
     mRNA            complement(join(363607..364055,364170..365279,
                     366296..366674))
                     /locus_tag="BRARA_H00044"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00044"
     CDS             complement(join(363752..364055,364170..365279,
                     366296..366549))
                     /locus_tag="BRARA_H00044"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49231.1"
                     /db_xref="Phytozome:Brara.H00044"
                     /translation="MKVGVKLLAVCLCVATVTVVMVQAEDPYFHHVWNVTYGSASPLG
                     VPQQVILINGQFPGPNLNSTSNNNVIVNVFNNLDEPFLITWNGIQHRKNSWQDGTAGT
                     MCPIPPGKNFTYHFQPKDQIGSYFYYPTTAMHRAAGAFGGLRVNSRLLIPVPYADPED
                     DYTVLINDWYTKSHTQLKKFLDSGRTIGRPDGILINGKAGKGDGSDQPLFTLKQGKTY
                     RVRICNVGLKTSLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFGVIVTANQEP
                     KDYYMVASTRFLKKALATTGLLRYEGGKGLASPQLPAAPVGWAWSLNQFRSFRWNLTA
                     SAARPNPQGSYHYGKINITRTIKLVNTQGKIDGKLRYALSGVSHTDPETPLKLAEYFG
                     VADKVFKYDIISDNPTSDQIKNIKIEPNVLNITHRTFIEVVFENHEKSVQSWHLDGYS
                     FFAVAVEPGTWTPEKRKNYNLLDAVSRHTVQVYPKCWAAILLTFDNCGMWNIRSENSE
                     RRYLGQQLYASVLSPEKSLRDEYNMPESSLQCGLVKDKPKINPYAGA"
     gene            369667..372363
                     /locus_tag="BRARA_H00045"
                     /db_xref="Phytozome:Brara.H00045"
     mRNA            join(369667..369954,370586..371692,371893..372363)
                     /locus_tag="BRARA_H00045"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00045"
     CDS             join(369710..369954,370586..371692,371893..372190)
                     /locus_tag="BRARA_H00045"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49232.1"
                     /db_xref="Phytozome:Brara.H00045"
                     /translation="MEGRLLTVLVCLVSTVAIVNAGDPYFFYTWNVTYGTASPLGVPQ
                     KVILINGQFPGPNLNSTSNNNVVVNVFNNLDEPFLLTWSGIQHRKNCWQDGVAGTSCP
                     IPAGQNFTYHFQPKDQIGSYFYYPTTSLHRFAGGFGGLRVNSRLLIPVPYADPEDDYT
                     VLINDWYTSGHTALKNFLDSGRTLGLPNGVLINGKSGKVGGKNEPLFTMKPGKTYKYR
                     LCNVGFKSTLNFRIQNHKMKLVEMEGSHVLQNDYDSLDVHVGQCFSVLVTANQEAKDY
                     YMVASTRFLKKELSTVGVIRYAGSNVQASAELPKTPVGWAWSLNQFRSFRWNLTSNAA
                     RPNPQGSYHYGKINITRSIKLVNTKNVVDGKVRYGFNGVSHVDTETPLKLAEYFQMAE
                     KVFKYDVIKDEPAAQITALTVQPNVLNITFRTFVEIIFENHEKSMESFHLDGYSFFAV
                     ASEPGRWTPEKRKNYNLLDAVSRHTVQVYPKSWSAILLTFDNAGMWNIRSENLERRYL
                     GQQLYVSVLSPEKSLRDEYNIPLNTNLCGIVKGLPLPASYT"
     gene            complement(<372739..>376606)
                     /locus_tag="BRARA_H00046"
                     /db_xref="Phytozome:Brara.H00046"
     mRNA            complement(join(<372739..372857,372931..374044,
                     374135..374262,374750..374787,374868..375083,
                     375164..375325,375414..375592,375672..375778,
                     375965..376120,376215..376298,376408..>376606))
                     /locus_tag="BRARA_H00046"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00046"
     CDS             complement(join(372739..372857,372931..374044,
                     374135..374262,374750..374787,374868..375083,
                     375164..375325,375414..375592,375672..375778,
                     375965..376120,376215..376298,376408..376606))
                     /locus_tag="BRARA_H00046"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49233.1"
                     /db_xref="Phytozome:Brara.H00046"
                     /translation="MERTRSKRVQNLPETVHSLIGLRSHLTSSWVKSVSNIAKNVSSS
                     SEISSTSKEEDDSAFIEEQSIRNQLSTLTVQVNDQNKRRRQILNEFLDLKGNIRVFCR
                     VKPLDSKNMRAPVASDTRNVFIKLTESKRKTYNFDRVFQPDSSQDDVFLEIEPVIKSV
                     MDGYNACIFAYGQTGTGKTFTMEGLPESPGIVPRAIKGLFKQVEESNHKFVIKFSMLE
                     IYMGNLRDLLVSQGTKPIGPIPPSLLIHTNPKGEIDIENLVTRKVNDFDEVFKLYKLG
                     CRNRATAFTNSNSASSRSHCMIRVSITCAGATERRRVRNKIWLVDLGGSERVLKTKAT
                     GRRFDEGKAINLSLSALGDVINSLQRKNAHIPYRNSKLTQVLKDSLGQDSKTLMLVHI
                     GRKEDDLCETICSLDFATRAKNVHLGQEESKEAQEKKETVMMNLQKTMETIEKDRETT
                     LKEIRYLNETLEKLYGKPHVTEEAEEVDETREEIQVTPKLRRNKSRRASDVFCSFMRP
                     TASSNRRLSGADFSPISNSPGFKLRRNSMAHVRSESVCLPMMKNVYDSLCDSSERSVS
                     KSTCAMSQNRTDDAATVYSQDISECDIKLVVSEHKTEVQHTGQGSARKACSKIGIFEK
                     NVNQKTEFSRINSWLRSQSENRSCVLDKKPRRLNKNISLGRSSNGDQTLEDIEESKAG
                     IKHPLLLKDVFELEYMCSADTEDQILSKYPNPNEEDYASLHHLPSFRYDGLSQHIDDA
                     WFGVARSANREQDSPSSGLLLELKQPLPNSQEGLAFVEEVVPLLLRPQGILVERGRGA
                     HTFMQKLEALCYRTLVGVGLIDVSYGSDFFNGLTQ"
     gene            384999..393659
                     /locus_tag="BRARA_H00047"
                     /db_xref="Phytozome:Brara.H00047"
     mRNA            join(384999..385274,385357..385565,386005..386173,
                     386263..386409,386701..386822,386905..387017,
                     387411..387550,387636..387801,387887..388850,
                     389017..389169,389327..389384,389914..390047,
                     390135..390259,390371..390713,390820..391003,
                     391103..391603,391699..393222,393301..393659)
                     /locus_tag="BRARA_H00047"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00047"
     CDS             join(385085..385274,385357..385565,386005..386173,
                     386263..386409,386701..386822,386905..387017,
                     387411..387550,387636..387801,387887..388850,
                     389017..389169,389327..389384,389914..390047,
                     390135..390259,390371..390713,390820..391003,
                     391103..391603,391699..393222,393301..393431)
                     /locus_tag="BRARA_H00047"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49234.1"
                     /db_xref="Phytozome:Brara.H00047"
                     /translation="MGKFEIIEEVEGDRVGTTDYYFDRIGEPLSIKEEDAQYDLENPP
                     SQPLAISERRGLVFIAHSSGFLVGRTKDVIAASKNSDGKGSRVCVQEIALVDVPVGDV
                     RILSLSADDSILAASVDAEIHFFSVDSLLKKDAKPSFSYSPDESGFVKDFRWTRKDKH
                     SYLVLSSNGKLFHGTDSAPPKHVMDGVDAVEWSSKGSYIAVAQDNSLRILSSKFNEKR
                     CIALSFDSWIGDSDEDCVVKVDSIKWIRQNCILLGCFQLIDGMEENYLVQVIRSPDGK
                     ITDGSSNLVALSFSDLFPCSMDDLVPVGVGPHLLFSYVDQCKLAITANRKSIDEHIVL
                     LNWSPGDDESAVSVVDIDRETFLPRIGLQENGDDNMIMGLCVDMVSVEGTVNVRSGGD
                     ELKELPPFCVLACLTLEGKLVMYNVASVSGLPDSSDVDLASSSDIEDAYAPSVGDDLP
                     GQSSEESEQQRKFNFSVQNEQKHLNSENSVSLLPTEQRFPKEEISKKETESVKSSVSG
                     DNNVKQEPYAGKLLQAADGQQSMIPRQFGTSFVQPPSSVGFETKKFAGFGHIFPVPDK
                     PQKDISEQSKSMNFQTRFGSKSTPGLFAFSGPQNASVTPPQNTPAQLWSSGKGVSPPS
                     FGSGLFPSVKDTQQKQPEQTGTGYVNPPTCIRENPVQAIETTRASALSILTPPLGQSQ
                     DADEGVEKIDPLPSIRASQLSLQVKSSFEKSSNHQQHKTPLNAGPLRLEHAMSKQTSN
                     INEMAREMDALLQSIEGPGGFKDSCTSLLTGHIEELEQGLEILAGKCQTCKIITHEQQ
                     GEIQHLLDKTIQVLAKKTYMEGMYKQTSDDQYWQLWNRRRLNPELEAKRQHIVKLNKD
                     LTHQLIELERYFNRLELDRYQDDGGLPLSRRGVPNRSAPSRRVQSLHSLHNTMSSQLA
                     AAEQLSDCLSKQMTFLKIDSPVKKNVKQELFETIGIPYDTSFNSPDAVKANNASSAKN
                     LLLSSIPASINAQSKQRQSSGTKSSDPETARRRRESLDRNWAAFEPPKTTVKRMLLQE
                     QQKSGTNQPIVSSERLRPKVDTQEQSLLRLKDHASPVVSSNKGIMKSFQQNTSEAQST
                     PFKSTRAMPQSNSPFNHSSASASKPSFNWSGNKSNSIASYAEESAPSQSKDTKTPTVF
                     EQTEKKAGGFKLPEGKANMFPDRSAGSVQRPTGAPVQSQFSFNTNSSMPGNRLTFPAA
                     TVSASSSPLSSTSLDSVSTLPTPSSRSLPTSTKDSVSAPTSIPISLASVPQTLSVAPT
                     STVSATGISVPFGKSLTSASLDLNQAATSTPSPSPGPTAGFSFKLPASSPSSPEIVSS
                     STGQSSVVPPSSTASQVSTSLVSATSSPTDSNRLFSSTSSSLTPPITSTAPGVFKFPQ
                     VSTPSSAVSTAEPVSEPKKLETQSSSILSTGSTAEPVAKAATSQTELLPVKSEILTSE
                     TTVTAPVSTSGFLSGFSSATQSSPVSMAPPSFSWPGSSQPQQPSPTPVSFPTSFSTSA
                     SPLGEKKDTVDTQEDEMDEEAPEASPAAELSMSGFGGFGLGSTPNPAAPKSNPFGGSF
                     GNATTATSNLFNLTVPSGELFRPASFSFQNPQPSQPTGFGGFSTTPSQTPTQGGFGQP
                     SQVGVGQQALGSVLGSFGQSRQIGAGLPGATFGSPTGFGGSSPGSGLPNAPASGGFAA
                     AGSSATGGFAAMASTGRGFAGASSSPTGGFAGLASGSGGFGGAAPGGGAGGGFGGVGS
                     GSGGFGSFAPPNSGGFAGASGGGGFGGFGGQGQGQGGGGGFSGFGGNTGGAGGKPSEL
                     FTQMRK"
     gene            393871..>394726
                     /locus_tag="BRARA_H00048"
                     /db_xref="Phytozome:Brara.H00048"
     mRNA            join(393871..394429,394513..>394726)
                     /locus_tag="BRARA_H00048"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00048"
     CDS             join(394266..394429,394513..394726)
                     /locus_tag="BRARA_H00048"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49235.1"
                     /db_xref="Phytozome:Brara.H00048"
                     /translation="MNLGELNNNKVWEIKALKKKAREDEARKILEKVANQVQPIMTRR
                     KWRVKLLSEFCPTNPRLLGVNVNRGVQVKLRLRRVNNDGDFLSYHEILDTMLHELCHN
                     AHGPHNASFYKLWDELRKVLSFA"
     gene            397919..400146
                     /locus_tag="BRARA_H00049"
                     /db_xref="Phytozome:Brara.H00049"
     mRNA            join(397919..398295,398375..398568,398636..398975,
                     399256..399351,399475..400146)
                     /locus_tag="BRARA_H00049"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00049"
     CDS             join(398200..398295,398375..398568,398636..398975,
                     399256..399351,399475..399519)
                     /locus_tag="BRARA_H00049"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49236.1"
                     /db_xref="Phytozome:Brara.H00049"
                     /translation="MMLCGSLRDRIQPWLRDYVKLQSLAVFLIYIQIGCALIGSLGAL
                     YNGVLLINLAIALFALVAIESNSQSLGRTYAVLLFCALLLDISWFILFTEEIWSISVE
                     TYGTLYIFSVRLTMAMEMIGFFVRLSSSLLWFQIYRLGASIVDTSSSLPRETDSDLRN
                     SFLNPPTPAIIDRQCSGAAEEILSGSIYDPAYYTSLFEDAEAQSNMSSPKVNHYSAEY
                     NGLPSAAEASRIKSPGSRSLHAIDEEKGLKKQGTSSSL"
     gene            400305..401991
                     /locus_tag="BRARA_H00050"
                     /db_xref="Phytozome:Brara.H00050"
     mRNA            join(400305..400579,400828..401991)
                     /locus_tag="BRARA_H00050"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00050"
     CDS             400849..401790
                     /locus_tag="BRARA_H00050"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49237.1"
                     /db_xref="Phytozome:Brara.H00050"
                     /translation="MEEEEGAVAYWCHMCSRTVDPLMEAEIKCPFCASGFVEEMAEEE
                     EEEHSPNTNSLLAPILMQVINESSLLTSNQSVDEDAQTEETESGNDVDSQLQEILRRR
                     RARRSVSVMQLLDDGDGDGDRERGSLIVVSGASLSEYFIGPGFEALLQRFTDNDPNRY
                     GTPPAQKEAVEALASVKILEPTLQCSVCLDDFEIGVEAKEMPCEHKFHGECLLPWLEL
                     HSSCPVCRYELPSDETKTETARTQPNGDGGGSESSSFASIQEGSENSDGSHHPEEEEE
                     EDSDDDGDDGVEFSIPWLLSSLFSSSQDSSNPSSGTH"
     assembly_gap    409409..419408
                     /estimated_length=unknown
                     /gap_type="between scaffolds"
     assembly_gap    420152..430151
                     /estimated_length=unknown
                     /gap_type="between scaffolds"
     gene            465791..467985
                     /locus_tag="BRARA_H00051"
                     /db_xref="Phytozome:Brara.H00051"
     mRNA            join(465791..466019,466253..466331,466441..466528,
                     466669..466740,466799..466849,466971..467015,
                     467115..467207,467281..467382,467478..467558,
                     467643..467985)
                     /locus_tag="BRARA_H00051"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00051"
     CDS             join(466255..466331,466441..466528,466669..466740,
                     466799..466849,466971..467015,467115..467207,
                     467281..467382,467478..467552)
                     /locus_tag="BRARA_H00051"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49238.1"
                     /db_xref="Phytozome:Brara.H00051"
                     /translation="MAEQGMEGSQPVDLMKHPSGIIPTLQNIVSTVNLDCKLDLKSIA
                     LQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVCTGAKSEHFSKLAARKYARIVQ
                     KLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHSAFSSYEPELFPGLIYRMKQPKI
                     VLLIFVSGKIVITGAKMREETYTAFENIYPVLTEFRKIQQ"
     gene            complement(468046..470324)
                     /locus_tag="BRARA_H00052"
                     /db_xref="Phytozome:Brara.H00052"
     mRNA            complement(join(468046..468228,468309..468395,
                     468467..468544,468622..468717,468793..468879,
                     468958..469026,469104..469291,469353..469410,
                     469485..469544,469612..469647,469734..469845,
                     470014..470324))
                     /locus_tag="BRARA_H00052"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00052"
     CDS             complement(join(468193..468228,468309..468395,
                     468467..468544,468622..468717,468793..468879,
                     468958..469026,469104..469291,469353..469410,
                     469485..469544,469612..469647,469734..469845,
                     470014..470180))
                     /locus_tag="BRARA_H00052"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49239.1"
                     /db_xref="Phytozome:Brara.H00052"
                     /translation="MASLLGRFCRKLVVPGSAHGSRMISTTACDSEAVKSLNLYSAIN
                     QALHIALETDPRSYVFGEDVGFGGVFRCTTGLAERFGKNRVFNTPLCEQGIVGFGIGL
                     AAMGNRAVVEIQFADYIYPAFDQIVNEAAKFRYRSGNQFNCGGLTIRAPYGAVGHGGH
                     YHSQSPEAFFCHVPGIKVVIPRSPREAKGLLLSSIRDPNPVVFFEPKWLYRQAVEEVP
                     EHDYMIPLSQAEVIREGNDITLVGWGAQLTVMEQACLDAEKEGISCELIDLKTLLPWD
                     KETVEASVKKTGRLLISHEAPVTGGFGAEISATILERCFLKLEAPVSRVCGLDTPFPL
                     VFEPFYMPTKNKILDAIKSTVNY"
     gene            477229..480760
                     /locus_tag="BRARA_H00053"
                     /db_xref="Phytozome:Brara.H00053"
     mRNA            join(477229..477279,477715..477937,478026..478151,
                     478234..478371,478460..478555,478631..478873,
                     478959..479193,479282..479451,479542..479619,
                     479712..479783,479847..479951,480022..480114,
                     480199..480291,480374..480497,480597..480760)
                     /locus_tag="BRARA_H00053"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00053"
     CDS             join(477722..477937,478026..478151,478234..478371,
                     478460..478555,478631..478873,478959..479193,
                     479282..479451,479542..479619,479712..479783,
                     479847..479951,480022..480114,480199..480291,
                     480374..480497,480597..480610)
                     /locus_tag="BRARA_H00053"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49240.1"
                     /db_xref="Phytozome:Brara.H00053"
                     /translation="MASTFTATSSIGSMVAPNAHKTDKKLMNKLSSSSFGRRQNVFPK
                     LRRSSPAVVCAAKELHFNKDGTTIRKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSP
                     RIVNDGVTVAREVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGFIAEGVK
                     VVAAGANPVLITRGIEKTAKALVAELKKMSKEVEDSELADVAAVSAGNNAEIGSMIAE
                     AMSRVGRKGVVTLEEGKSAENALYVVEGMQFDRGYVSPYFVTDSEKMSVEFDNCKLLL
                     VDKKITNARDLVGVLEDAIRGGYPILIIAEDIEQEALATLVVNKLRGTLKIAALKAPG
                     FGERKSQYLDDIAILTGATVIREEVGLSLDKAGKEVLGHAAKVVLTKETSTIVGDGST
                     QDAVQKRVTQIKNLIEQAEQDYEKEKLNERIAKLSGGVAVIQVGAQTETELKEKKLRV
                     EDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKAALDNDEEKVGADIVKRALSYPLK
                     LIAKNAGVNGSVVSEKVLSNDNVKFGYNAATGKYEDLMAAGIIDPTKVVRCCLEHAAS
                     VAKTFLMSDCVVVEIKEPEPVPVGNPMDNSGYGY"
     gene            complement(481030..482852)
                     /locus_tag="BRARA_H00054"
                     /db_xref="Phytozome:Brara.H00054"
     mRNA            complement(join(481030..481974,482102..482333,
                     482424..482852))
                     /locus_tag="BRARA_H00054"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00054"
     CDS             complement(join(481917..481974,482102..482333,
                     482424..482475))
                     /locus_tag="BRARA_H00054"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49241.1"
                     /db_xref="Phytozome:Brara.H00054"
                     /translation="MINCFKDPLHVLMTVLLSTNDDDDGHEEAVVDDHRNREDPKVDA
                     KEDECEVVCPTLTLTSSLRKVDSNKKEKKKVQWVDLMGVKELAEIREFEPSGEDDIDS
                     DGEKNCVCVIL"
     gene            complement(<484134..>485300)
                     /locus_tag="BRARA_H00055"
                     /db_xref="Phytozome:Brara.H00055"
     mRNA            complement(<484134..>485300)
                     /locus_tag="BRARA_H00055"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00055"
     CDS             complement(484134..485300)
                     /locus_tag="BRARA_H00055"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49242.1"
                     /db_xref="Phytozome:Brara.H00055"
                     /translation="MGKNDFLTPKAIANRMKAKGLQKLRWYCQMCQKQCRDENGFKCH
                     CMSESHQRQMQVFGQNQRRVLQGYSEEFEKTFLDLMRRSHRFSRIAATVVYNEYINDR
                     HHVHMNSTEWATLTEFIKYLGKTGKCKVEETPKGWFITYIDRDSETIFKERLKNKRVK
                     SDLAEEEKQEREIQKQIERAKEGEGEGEEKKKGGDFALKSGVVKVGFSLGGGAKQVVT
                     TGESSKRVFEEEEENEREEKKRKKGGDLEKERRSALDELMKEEERKKERMNRKPYWLF
                     QGIVVKVMSKALADKGYYKQKGVVRKVIDDYVGEIEMIDSKHVLRVDQEELETVIPQI
                     GGLVKIVNGAYRGSVAKLLGVDTEKFCAKVQIEKGVYEGRVIKSIEYEDICKLA"
     gene            complement(486172..488883)
                     /locus_tag="BRARA_H00056"
                     /db_xref="Phytozome:Brara.H00056"
     mRNA            complement(join(486172..486481,486579..486815,
                     486919..487128,487361..487627,487738..487902,
                     488139..488546,488661..488883))
                     /locus_tag="BRARA_H00056"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00056"
     CDS             complement(join(486341..486481,486579..486815,
                     486919..487128,487361..487627,487738..487902,
                     488139..488546,488661..488729))
                     /locus_tag="BRARA_H00056"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49243.1"
                     /db_xref="Phytozome:Brara.H00056"
                     /translation="MEDINRKEKLFLNYVPVYIVLPLFGIVAKDNKHAELETTERNLK
                     RLKKEACIDGVMVDVWWGIVESKAPKEYNWNGYKELFKMVKRLELKIHAIMSFHKSSQ
                     NRKTTSLPSWVVQVGKENPDIYYTDRKGFRNDECLSLGVDNEPLFDDVNGTKRTAIQI
                     YSDYMNSFKENMAEFLEDGVIGAIEVGLGPNGELCYPSFPSDQRWTFPGIGEFQCYDK
                     YLKKDFENAAKKAGHSMLDLSKEDFGDYNSKPDETTFFKENGTYTTEKGEFFLEWYSN
                     KLIFHGDQILREANKIFTGLKIDLVAKVSGVHWLYYHPSHGAELTAGYYNLYDRDGYR
                     PIARMLYKRNCFLNFSCLEMKYYNYSEEALSAPEELVKAVLSKAWKEGIEVIGANTSE
                     IKNAEGYNQVLLNARPNGSNPKGKPKLKVHSFMYLRLSETIFSRNYDMFKKFVRNMHA
                     DQDYCGDAEKYAHKVESNSAITIEEILAATKSSGSFKWDEETEAKVDG"
     gene            complement(<489361..>490479)
                     /locus_tag="BRARA_H00057"
                     /db_xref="Phytozome:Brara.H00057"
     mRNA            complement(<489361..>490479)
                     /locus_tag="BRARA_H00057"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00057"
     CDS             complement(<489361..490479)
                     /locus_tag="BRARA_H00057"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49244.1"
                     /db_xref="Phytozome:Brara.H00057"
                     /translation="MSSETKDWDRQKIERSFPLLLGNILSIKPSKKGGEDKLIWLKHK
                     SGAYTTKTRYYSAREKHQQQLDNNSEATITQEWLNEVWKITTAPKLKLFIWKIKHGAL
                     PVGDRLEARHILTGAKCTHCGSDETITHLFFQCPFALRVWELVPFSGGFAPLSQNSFN
                     EEWQRLLQLTVLPPVGLGRCPLAPWIIWSIWSARNQKIFQQRSFTAQETILKAMVDAK
                     EWQDAQSFELPLILRKPHPQDTLAVEITCRSDAAWKKETHTAGMAWSFSRNQSERISS
                     HSQSSAFVISSIMAEGLAMLAAVEHAIDLQMRSVVFKSDSLQLVAAIADGTGISELHG
                     ILSDIYFLSQCFDVVSFRFCRCELLCFEDTLAKKALSDF"
     gene            complement(<493462..>495126)
                     /locus_tag="BRARA_H00058"
                     /db_xref="Phytozome:Brara.H00058"
     mRNA            complement(join(<493462..494411,494448..>495126))
                     /locus_tag="BRARA_H00058"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00058"
     CDS             complement(join(493462..494411,494448..495126))
                     /locus_tag="BRARA_H00058"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49245.1"
                     /db_xref="Phytozome:Brara.H00058"
                     /translation="MARRLSYAEKGKNIASKGSPPRKGRVILPDFDNSELLKRHELTL
                     IGRVTNPKAQRLWSLIPFLGDLWKCSSRPVGSDLGQGRFQFQFASDEDLEKVLDNGPY
                     HFAKWMFIIQRWEPTVSPNFPSQIPFWIQVQDVPEHLWNEAILRGIGADIGTFDCWEI
                     TASKARLRCYINGLQPLIFQTTLEFRNGDEVNAVLVYEKLEKFCKICYRLDHEREDCP
                     QNPSPKMKRELPPHKKLDHPHDENLPRKDETRQSSGFMRDARRAGTGLHHYSHRNSED
                     RRPYETSRRVENYSYSRTRNYSPSHRSHSSQVSQRQNGPRWVDSGRRLPAPEASHSRV
                     PENSITREKEHTFPSNSLLHSSAQRTERNSSPQARHQRTSQNPNLPINISLEAINDAR
                     EELREVMIQYVNVADPSESAARRERMRYAEEHGETEEVIRNMVIAATATATPETRTGN
                     EDQPSAERVPALARLVPAHPVTIPTDDSERVPAKKRLGRPPLNKNKKQTNPLGVTAGQ
                     TSKKRKLLRSGYHLKDAVLPLLQQEELLQIERLQ"
     gene            498110..499935
                     /locus_tag="BRARA_H00059"
                     /db_xref="Phytozome:Brara.H00059"
     mRNA            join(498110..499435,499560..499935)
                     /locus_tag="BRARA_H00059"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00059"
     CDS             join(498151..499435,499560..499723)
                     /locus_tag="BRARA_H00059"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49246.1"
                     /db_xref="Phytozome:Brara.H00059"
                     /translation="MALECPFSHLSKPHNVFRRDSPQLFRCYVCNEESKEYSESYYCS
                     TCKKESHIGCYKFQPQIKQHPYHPSHPLTLVITPNSNSLIPNSWPDEEVISPLDENLG
                     GCKCCRRQLQDRYYHCSICKFSINATCAINPPLLTIVPKKSHEHMAFTLFPRRISLPC
                     DACGVLLDKGSDHVYTCLSSNYIAHRKCISSLPCVIKITRHIHRLQHTPSLFSPNADT
                     SGFACGVCHKPVDVNYGQYSCIKGCHYAVHSKCATRKDVWDGKELKGVREEQEKDGVV
                     ELFQRIDDETILHCNHEHHLKYSGENNDVCDGNKYCQACLLLIVDSDSLYSCMKCNFI
                     LHEACALLPRKIAHPLHKHPLTLLPFPTNLYLIQFKVFVEGMFKCSGCHQRGCGFMYR
                     CTEKGCRFQLDVRCASLEESFIHGSHGHPLFLSLNKGTHSHFVTEKKVQEVVNTGVSY
                     VKQHYIQVNGSIHVTFVESLFMLLVCWGKRYT"
     gene            513722..516147
                     /locus_tag="BRARA_H00060"
                     /db_xref="Phytozome:Brara.H00060"
     mRNA            join(513722..514140,514363..514449,514539..514802,
                     514875..515039,515130..515183,515258..515404,
                     515486..516147)
                     /locus_tag="BRARA_H00060"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00060"
     CDS             join(513967..514140,514363..514449,514539..514802,
                     514875..515039,515130..515183,515258..515404,
                     515486..515863)
                     /locus_tag="BRARA_H00060"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49247.1"
                     /db_xref="Phytozome:Brara.H00060"
                     /translation="MGAAHLSREKVARGFLVCFWLWGLFSLSYAARSGVSKQKFEVKK
                     HLNRLNKPAVKSIQSPDGDIIDCVPITKQPAFDHPFLKDHKIQMKPNYHPEGLFDDNK
                     VSSTTKSKDKEPHIPQLWHRYGKCAEGTIPMRRTKEDDVLRASSVKRYGKKKHRTVPL
                     PKSAEPDLINQSGHQHAIAYVEGDKYYGAKATINVWEPKIQQQNEFSLSQIWLLGGSF
                     GQDLNSIEAGWQVSPDLYGDNNTRLFTYWTSDAYQATGCYNLLCSGFIQINSDIAMGA
                     SISPVSGYRNSQYDISILIWKDPKEGHWWMQFGNGYVLGYWPSFLFSYLTESASMIEW
                     GGEVVNSQADGHHTSTQMGSGRFPEEGFSKASYFRNIQVVDSSNNLKAPKGLGTFTEQ
                     SNCYDVQPGNNDDWGHFFYYGGPGKNENCP"
     gene            complement(516427..518184)
                     /locus_tag="BRARA_H00061"
                     /db_xref="Phytozome:Brara.H00061"
     mRNA            complement(join(516427..516661,516763..516840,
                     516926..517196,517280..517500,517694..517749,
                     517926..518184))
                     /locus_tag="BRARA_H00061"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00061"
     mRNA            complement(join(516427..516661,516763..516840,
                     516926..517196,517280..517510,517694..517749,
                     517926..518184))
                     /locus_tag="BRARA_H00061"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00061"
     CDS             complement(join(516611..516661,516763..516840,
                     516926..517196,517280..517491))
                     /locus_tag="BRARA_H00061"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49248.1"
                     /db_xref="Phytozome:Brara.H00061"
                     /translation="MEEVKGQRGNGTTDADFVLQWGERKRVRCMKVKKDQSRKSSDCL
                     SNKRKLISRAVSSERGSPSRHLNRPNKVVESPGNVRRSFVASPEKEDRYYTTRGSMGV
                     DESGKIIKEPVKETKKHVWPKLFITLSNKEKEEDFLAMKGCKLPQRPKKRAKLVQKTL
                     LLVSPGTWLSDLCKERYEVREKKTSKKRPRGLKAMGSMESDSE"
     CDS             complement(join(516611..516661,516763..516840,
                     516926..517196,517280..517491))
                     /locus_tag="BRARA_H00061"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49249.1"
                     /db_xref="Phytozome:Brara.H00061"
                     /translation="MEEVKGQRGNGTTDADFVLQWGERKRVRCMKVKKDQSRKSSDCL
                     SNKRKLISRAVSSERGSPSRHLNRPNKVVESPGNVRRSFVASPEKEDRYYTTRGSMGV
                     DESGKIIKEPVKETKKHVWPKLFITLSNKEKEEDFLAMKGCKLPQRPKKRAKLVQKTL
                     LLVSPGTWLSDLCKERYEVREKKTSKKRPRGLKAMGSMESDSE"
     gene            complement(<520585..>520941)
                     /locus_tag="BRARA_H00062"
                     /db_xref="Phytozome:Brara.H00062"
     mRNA            complement(<520585..>520941)
                     /locus_tag="BRARA_H00062"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00062"
     CDS             complement(<520585..520941)
                     /locus_tag="BRARA_H00062"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49250.1"
                     /db_xref="Phytozome:Brara.H00062"
                     /translation="MTINHTIFECPTALQCWALSNIPSSLGLFPCNSLYSNIDFLLFR
                     AKETGVRSEALAAFPWIAWYIWKARNKKIFKDKDITPMDSMQLAVKEAASWTLAQRIP
                     EDTEGDSDKQRRTRHKT"
     gene            524702..525143
                     /locus_tag="BRARA_H00063"
                     /db_xref="Phytozome:Brara.H00063"
     mRNA            524702..525143
                     /locus_tag="BRARA_H00063"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00063"
     CDS             524777..524953
                     /locus_tag="BRARA_H00063"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49251.1"
                     /db_xref="Phytozome:Brara.H00063"
                     /translation="MAMKMMVVFMVVAVAFSAVGQAAAATVDAPAPSPTSDAAMFVPA
                     LFASVVALASGLLF"
     gene            complement(526045..528760)
                     /locus_tag="BRARA_H00064"
                     /db_xref="Phytozome:Brara.H00064"
     mRNA            complement(join(526045..526437,526534..526691,
                     526907..527161,527343..527442,527574..527662,
                     527743..528198,528525..528760))
                     /locus_tag="BRARA_H00064"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00064"
     CDS             complement(join(526155..526437,526534..526691,
                     526907..527161,527343..527442,527574..527662,
                     527743..528198,528525..528680))
                     /locus_tag="BRARA_H00064"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49252.1"
                     /db_xref="Phytozome:Brara.H00064"
                     /translation="MAKGDDALARKKNKSNRKKMNRKNDSATVSTRIAAIIAAKKRRQ
                     TGKRSMCQGMCFSLPTPEDPFNEKLGKVDIAKKKKKKAKAKTRDALSVNKSLRQAKKP
                     SRLSIGGPPKFLMLCLSDIESSFHQLEKPLFTSTWGIEFWKSFHSGKDVVETSGTSST
                     LEQIAWIVSTATDAISTREKDEENPLSNSPFLLYLVPSQSKAAQVRSVCKALKRLGVH
                     AVSLHNGAELDHQISGLKSLEPEFLVSTPERLLEIVALKGVDISGVSLLVIDELGSLC
                     ASGYLDAVKSIKQAISSEHRSIVFNDSFSASYIPAVQSLLGRSVNRLSLSDSVASQAS
                     CIIQTVNVCASEKKKLQKFSEVLDSTTSSRGINIVAKEESFRKLTALLKLKGLSVVIA
                     NSEPTIIPAITKRGGQLAYLIDIEQFDSTGMNNFETVLLPDFVPSFQTYVEILTSMAR
                     DSVRGVLHSFVTEEEDVSGLAGSLVNVLEDCGQCVPDSWRNLSASMSD"
     gene            complement(<530044..>530472)
                     /locus_tag="BRARA_H00065"
                     /db_xref="Phytozome:Brara.H00065"
     mRNA            complement(<530044..>530472)
                     /locus_tag="BRARA_H00065"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00065"
     CDS             complement(530044..>530472)
                     /locus_tag="BRARA_H00065"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49253.1"
                     /db_xref="Phytozome:Brara.H00065"
                     /translation="LSTGHRTSKWGSPQWCLYCGEPDETRDYLFFACPYTYTLWLKVV
                     GNLFGAEPDPDWGINILCLQTGTYDRITFILLRMVLQVTIYYIWKERNGRRHNNTAKP
                     VDQLARIVDKAMRNRISSTRYFRKPKFRDLLCRWFGAHLT"
     gene            complement(533469..535836)
                     /locus_tag="BRARA_H00066"
                     /db_xref="Phytozome:Brara.H00066"
     mRNA            complement(join(533469..534014,534113..534205,
                     534304..534474,535001..535078,535238..535395,
                     535758..535836))
                     /locus_tag="BRARA_H00066"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00066"
     mRNA            complement(join(533469..534020,534113..534205,
                     534304..534474,535001..535078,535238..535395,
                     535758..535836))
                     /locus_tag="BRARA_H00066"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00066"
     CDS             complement(join(533699..534014,534113..534205,
                     534304..534474,535001..535078,535238..535383))
                     /locus_tag="BRARA_H00066"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49254.1"
                     /db_xref="Phytozome:Brara.H00066"
                     /translation="MRGRSYTLSPSPPRGHGRRGRSPSPSPRGGGRYRARSSLFVCQL
                     SRDCREGDLRKSFKQFGPLKDIHLPRDHRTGYQRRFGFVQFEDPADAAEAKDHMDGYV
                     LLGRKMAVEFAENNRKTPTKMRAKQRGDGRFRDRRRSSPRYHSRSPMSSRSPSPYRRR
                     HSRKEGYDRRRRSYSRSPASNGSRGRSASPATSKSRSISRSPRRSISRSPRRRSISRS
                     PRRNKSSSLRRRRSNTPIPASRNRSRRPRRIRSKTPVPPARSRSPRGEQ"
     CDS             complement(join(533699..534020,534113..534205,
                     534304..534474,535001..535078,535238..535383))
                     /locus_tag="BRARA_H00066"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49255.1"
                     /db_xref="Phytozome:Brara.H00066"
                     /translation="MRGRSYTLSPSPPRGHGRRGRSPSPSPRGGGRYRARSSLFVCQL
                     SRDCREGDLRKSFKQFGPLKDIHLPRDHRTGYQRRFGFVQFEDPADAAEAKDHMDGYV
                     LLGRKMAVEFAENNRKTPTKMRAKQRGDGRFRDRRRSSPRYHSRSPMSSRSPSPYRRR
                     HSSRRKEGYDRRRRSYSRSPASNGSRGRSASPATSKSRSISRSPRRSISRSPRRRSIS
                     RSPRRNKSSSLRRRRSNTPIPASRNRSRRPRRIRSKTPVPPARSRSPRGEQ"
     gene            541246..542845
                     /locus_tag="BRARA_H00067"
                     /db_xref="Phytozome:Brara.H00067"
     mRNA            join(541246..541482,541605..541943,542023..542845)
                     /locus_tag="BRARA_H00067"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00067"
     CDS             join(541332..541482,541605..541943,542023..542687)
                     /locus_tag="BRARA_H00067"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49256.1"
                     /db_xref="Phytozome:Brara.H00067"
                     /translation="MATESICLNPLSFARLTKNPSNQFRKRRNLSCRTRRSRFGAICS
                     KTSDYQDYQSYARPLRLLPAEEVKVSIAKNPSLTVAKSQSLYMVKLQTSNVFGSGISD
                     MNARVLLCLIDDKGDSLLQTIPETLSSNDESFKFQRGSVDEFTFLGPELGKIRAFWIS
                     LESGQWRLGGVSLWVVKGPVPGVTNVEDAYCYRYDFEVDDILLGESSDLSMVELRPSR
                     ITELTDSHQISSSSAQNLDRTDVSNEQSMEEYANLKLSLLLYDALLILLGSSLVSFSL
                     GENSAIAFFFGGTVGFLYLLLLQRSVDELQAPGSSSSSQNSSQILSGRVKIPVLSLAL
                     AIGLSVLAVRGYNPTAFAVTPRDIVVGTLGFLVCKVAVVLAAFKPLKDGS"
     gene            544668..546744
                     /locus_tag="BRARA_H00068"
                     /db_xref="Phytozome:Brara.H00068"
     mRNA            join(544668..544980,545177..546744)
                     /locus_tag="BRARA_H00068"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00068"
     CDS             join(544915..544980,545177..546418)
                     /locus_tag="BRARA_H00068"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49257.1"
                     /db_xref="Phytozome:Brara.H00068"
                     /translation="MDLSSQRQSPNGSRGFRLQAPLVDSVSCYCRVDSGLKTVVEARK
                     FVPGSKLCIQPDINPNAHRRSKNSKRERTRIQPPLLPGLPDDLAVACLIRVPRSDHRK
                     LRLVCKRWYRLASGNFFYSQRKLLRMSEEWVYVFKRDRDGKISWNTFDPVSQHPQPLP
                     PVPREYSEAVGFGCAVLSGCHLYLFGGKDPLRGSMRRVIFYNARTNKWHRAPDMLRKR
                     HFFGCCVINNCLYVAGGECEGIQRTLRSAEVYDPNKNRWSFVADMSTAMVPLIGVVYD
                     KKWFLKGLGSHQQVMSEAYDPESNSWSPVSDGMVTGWRNPCTSLNGRLYGLDCRDGCK
                     LRVFDETTDSWNKFMDSKVHLGNSKALEAAALVPLNNKLCIIRNNMSMSLVDVSNPDK
                     NNPRVWENIAVKGQSKGILSNIWSSIAGRAVKSHIVHCQVLQA"
     gene            complement(556225..557849)
                     /locus_tag="BRARA_H00069"
                     /db_xref="Phytozome:Brara.H00069"
     mRNA            complement(join(556225..556539,556749..556859,
                     557429..557849))
                     /locus_tag="BRARA_H00069"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00069"
     CDS             complement(join(556397..556539,556749..556859,
                     557429..557768))
                     /locus_tag="BRARA_H00069"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49258.1"
                     /db_xref="Phytozome:Brara.H00069"
                     /translation="MEKSTRTLMIITIVITSMLVGFGSSDLDQDREECTDQLIALSPC
                     LPYVGGNAKAPTKDCCGGFDQVITKSEKCVCILVKDKDDPNLGLKFNATLAAHIPTLC
                     HITAPNITKCISLLHLSPNSTLAKEFESLGRIEYEGKTNSTSPSHNVKDGTGGGKAEQ
                     VKSTGEKKSWLAVELLIFALFSHLLFIIPSFTSSSFI"
     gene            complement(564491..569700)
                     /locus_tag="BRARA_H00070"
                     /db_xref="Phytozome:Brara.H00070"
     mRNA            complement(join(564491..565046,565160..565322,
                     565404..565606,565696..565833,565949..566035,
                     566112..566184,566277..566471,566556..566632,
                     566894..566965,567281..567441,567524..567710,
                     567798..567917,568001..568084,568178..568371,
                     568483..568650,568735..568965,569058..569145,
                     569226..569387,569478..569700))
                     /locus_tag="BRARA_H00070"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00070"
     CDS             complement(join(564915..565046,565160..565322,
                     565404..565606,565696..565833,565949..566035,
                     566112..566184,566277..566471,566556..566632,
                     566894..566965,567281..567441,567524..567710,
                     567798..567917,568001..568084,568178..568371,
                     568483..568650,568735..568965,569058..569145,
                     569226..569387,569478..569591))
                     /locus_tag="BRARA_H00070"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49259.1"
                     /db_xref="Phytozome:Brara.H00070"
                     /translation="MESQDSDEPMQKKPHLLDPVSPTATAPNSSPSHPVAKSVDATVL
                     QLQNQKLVQQLDLQKKRMYDVETKIHELHLNQSSYDDQLISVNRLWNQLVDDLVLLGV
                     RAGANQEALKYLDIADKKRGSVPPCAADEMFLCRLLQVDSIGASNSDEVVRKVEEALS
                     LRHSSTVELMGVFENTIATQRTKAESISQNLQAVKSAEDATVQLSNINDLMKEEARNL
                     REMIDALNARHKEQTEQIQAYVSSHSTDQSELKHLKGELEEIKAELEENRRKLINLKM
                     QKDAACEGHVTSSPAVANGSVSPEKPVDKTKLRELKDSIDEIKIVAEGRLSELQAAQE
                     YNLSLSRQCEDIENELKDDQYIYSSRLYNLIKEQLHHWNDDVDRYKLLSEAAQAERSF
                     VMRREKDLNQREESLEAAKQKITSVGSRIEVLEQKLQSCIVEKNGLELETEEAIQDSE
                     RQDIKREFITMASTLSKEMEMMEAQLKRWKNTAHDALDLRQQAQSLRVSLSNKADEQK
                     GLENKCAEQMAEIKSLKALIEKLLKEKLELQNLASIYTRECNDERGLAEIKESQRKAQ
                     AQAEELKNVLDEHFLELRVKAANETETACQERLATAKAEIAELRTQLDVSEREVLELK
                     EGIKVKEQEAEALIAEMETVGQAYEDMQTQNQHLLQQVAERDDYNIKLVSESVKTKHA
                     YNTHLSEKQVMEKQLQNVNASVETLKARIAHSEEQMKGCFAEAYKLIQEDRHLVLSLE
                     TAKGELADAEKEFRWIKSAVSSSEKEYEQISRRTDEIKLELDDERSEKKKLEEELMEL
                     NKELEELGSESVEAATLRLQEEVKNCKNILKCGVCFDRPKEVVIMKCFHLFCKQCIQR
                     SLEIRHRKCPGCGTAFGQSDVRVVKM"
     gene            complement(574991..576459)
                     /locus_tag="BRARA_H00071"
                     /db_xref="Phytozome:Brara.H00071"
     mRNA            complement(join(574991..575489,575849..576459))
                     /locus_tag="BRARA_H00071"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00071"
     CDS             complement(join(575071..575489,575849..576359))
                     /locus_tag="BRARA_H00071"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49260.1"
                     /db_xref="Phytozome:Brara.H00071"
                     /translation="MGTLVGHVLPGLAFLALGLWHLFNNIKLFCLRPNIFYSSIWFPV
                     SKIRYLELYFIMFSSSASISMELFVGPTKHQPFDSDGTIPSNHLHNFEHSFISMSFLV
                     YAVLALVLDRARPRAAASEGLTILAAAAAFSQELLLFHFHSTDHVGFEGQYHLILQLI
                     IFVSLLTTLMGVALPKSFLVSLVRSSSIVFQGVWFIFLGCMLYTPSLIPKGCFIYVED
                     GHQLVNCSTQEALHRAKALVNLEFSCLFVINTICVVTLFLIMDRNYGGNIEYSSLTTN
                     YQRGQYDEEQQHFETQKMSFVQMGKLVDHEDKM"
     gene            complement(<588276..>588818)
                     /locus_tag="BRARA_H00072"
                     /db_xref="Phytozome:Brara.H00072"
     mRNA            complement(<588276..>588818)
                     /locus_tag="BRARA_H00072"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00072"
     CDS             complement(588276..588818)
                     /locus_tag="BRARA_H00072"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49261.1"
                     /db_xref="Phytozome:Brara.H00072"
                     /translation="MGSRAGHILPGFAFLALGLWHLFNNIKLFCLRPNTFISSPWFPV
                     SKIRHLELYFMMFSASASISMELFIGPRRHHPFDSDGTIPSNHLQNVEHSSISMAFLV
                     YAVSALVLDRARPRAAASEGLTILAAAAAFTQQLLLFHFHSADHMGVEGQYHFIVQLI
                     IFVSLITTLTTFILRIYVFY"
     gene            606997..607741
                     /locus_tag="BRARA_H00073"
                     /db_xref="Phytozome:Brara.H00073"
     mRNA            606997..607741
                     /locus_tag="BRARA_H00073"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00073"
     CDS             607018..607587
                     /locus_tag="BRARA_H00073"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49262.1"
                     /db_xref="Phytozome:Brara.H00073"
                     /translation="MTKLILFLAVQISLLIAISSAGDDGEHFARTIDRKLLGLHKKEK
                     LTHFKVYWHDILSGPNPSSIRIQPPVANSTTYFGGITMIDNALTSKVEMNSTLIGQAQ
                     GFYAGAAQKELGFFMAMNFAFKTGKYNGSTITILGRNTAMSEVREMPIIGGSGLFRFA
                     RGYVEARTKWLNFQNGDATVEYSCYVLHY"
     gene            complement(609151..610763)
                     /locus_tag="BRARA_H00074"
                     /db_xref="Phytozome:Brara.H00074"
     mRNA            complement(609151..610763)
                     /locus_tag="BRARA_H00074"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00074"
     CDS             complement(609376..610626)
                     /locus_tag="BRARA_H00074"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49263.1"
                     /db_xref="Phytozome:Brara.H00074"
                     /translation="MGCCLSKKPSPIPLSSGDVKSPDPVKPDVNKPTKPVIELPVKPA
                     IEIQESPYPGVEEAKPIISEKVEKEEENATSKDVSASVAVEKSSVRTSSCTKEEVDAI
                     LIQCGKLSRSNSTRRYSGSKRSFDFDQNERTHGGGGGGDVEDERRKTPQRNRDRGRVE
                     RANGSPRERRRRTPSRERERERGGGAGGSRRASRSPAKRSEQATNPSGSLVISSNIKF
                     VTVPATDPSSKRVTVKRSIGEACRTAAMTNVQPRRKALGEIDQNATKGDKKKKMIKRE
                     NEDKKLTTPQVISRSRSLRRSRDFDFSPETLLLQSSEQDMKSSYTELLLKDIKDFHGK
                     SSNDDEEEDPFSRLPSCVTKACSIVEAVADLNSSSSDLNQFRFGSTVKKADLVEPSFE
                     KYVTVRRGCCSLEEQESCGSNNLT"
     gene            <611960..>612491
                     /locus_tag="BRARA_H00075"
                     /db_xref="Phytozome:Brara.H00075"
     mRNA            join(<611960..612093,612224..>612491)
                     /locus_tag="BRARA_H00075"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00075"
     CDS             join(611960..612093,612224..612491)
                     /locus_tag="BRARA_H00075"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49264.1"
                     /db_xref="Phytozome:Brara.H00075"
                     /translation="MVPYEKEYLSSDTIANESTSDGDWTSNYIQEYLNILKFIGLPNH
                     KYTCRKQSSHSEDSIVTQRKHPSINVMQALIPLRLSYATTVNKIQGKSLKQVALYLPG
                     RVFSHNQIYVALSRVISREGLKNTKQISRRR"
     gene            <614574..>615153
                     /locus_tag="BRARA_H00076"
                     /db_xref="Phytozome:Brara.H00076"
     mRNA            join(<614574..614675,614705..614845,614884..>615153)
                     /locus_tag="BRARA_H00076"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00076"
     CDS             join(614574..614675,614705..614845,614884..615153)
                     /locus_tag="BRARA_H00076"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49265.1"
                     /db_xref="Phytozome:Brara.H00076"
                     /translation="MAKLIFFLAVQIIFLAAVSSAGDDGEDFARTIDTKLTHFKVYWH
                     DILSGPKPSSIRIKPPVTNSTSYFGGVTMFDNALTATGQGFYSGAAQKEFSFLVGMNF
                     AFKTGKYNGSTITILGRNPVLSKVREMPIVGGSGLFRFARGYVEARTKLLNLKNGDAI
                     VEYSCYVLHY"
     gene            complement(616204..617416)
                     /locus_tag="BRARA_H00077"
                     /db_xref="Phytozome:Brara.H00077"
     mRNA            complement(join(616204..616531,616992..617113,
                     617209..617416))
                     /locus_tag="BRARA_H00077"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00077"
     CDS             complement(join(616512..616531,616992..617113,
                     617209..617363))
                     /locus_tag="BRARA_H00077"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49266.1"
                     /db_xref="Phytozome:Brara.H00077"
                     /translation="MASSKVCRLSSKIHSLTQRLSKTTNVHASSIPSPLKSSLPSAAT
                     SRINQSFRRLPVELSSCVSLFPLHSAVASARLVSSLSAESMSWGLVPQGISMPL"
     gene            <622919..625469
                     /locus_tag="BRARA_H00078"
                     /db_xref="Phytozome:Brara.H00078"
     mRNA            join(<622919..623093,623172..623326,623394..623488,
                     623579..624342,624412..624572,624638..624714,
                     624791..624938,625014..625163,625253..625469)
                     /locus_tag="BRARA_H00078"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00078"
     CDS             join(622919..623093,623172..623326,623394..623488,
                     623579..624342,624412..624572,624638..624714,
                     624791..624938,625014..625163,625253..625342)
                     /locus_tag="BRARA_H00078"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49267.1"
                     /db_xref="Phytozome:Brara.H00078"
                     /translation="MIRGKHEKRPSSNGTEKVLVAVKASREISKTALVWALTHIVHPG
                     DCITLVVVVTSRNAGRKLWTLPKFAGDCASVHRKPHSDAIPEIRSDLTDTCSQMILQL
                     HDVYDPNKVNVRIKIVSGSPCGAVASEAKESQATWVVLDKHLKQEVKRCIDELQCNIV
                     AIKRSQAKVLRLNLVGSPTTKDAVKENKSRSLGSVGAVVTTPLSSPEVGTPFTGTEAG
                     TSSVASSDLGTSSPIFTAEVKKDDTNAAQETKISRRSDSETSGNIRGAVSLSRNAPPV
                     PPPLCSICQHKAPVFGKPPRFFSYKELELATKGFSQSNFLAEGGFGSVHRGVLPEGQI
                     VAVKQHKLASTQGDVEFCSEVEVLSCAQHRNVVMLIGFCIEQSRRLLVYEYICNGSLD
                     AHLYGRHKDTLEWPARQKIAVGAARGLRYLHEECRVGCIVHRDLRPNNILITHDYEPL
                     VGDFGLARWQPDGELGVDTRIIGTFGYLAPEYTQSGQITEKADVYSFGVVLIELITGR
                     KAMDISRPKGQQCLTEWARSRLEEYAVEELVDPKLEKRYSETEIICMIHTASLCIRRD
                     PHVRPRMSQVLRLLEGDMAVNERFSGRLSTERSQRSVR"
     gene            complement(<625928..>626421)
                     /locus_tag="BRARA_H00079"
                     /db_xref="Phytozome:Brara.H00079"
     mRNA            complement(join(<625928..626167,626206..626314,
                     626363..>626421))
                     /locus_tag="BRARA_H00079"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00079"
     CDS             complement(join(625928..626167,626206..626314,
                     626363..626421))
                     /locus_tag="BRARA_H00079"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49268.1"
                     /db_xref="Phytozome:Brara.H00079"
                     /translation="MTNYSTIPTSSHPSPPIDLEPNLVYFRANYVIAVLVILFLSLIY
                     HPTSLLVLAILVPLVVFNRQSDDRTVMICLSVLTVVMLLFTHATANVLGAMLTAVVLV
                     LVHAAVRRSDNLFLDEEAVAASEYSGLTSYPSS"
     gene            complement(652942..654473)
                     /locus_tag="BRARA_H00080"
                     /db_xref="Phytozome:Brara.H00080"
     mRNA            complement(join(652942..653415,654034..654228,
                     654300..654473))
                     /locus_tag="BRARA_H00080"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00080"
     CDS             complement(join(653117..653415,654034..654228,
                     654300..654348))
                     /locus_tag="BRARA_H00080"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49269.1"
                     /db_xref="Phytozome:Brara.H00080"
                     /translation="MSEEGPKLFTNKPKKKDIIAQLKHVEANGTTVVPPSNPAAAAAA
                     SYTMGGAPPPPPPPKESFARRYKYMWPLLLTVNLAVGGYLFFRTKKKDIDEPASEEIA
                     PKSGSVAAAPVTIEKPVSSAVVVKAREPIPEKQQRELFKWMLEEKRKVKPQNAEEKKR
                     IDEEKAILKQFIGSKTIPTL"
     gene            complement(657607..660571)
                     /locus_tag="BRARA_H00081"
                     /db_xref="Phytozome:Brara.H00081"
     mRNA            complement(join(657607..657877,657980..658213,
                     658290..658516,658599..658684,658768..658860,
                     658946..659100,659185..659346,659422..659601,
                     660003..660262,660423..660571))
                     /locus_tag="BRARA_H00081"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00081"
     CDS             complement(join(657831..657877,657980..658213,
                     658290..658516,658599..658684,658768..658860,
                     658946..659100,659185..659346,659422..659601,
                     660003..660262,660423..660478))
                     /locus_tag="BRARA_H00081"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49270.1"
                     /db_xref="Phytozome:Brara.H00081"
                     /translation="MSRYDSRTGDSTSYRDRRSDTGFGGASGYGSSASKRESSSVGDE
                     SPKKPDLDGLTPFEKNFYVESPSVAAMTEAEVEEYRKKREITVEGRDIPKPVKSFRDV
                     GFPDYVLEEVKKAGFTEPTPIQSQGWPMALKGRDLIGIAETGSGKTLSYLLPAIVHVN
                     AQPILAPGDGPIVLVLAPTRELAVQIQQEASKFGSSSKIKSTCIYGGVPKGPQVRDLQ
                     KGVEIVIATPGRLIDMMESNNTNLRRVTYLVLDEADRMLDMGFDPQIRKIVSHIRPDR
                     QTLYWSATWPKEVEQLSKKFLYNPYKVIIGSSDLKANRAIRQIVDVISESQKYNKLVK
                     LLEDIMDGSRILVFLDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFRSGK
                     SPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYSFFTAAN
                     ARFAKELVSILEEAGQKVSHELASMGRSTAPPPPGLGGFRDRGSRRAWS"
     gene            660862..663053
                     /locus_tag="BRARA_H00082"
                     /db_xref="Phytozome:Brara.H00082"
     mRNA            join(660862..661109,661181..661311,662143..662232,
                     662458..662510,662651..662753,662833..663053)
                     /locus_tag="BRARA_H00082"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00082"
     mRNA            join(660862..661109,661184..661311,662143..662232,
                     662458..662510,662651..662753,662833..663053)
                     /locus_tag="BRARA_H00082"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00082"
     CDS             join(660884..661109,661181..661311,662143..662232,
                     662458..662510,662651..662753,662833..662961)
                     /locus_tag="BRARA_H00082"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49271.1"
                     /db_xref="Phytozome:Brara.H00082"
                     /translation="MAMVSAASSGLVRAALDTKPKKLRYNPNAPRNVKRNPNSTTSFV
                     PPSSPSSSPAATVLTTTSVSVSDLLKRPASKEDIGGDEDSCVGYEKWFPSPPKVGKPR
                     SVFNAASLAYIGDSIYEIYARRHFLFPPLSIEEYNDRVRAVVRCEAQYALLHKLLDED
                     FLTKDEREILRWGKNVGSVKTRSTRRAGVAVYNKASSLETLIGYLYLANGKRLEEIMQ
                     KLGFSSSSSTEIMVKEAKHKLSALK"
     CDS             join(660884..661109,661184..661311,662143..662232,
                     662458..662510,662651..662753,662833..662961)
                     /locus_tag="BRARA_H00082"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49272.1"
                     /db_xref="Phytozome:Brara.H00082"
                     /translation="MAMVSAASSGLVRAALDTKPKKLRYNPNAPRNVKRNPNSTTSFV
                     PPSSPSSSPAATVLTTTSVSVSDLLKRPASKDIGGDEDSCVGYEKWFPSPPKVGKPRS
                     VFNAASLAYIGDSIYEIYARRHFLFPPLSIEEYNDRVRAVVRCEAQYALLHKLLDEDF
                     LTKDEREILRWGKNVGSVKTRSTRRAGVAVYNKASSLETLIGYLYLANGKRLEEIMQK
                     LGFSSSSSTEIMVKEAKHKLSALK"
     gene            <667283..>679312
                     /locus_tag="BRARA_H00083"
                     /db_xref="Phytozome:Brara.H00083"
     mRNA            join(<667283..667514,667632..668031,678604..>679312)
                     /locus_tag="BRARA_H00083"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00083"
     CDS             join(667283..667514,667632..668031,678604..679312)
                     /locus_tag="BRARA_H00083"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49274.1"
                     /db_xref="Phytozome:Brara.H00083"
                     /translation="MMMNKDMLYNHQQQHGEENMSNLTSASGDHASVSSGNRTETSGS
                     NFHYNTNPNQQQEEQCLAPQPSQKKKRNQPGNPDPEAEVLALSPKTLMATNRFICEIC
                     NKGFQRDQNLQLHKRGHNLPWKLKQRSNKDVIRKKVYVCPEPNCVHHHPSRALGDLTG
                     IKKHFFRKHGEKKWKCDKCSKKYAVQSDWKAHAKTCGTKEYKCDCGTLFSRAFCDALA
                     EESARAIPNPILIQSSSPHQTQHNINFSSSSQNITSHNNNPHGHDELPMKQEEPHHHF
                     HNIPPWLISSNPNPNGNNANYFPLASSSASFHHSSPAMSATALLHKAAQMGRTKSTAT
                     PEEEEERVDDYYNTMAASMMTSPSEHGFGFQDYYMMNQHPHHHHGVGEAFDGGFIAVD
                     EKNDVGDDGGGETRDFLGLKSLMSDNEMLSFANNLGNCINTSASEQQERYSHQD"
     assembly_gap    668595..678594
                     /estimated_length=unknown
                     /gap_type="between scaffolds"
     gene            complement(679162..>679975)
                     /locus_tag="BRARA_H00084"
                     /db_xref="Phytozome:Brara.H00084"
     mRNA            complement(join(679162..679600,679689..>679975))
                     /locus_tag="BRARA_H00084"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00084"
     CDS             complement(join(679597..679600,679689..679975))
                     /locus_tag="BRARA_H00084"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49273.1"
                     /db_xref="Phytozome:Brara.H00084"
                     /translation="MSQSFVFLYFLFFLSFFLLSSHCSPSQKKERSGERQFTPTCSLL
                     WILGGIRRRSPIRPKLPPSLRSLSHRSSDINSYDEDDDYFATTAPPPQPLSR"
     gene            complement(<680636..>680991)
                     /locus_tag="BRARA_H00085"
                     /db_xref="Phytozome:Brara.H00085"
     mRNA            complement(join(<680636..680787,680919..>680991))
                     /locus_tag="BRARA_H00085"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00085"
     CDS             complement(join(<680636..680787,680919..680991))
                     /locus_tag="BRARA_H00085"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49275.1"
                     /db_xref="Phytozome:Brara.H00085"
                     /translation="MALSKLQSVVLLVICSLLVTSQSRGLSENTEHRSDCVYKGPCKT
                     YQECKSRCGPPNFPPTTIASCQVRAHGTICC"
     gene            complement(684338..689545)
                     /locus_tag="BRARA_H00086"
                     /db_xref="Phytozome:Brara.H00086"
     mRNA            complement(join(684338..684797,684886..685014,
                     685093..685188,685579..685746,685818..685994,
                     686069..686207,686289..686424,686900..687068,
                     687152..687390,687492..687715,687802..688107,
                     688636..688859,689064..689106,689203..689545))
                     /locus_tag="BRARA_H00086"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00086"
     mRNA            complement(join(684338..684797,684886..685014,
                     685093..685188,685579..685746,685818..685994,
                     686069..686207,686289..686424,686900..687068,
                     687152..687390,687492..687715,687802..688107,
                     688636..688859,688997..689106,689203..689545))
                     /locus_tag="BRARA_H00086"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00086"
     CDS             complement(join(684597..684797,684886..685014,
                     685093..685188,685579..685746,685818..685994,
                     686069..686207,686289..686424,686900..687068,
                     687152..687390,687492..687715,687802..688107,
                     688636..688829))
                     /locus_tag="BRARA_H00086"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49277.1"
                     /db_xref="Phytozome:Brara.H00086"
                     /translation="MRMLKVATCNLNQWAMDFECNMKNIKASIVQAKAAGAAIRLGPE
                     LEVTGYGCEDHFLELDTVTHAWDCLKELLLGDWTNDILCSIGMPVIKGAERYNCQVLC
                     MNKRIIMIRPKMCLANDGNYRELRWFTAWKQRGELEEFHLPIEISEALSQESVPFGYG
                     YIQFIDTAVAAEVCEELFSPVPPHAELALNGVEVFMNASGSHHQLRKLDIRLNAFMGA
                     THARGGVYMYSNQQGCDGGRLYYDGCACIVVNGDVVAQGSQFSLKDVEVITSQVDLDA
                     VASLRGSISSFQEQASCKVKVSSVYVPCRLTQSFNLKMTLSSPKKIMYHFPQEEIAFG
                     PACWLWDYLRRSGASGFLLPLSGGADSSSVAAIVGCMCQLVVKEIANGDEQVKTDAKR
                     IGNYTNGEFPTESKEFAKRIFYTVFMGSENSSEATKMRAKQLADEIGAWHLDVCIDGV
                     VSAVLTLFQTVTGMRPRYKVDGGSNVENLGLQNIQARMRMVLAFMLASLLPWVHSKPG
                     FYLVLGSSNVDEGLRGYLTKYDCSSADINPIGSISKQDLRLFLRWAATNLGYQSLAEI
                     EAAPPTAELEPIRSDYSQLDEVDMGMTYEELSVYGRMRKIFRCGPVSMFKNLCYKWGT
                     KLSPAEVAEKVKYFFKYYSINRHKMTVLTPSYHAESYSPEDNRFDLRQFLYNSKWPYQ
                     FKKIDEIVDGLNGDSVAFPGEEASYGKEVGVVAANSGDPSAGL"
     CDS             complement(join(684597..684797,684886..685014,
                     685093..685188,685579..685746,685818..685994,
                     686069..686207,686289..686424,686900..687068,
                     687152..687390,687492..687715,687802..688107,
                     688636..688829))
                     /locus_tag="BRARA_H00086"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49278.1"
                     /db_xref="Phytozome:Brara.H00086"
                     /translation="MRMLKVATCNLNQWAMDFECNMKNIKASIVQAKAAGAAIRLGPE
                     LEVTGYGCEDHFLELDTVTHAWDCLKELLLGDWTNDILCSIGMPVIKGAERYNCQVLC
                     MNKRIIMIRPKMCLANDGNYRELRWFTAWKQRGELEEFHLPIEISEALSQESVPFGYG
                     YIQFIDTAVAAEVCEELFSPVPPHAELALNGVEVFMNASGSHHQLRKLDIRLNAFMGA
                     THARGGVYMYSNQQGCDGGRLYYDGCACIVVNGDVVAQGSQFSLKDVEVITSQVDLDA
                     VASLRGSISSFQEQASCKVKVSSVYVPCRLTQSFNLKMTLSSPKKIMYHFPQEEIAFG
                     PACWLWDYLRRSGASGFLLPLSGGADSSSVAAIVGCMCQLVVKEIANGDEQVKTDAKR
                     IGNYTNGEFPTESKEFAKRIFYTVFMGSENSSEATKMRAKQLADEIGAWHLDVCIDGV
                     VSAVLTLFQTVTGMRPRYKVDGGSNVENLGLQNIQARMRMVLAFMLASLLPWVHSKPG
                     FYLVLGSSNVDEGLRGYLTKYDCSSADINPIGSISKQDLRLFLRWAATNLGYQSLAEI
                     EAAPPTAELEPIRSDYSQLDEVDMGMTYEELSVYGRMRKIFRCGPVSMFKNLCYKWGT
                     KLSPAEVAEKVKYFFKYYSINRHKMTVLTPSYHAESYSPEDNRFDLRQFLYNSKWPYQ
                     FKKIDEIVDGLNGDSVAFPGEEASYGKEVGVVAANSGDPSAGL"
     gene            689203..690995
                     /locus_tag="BRARA_H00087"
                     /db_xref="Phytozome:Brara.H00087"
     mRNA            join(689203..689441,689655..690123,690198..690260,
                     690334..690417,690508..690566,690666..690995)
                     /locus_tag="BRARA_H00087"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00087"
     CDS             join(689677..690123,690198..690260,690334..690417,
                     690508..690566,690666..690723)
                     /locus_tag="BRARA_H00087"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49276.1"
                     /db_xref="Phytozome:Brara.H00087"
                     /translation="MDQFSGGGNWSMIPNVQAQGNFGTPTNQDHLFLQQQQQPQQFHH
                     PQQQQTQQQFQPQQQQQEMQFQQFQQQQQFIQQQQFHHQQHRLLHSPQQPQSSLQSPP
                     PQQTVVHTPQSMMHTPQQQQQLVHTPQQSVQTPQQHQSLASHFHLYPLVEKLSDAVET
                     GTRDQNSDALVSELNGHFDKCQQLLNSISGSLGSKTTMTVDGQKRNLEESEQLLQQRR
                     DLIMEYRKSIEDLVKIEP"
     gene            692208..693751
                     /locus_tag="BRARA_H00088"
                     /db_xref="Phytozome:Brara.H00088"
     mRNA            join(692208..692328,692706..692791,692921..693132,
                     693323..693376,693461..693751)
                     /locus_tag="BRARA_H00088"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00088"
     CDS             join(692755..692791,692921..693132,693323..693376,
                     693461..693505)
                     /locus_tag="BRARA_H00088"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49279.1"
                     /db_xref="Phytozome:Brara.H00088"
                     /translation="MSDLEVQVPTAFDPFADANAEDAGAGAGTKEYVHIRVQQRNGRK
                     SLTTVQGLKKEYSYTKILKDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQA
                     GLVKKDNIKIHGF"
     gene            694488..>697274
                     /locus_tag="BRARA_H00089"
                     /db_xref="Phytozome:Brara.H00089"
     mRNA            join(694488..694712,694885..696746,696817..696927,
                     697022..>697274)
                     /locus_tag="BRARA_H00089"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00089"
     CDS             join(694909..696746,696817..696927,697022..>697274)
                     /locus_tag="BRARA_H00089"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49280.1"
                     /db_xref="Phytozome:Brara.H00089"
                     /translation="MARRSRIRSRIKKSHFYTFRCLRPKTLDDQGPHVINGPGYTRIV
                     HCNQPHLHLATKLLRYRSNYVSTTRYNMLTFLPKCLYEQFHRVANFYFLVAAILSVFP
                     LSPFNKWSMIAPLVFVVGLSMGKEALEDWRRFMQDVGVNSRKACVHKGHGEFGRRMWK
                     KLRVGDVVRVDKDEFFPADLLLLSSSYEDGICYVETMNLDGETNLKVKRCLDATLALE
                     KDESFQSFSGIIKCEDPNPNLYTFVGNLECDGQVYPLDPNQILLRDSKLRNTTYIYGV
                     VVFTGHDTKVMQNSTKSPSKRSSIEKRMDYIIYTLFALLLFVSFISSLGFAVMTKVQM
                     GNWWYLRPDRPESLTNPKNPLYAWVVHLITALLLYGYLIPISLYVSIELVKVLQASFI
                     NQDLQLYDSESGTPAQARTSNLNEELGQVDTILSDKTGTLTCNQMDFLKCSIAGTSYG
                     VRASEVELAAAKQMAMDLEEQGDEITNVPMSTVRTQRYTKLASRTSSDFELETVITAS
                     DEKDRKQTTGIKGFSFEDNRLMDDNWVNEPNPDEILMFFRILAVCHTAIPEVDEDTGK
                     CTYEAESPDEVAFLVASREFGFEFTKRTQTSVFIAERFSPSGQPVDREYKVLNLLDFT
                     SKRKRMSAIIRDEEGQILLLCKGADSIIFERLSKKGKDYLGATTKHLNEYGEAGLRTL
                     ALGYRKLDEAEYSEWNSEFHKAKTSVGADRDELLEKVSDMMEKELILVGATA"
     assembly_gap    702060..712059
                     /estimated_length=unknown
                     /gap_type="between scaffolds"
     assembly_gap    723732..733731
                     /estimated_length=unknown
                     /gap_type="between scaffolds"
     gene            758465..759800
                     /locus_tag="BRARA_H00090"
                     /db_xref="Phytozome:Brara.H00090"
     mRNA            758465..759800
                     /locus_tag="BRARA_H00090"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00090"
     CDS             758716..759639
                     /locus_tag="BRARA_H00090"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49281.1"
                     /db_xref="Phytozome:Brara.H00090"
                     /translation="MDPWDKTNSLDHHHHRRQDHRHPSFSSTLLDQIYNSIDSSSAVN
                     RRAVAGDSVRSRNLKTAEPVFFKHWSSSSSSDSSGFSSSESDSFYRRSRSSRSPPEIC
                     HPKPIRTTVERLERPNNNNNNNNNNKVKSKALKMYSDLKRVKQPISPGGRLATFINSI
                     FTGNTKKPNKTATSSSTTCSSASSFSKSCLSKTPSSSEKSKRSVRFCESTRQRQNFDT
                     LESRVMEENRRVIEAAKELIRTYQKNKDVVNIIGKEEEDDEEDDDDGASCASSDLFEL
                     DHLSVIGIDSYREELPVYETTRFHTNRIISR"
     gene            781438..794783
                     /locus_tag="BRARA_H00091"
                     /db_xref="Phytozome:Brara.H00091"
     mRNA            join(781438..781704,781798..781965,782063..782152,
                     782751..782887,782967..783057,783160..783242,
                     783390..783496,783819..783971,784386..784450,
                     784719..784803,784881..784959,785035..785143,
                     785291..785350,785467..785585,786078..786456,
                     786558..786745,786846..786918,787658..787808,
                     787879..788051,788147..788491,788785..788952,
                     789032..789325,789795..789971,790224..790487,
                     790884..790982,791064..791248,791545..791880,
                     792232..792385,792469..792579,792792..792959,
                     793078..793204,793485..793643,793723..793835,
                     793906..793965,794401..794783)
                     /locus_tag="BRARA_H00091"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00091"
     CDS             join(781522..781704,781798..781965,782063..782152,
                     782751..782887,782967..783057,783160..783242,
                     783390..783496,783819..783971,784386..784450,
                     784719..784803,784881..784959,785035..785143,
                     785291..785350,785467..785585,786078..786456,
                     786558..786745,786846..786918,787658..787808,
                     787879..788051,788147..788491,788785..788952,
                     789032..789325,789795..789971,790224..790487,
                     790884..790982,791064..791248,791545..791880,
                     792232..792385,792469..792579,792792..792959,
                     793078..793204,793485..793643,793723..793835,
                     793906..793965,794401..794583)
                     /locus_tag="BRARA_H00091"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49282.1"
                     /db_xref="Phytozome:Brara.H00091"
                     /translation="MEGSSSSSLASKSDGELEEMLDRMLTRLALCDDSKLEALVSKLL
                     PLTISSLSSQSPAVRNKVLEILSHVNKRVKHHHEIGLPLLELWKLYTDPAASPMVRNF
                     AIVYVEMAFERAPAKEREDIAPKTLENVSKFPQQHQEIILRIAIKVIGECHASRISDD
                     VSVKYSTLIASQDKEIFLDFCLHMLLYQPPPQGGGCPPGLSVFQVNRITGKQELKGDM
                     LTKRKLGILNVIGTMDLPGESVYPLYIAASVDSQEPVAKRGEELLKKKASVTNLDDPK
                     LIKRLFLLFNGTTATEHATPEHSVAPGNIALKMKLMSGFCRSIAAANSFPATLQCIFG
                     CMYGSGTTLRLKQMGMEFTVWVFKHGKIDQLKLMGPVILNAILKMLDGTGSEADALSR
                     ETKTFSFQAIGLIAQRLPQLFREKTEMAVRLFNALKLETQSLRSTIQEAIISLAAAYK
                     DSPEKILKDLEVLLLENSLAEQNEARFCALRWATSLYDSQHCPSLYICMLSAADMKLD
                     IRELALEGLFLKEEGRSIVSNHDHKYPKFVEMLEYILKQQPKLLDSSEMRSQKLLFPS
                     QVYVVMIKFLVKCFEIQMEEINTQAVGTEFLSSAQRMCLLLEHSLAFEGSAELHACAS
                     KALVSVGSYLPEMVEVYCSQKVVWLRRLLSHTDLSTRESASRLLGMASCALSDAESCS
                     LLSELIASVSQPPQKLRFEAHHGGLCAVGYVSAHCLYRIPAVSEAVVQNAVKCLVDVV
                     NSETAPLASVAMEALGHIGICGPLPLLVNDSSPGTQVLEVLQEKLSKLLSGDDIKSVQ
                     KIALSLGHICSNEMSSSHLKIALDLLFSLSRSKAEEILFAAGEALSFLWGGVPVTADM
                     ILKTNYTSLSTDSNFLMREVKSLSKKLSDAKTGDEDSRVTTRETISGKLFDTLLYSSR
                     KDERCAGTVWMLSLIMYCGQHPSIQLMLPKIQEAFSHLLGDQNELTQELASQGMSIVY
                     ELGDSSMKQSLVDALVNTLTGTSKRKRAIKLDEETEVFQEGTIGESPSGGKISTYKEL
                     CNLANEMGQPDLIYKFMDLANHQASLNSKRGAAFGFSKIAKQAGDALRPHLRLLIPRL
                     IRYQYDPDKNVQDAMAHIWKALIQDPKKAVDEHLNHIFDDLLVQCGSRLWRSREASCL
                     ALADIIQGRKFDQVGEHLKRLWIAAFRAMDDIKETVRNAGDKLCRSVTSLTIRICDIT
                     LTEISDARQAMGIVLPFLLSEGIMSKVSSVRKASIAVVMKLAKGAGVALRPHLSDLVC
                     CMLESLSSLEDQGLNYVELHAANIGIETEKLENLRISISKGSPMWETLDLCINIVDTE
                     SLEQLIPRLTQLVRSGVGLNTRVGVASFISLLVQKVGTEIKPFTGMLLRLLFPVAKEE
                     KSSAAKRAFSSACGVVLKYSSPSQAQSLIEETAALHSGDRSSQIACASLFKSFSSTAS
                     DIMSGHQSAIVPVIFLSRFEDDKQISSLFEEVWEDITSGERVTLQLFLQEIVNHICES
                     ITSSSWASKKKAGKAISKLTEVLGESLSPQHNKLLQCLINEMPGRLWEGKDALLDALG
                     ALSVSCHEAITKEDPKTPTVILDLICSACRKKVKKYRESAFSCLEKVIIAFGDPEFFS
                     AVFPMLYEMCNTASVKTNSQVQSASDAVKTESEKGEDGQVPLEKIMECVKSCIQVATI
                     DDIISRKADLIHVLLISLSPGFLWNVKMSGISCLGKLCSRFQSLWNDSMDGPLPSDAT
                     KFAHELFHSLVPKLLECINTVKIAQVHVATSQCMLELIEVYSKVSTLHPVEVDFKGEI
                     NSLIELEKSEEAKSLLRKSRDALAILS"
     gene            <795679..>796194
                     /locus_tag="BRARA_H00092"
                     /db_xref="Phytozome:Brara.H00092"
     mRNA            <795679..>796194
                     /locus_tag="BRARA_H00092"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00092"
     CDS             795679..796194
                     /locus_tag="BRARA_H00092"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49283.1"
                     /db_xref="Phytozome:Brara.H00092"
                     /translation="MAFLDSVLRHWSLLHILFLSLSLCFLLVRSQEPPFFTQSPPPPP
                     PPPPPPPPPPPPPPPPPPPPPPPPPSSAPPPLVNVTDIFPPPPVAETIAPLPSPTPQQ
                     QPPQPRSESLPPPPEPRRFGSPDEPKRGGLNKGETVGLVFAGLAAMLQVLVVVFLVLK
                     RRQLLQLKETQ"
     gene            complement(796412..797809)
                     /locus_tag="BRARA_H00093"
                     /db_xref="Phytozome:Brara.H00093"
     mRNA            complement(join(796412..796736,796828..796945,
                     797035..797152,797231..797296,797603..797809))
                     /locus_tag="BRARA_H00093"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00093"
     CDS             complement(join(796674..796736,796828..796945,
                     797035..797152,797231..797240))
                     /locus_tag="BRARA_H00093"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49284.1"
                     /db_xref="Phytozome:Brara.H00093"
                     /translation="MNENIEEQKKGKYVLIRDGEGNELGGLFYKPLPCFGFGIGWLSF
                     LLGFFFPFAWYFATFLYLTNYYRRDPRERSGLAASAIAALIFTVALLITVLVLLFSGR
                     "
     gene            <799560..>799913
                     /locus_tag="BRARA_H00094"
                     /db_xref="Phytozome:Brara.H00094"
     mRNA            join(<799560..799712,799854..>799913)
                     /locus_tag="BRARA_H00094"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00094"
     CDS             join(799560..799712,799854..799913)
                     /locus_tag="BRARA_H00094"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49285.1"
                     /db_xref="Phytozome:Brara.H00094"
                     /translation="MMYAQRRKWSAEEEEALLAGICKYGPGKWSYIINDPEFRAQLSN
                     RTNIDLKDKWRNMTIKEEAKTLVNKI"
     gene            805363..808286
                     /locus_tag="BRARA_H00095"
                     /db_xref="Phytozome:Brara.H00095"
     mRNA            join(805363..805487,806627..806696,806781..806884,
                     806985..808286)
                     /locus_tag="BRARA_H00095"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00095"
     CDS             join(806629..806696,806781..806884,806985..808051)
                     /locus_tag="BRARA_H00095"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49286.1"
                     /db_xref="Phytozome:Brara.H00095"
                     /translation="MAGSAPEGTQFDTRQFDQKLNEVLEGQDEFFTSYDEVHESFDAM
                     GLQENLLRGIYAYGFEKPSAIQQRGIVPFCNGLDVIQQAQSGTGKTATFCSGVLQQLD
                     FTLVQCQALVLAPTRELAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQAGVHV
                     VVGTPGRVFDMLRRQSLRADSIKMFVLDEADEMLSRGFKDQIYDIFQLLPPKIQVGVF
                     SATMPPEALEITRKFMSKPVRILVKRDELTLEGIKQFYVNVEKEDWKLETLCDLYETL
                     AITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLIT
                     TDLLARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFVTKDDERMLFD
                     IQKFYNVVVEELPSNVADLL"
     assembly_gap    815867..825866
                     /estimated_length=unknown
                     /gap_type="between scaffolds"
     gene            828958..830918
                     /locus_tag="BRARA_H00096"
                     /db_xref="Phytozome:Brara.H00096"
     mRNA            join(828958..829170,829480..829732,829825..829934,
                     830015..830191,830291..830918)
                     /locus_tag="BRARA_H00096"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00096"
     mRNA            join(828958..829111,829480..829732,829825..829934,
                     830015..830191,830291..830918)
                     /locus_tag="BRARA_H00096"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00096"
     CDS             join(829495..829732,829825..829934,830015..830191,
                     830291..830455)
                     /locus_tag="BRARA_H00096"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49287.1"
                     /db_xref="Phytozome:Brara.H00096"
                     /translation="MQVFQRKDSMPTNPNIQGSQSFSLTKHMMMMSTQSGLQLQDQDS
                     SSTQSSGESGGGGEAASFVEHNRYGCSSIVNTNLSDSVFPPPTSDLASWPLPCPETPH
                     FNGFLAPEYASQPTALSSHLEMMGLASSRVPLPHNIQENEPIFVNAKQYHAILRRRKH
                     RAKLEAQNKLIKSRKPYLHESRHLHALKRVRGSGGRFLNTKKLQDSSNTPFRFSGYPS
                     THHVSALMSGT"
     CDS             join(829495..829732,829825..829934,830015..830191,
                     830291..830455)
                     /locus_tag="BRARA_H00096"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49288.1"
                     /db_xref="Phytozome:Brara.H00096"
                     /translation="MQVFQRKDSMPTNPNIQGSQSFSLTKHMMMMSTQSGLQLQDQDS
                     SSTQSSGESGGGGEAASFVEHNRYGCSSIVNTNLSDSVFPPPTSDLASWPLPCPETPH
                     FNGFLAPEYASQPTALSSHLEMMGLASSRVPLPHNIQENEPIFVNAKQYHAILRRRKH
                     RAKLEAQNKLIKSRKPYLHESRHLHALKRVRGSGGRFLNTKKLQDSSNTPFRFSGYPS
                     THHVSALMSGT"
     gene            complement(830291..833563)
                     /locus_tag="BRARA_H00097"
                     /db_xref="Phytozome:Brara.H00097"
     mRNA            complement(join(830291..830909,830995..831114,
                     831232..831353,831429..831599,831662..831763,
                     833021..833563))
                     /locus_tag="BRARA_H00097"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00097"
     CDS             complement(join(830636..830909,830995..831114,
                     831232..831353,831429..831599,831662..831763,
                     833021..833446))
                     /locus_tag="BRARA_H00097"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49289.1"
                     /db_xref="Phytozome:Brara.H00097"
                     /translation="MPIIASSLSSCLVQVYFRKITVMSSPDRAVLSLLADIFLSFDGA
                     ILGVTLAFGAARAASKYASTSAALNKIKDAPEVSVSDLRSLIPPSDDESSHANQRVVV
                     VLGTVEPKVTGDGSHKNNNDSALTSQETGEKALIIHRTQTYMYSGWKTLFHLSSGHRF
                     LLERSLPKQGADFMRMVPFVIVDKNQRSQSSFLVVNMDGARQPLPLTTVYNRLQPINS
                     SPYSFLQALFFPEFPVGMLDVEKILPPGRDLTAVGICSLNNGVPEIKSCQDLPYFLSD
                     MTKDKMIMHLTETTSVLFWGGVILGCLSVGILGFAAVRAWNRWKLRRELLQRRPDQHM
                     VDDETEEDADEIPDGELCVICVTRRRIPAFIPCGHVVCCRYCALTVERGLNPKCPVCL
                     QSIRGSMRIYYS"
     gene            834178..835389
                     /locus_tag="BRARA_H00098"
                     /db_xref="Phytozome:Brara.H00098"
     mRNA            join(834178..834288,834375..834651,834973..835389)
                     /locus_tag="BRARA_H00098"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00098"
     CDS             join(834391..834651,834973..835251)
                     /locus_tag="BRARA_H00098"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49290.1"
                     /db_xref="Phytozome:Brara.H00098"
                     /translation="MAGEGEEDVPRDAKIVKSLLKSMGVEDYEPRVVHQFLELWYRYV
                     VEVLTDAQVYSEHASKSTIDCDDVKLAIQSKVSFSFSQPPPREVLLELAASRNKIPLP
                     KSIAGPGIPLPPEQDTLLSPNYQLVIPKKSASTEPEETEDDEEMADPAQSSSQEQQTS
                     ELPSQTPQRVSFPLSRRPK"
     gene            complement(<836009..>837131)
                     /locus_tag="BRARA_H00099"
                     /db_xref="Phytozome:Brara.H00099"
     mRNA            complement(join(<836009..836336,836384..836447,
                     836628..836740,836779..837042,837127..>837131))
                     /locus_tag="BRARA_H00099"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00099"
     CDS             complement(join(836009..836336,836384..836447,
                     836628..836740,836779..837042,837127..837131))
                     /locus_tag="BRARA_H00099"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49291.1"
                     /db_xref="Phytozome:Brara.H00099"
                     /translation="MIVPAESIARFHCVSKLWRSILRHRHDFTELFMARSITRPRLLF
                     TFKVEDKLLIFSSTQPQNVGGDNCSLVATRYKDFPKHFPTENRDDLKKGSDSCNPVTG
                     EFIDLAKVKAAGTERSYIGYDPIKKKYIACYDFRFEKFSFIERDSEILTTTGLKKKLV
                     LWVLEDAEKHKWSKSIFVLSHLYNEKIGHKCYIVGITSAGEIVFMPVGHVNPNFHLFF
                     YNMERDTCTTVNIKGFEEFKHHSLHITTYLDYVENMMPL"
     gene            complement(<841121..>841495)
                     /locus_tag="BRARA_H00100"
                     /db_xref="Phytozome:Brara.H00100"
     mRNA            complement(<841121..>841495)
                     /locus_tag="BRARA_H00100"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00100"
     CDS             complement(841121..841495)
                     /locus_tag="BRARA_H00100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49292.1"
                     /db_xref="Phytozome:Brara.H00100"
                     /translation="MDPRVPATSVFRWSRSRRKIHIRRRKTQVVRLGGKNNVVSRGGF
                     SLKKMVRRMKLKWLRLHYVRLVKKMKGFYCNLVKEFVDAGVELEAIQTQMAVEAAAFA
                     VPGLGLSFSSLSAHDRARYFLV"
     gene            complement(<847985..>849808)
                     /locus_tag="BRARA_H00101"
                     /db_xref="Phytozome:Brara.H00101"
     mRNA            complement(<847985..>849808)
                     /locus_tag="BRARA_H00101"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00101"
     CDS             complement(847985..849808)
                     /locus_tag="BRARA_H00101"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49293.1"
                     /db_xref="Phytozome:Brara.H00101"
                     /translation="MRAVNYLYTSSNPRFRGIFNALCAVTLFLFFFNKNPLLKTQSFV
                     DGSPPPRGRHMIETYSGDTTAICSGLHQHIGYTDQCQFLKSNPLCYPDSFFDYLSFFY
                     CTCQHFKILGYIALGVWLVALFYLLGNTAADYFCPSLEKLSKLLRLPPTVAGVTLLPL
                     GNGAPDVFASIAAFVGSDKGEVGLNSVLGGAVFVTCVVAGVVSLCVADKEVKIDKKCF
                     IRDLCFFLFTLVALLVILTVGRVSVGIAAAFVSIYVLYASLVAANEIIRKHSKRLKLD
                     SFTPLLPIQGSVFSPPSGGEEDVYSPLLELDTEEGPPKLHDSLPQWMWATNVAIYSAK
                     ANVHDEERPPWGWSEDGGEVETSLCYKITYFLETPLTVPRRLTIPLIEEDSWSKTYAV
                     ASVSLAPLLLAFLWSSLQAYFIGIAVGSILGFLAYRNTEHDRPPQRYLIPWVLGGFIM
                     SIVWFYMIANELVALLVTFGGIYGINPSILGLTVLAWGNSMGDLVSNIALSMNGGDGV
                     QIALSGCYAGPMFNTLVGLGVSMLLGAWSKRPESYMIPEDNSLFYTLGFLILGLLWAL
                     VMLPRNEMRPNKVMGIGLIALYLIFVTFRLSSAMGFIPWAA"
     gene            851036..854498
                     /locus_tag="BRARA_H00102"
                     /db_xref="Phytozome:Brara.H00102"
     mRNA            join(851036..851203,851275..851414,851540..851626,
                     851706..851837,851934..852006,852105..852127,
                     852206..852269,852527..852572,852826..853006,
                     853096..853272,853358..853522,853596..853736,
                     853811..853908,853987..854136,854226..854498)
                     /locus_tag="BRARA_H00102"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00102"
     CDS             join(851277..851414,851540..851626,851706..851837,
                     851934..852006,852105..852127,852206..852269,
                     852527..852572,852826..853006,853096..853272,
                     853358..853522,853596..853736,853811..853908,
                     853987..854136,854226..854280)
                     /locus_tag="BRARA_H00102"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49294.1"
                     /db_xref="Phytozome:Brara.H00102"
                     /translation="MGSASKEYEFLSEIGLSSSHNLGNYVGGKWLGNGPLVSTLNPAN
                     NQPIAQVVEASLEDYEIGLKACEEAAKTWMQVPAPKRGDIVRQIGDALRSKLDYLGRL
                     LSLEMGKILAEGIGEVQEVIDMCDFAVGLSRQLNGSVIPSERPNHMMLEMWNPLGIVG
                     VITAFNFPCAVLGWNACIALVCGNCVVWKGAPTTPLITIAMTKLVAEVLEKNHLPGAI
                     FTAMCGGAEIGEAIAKDTRIPLVSFTGSSKVGLTVQQTVSARSGKTLLELSGNNAIIV
                     MDDADIQLAARSVLFAAVGTAGQRCTTCRRLLLHESVYDKVLEQLLTSYKQVKIGDPL
                     EKGTLLGPLHTPESKKNFEKGIEVIKSQGGKVLTGGKAVEGEGNFVEPTIIEISSDAA
                     VVKEELFAPVLYALKFKTFEEAVAINNSVPQGLSSSIFTRSPENIFKWIGPMGSDCGI
                     VNVNIPTNGAEIGGAFGGEKATGGGREAGSDSWKQYMRRSTCTINYGNELPLAQGINF
                     G"
     gene            complement(<855179..>857074)
                     /locus_tag="BRARA_H00103"
                     /db_xref="Phytozome:Brara.H00103"
     mRNA            complement(join(<855179..856897,856934..>857074))
                     /locus_tag="BRARA_H00103"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00103"
     CDS             complement(join(855179..856897,856934..857074))
                     /locus_tag="BRARA_H00103"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49295.1"
                     /db_xref="Phytozome:Brara.H00103"
                     /translation="MESPDIRGGDGSDFATLETAEKIILRWDSTTSEEAKENLIFQSD
                     REERLVSSVSISDSRHEVKARSTIQIAMARLEDELRNILLSQTSTFEPDSLLLDSSAS
                     SFATRADLEDTETAPPDEGEGEEQEEMNLVLPDGSDSNSGSDPGSSRLSSRRSSCKST
                     SSIREIDLVSSEAVSDLRSIVHRMIGAGYSRECLQVYGNVRKSAMETIFKQLGIVKLG
                     IGDVQRLDWEVVEVKIRRWIRAAKACVRVVFASEKRLCEQIFDGGEVEETCFMEIVKS
                     SALQLFTFPEAISISRRSPEKLFKILDLHDALADLLPDMEEIFNSESSETILVQATEI
                     QSRLAEAARGTLVEFENAIFREPSVVPVPGGTIHPLTRYVMNYLNLIADYKQTLVELI
                     MSKPCAGLKCTNDPVKPDMDISQLEGCSPLALHCIWTMVMLQFNLEGKSLHYKDEALS
                     HIFIMNNVHYIVQKVKSSTELREIIGDLYLRRLTGIFRHAATKYQRATWVRVLNSLRD
                     EGLHVSGSFSSGVSKSALRERFKAFNTMFEEVHRVQSTWSVPDVQLREELRISLSEHL
                     IPAYRSFLGRFRGHIESGRHPENYLKYSVENLETAVLDFFEGYTTAPHLRRSQ"
     gene            859428..862315
                     /locus_tag="BRARA_H00104"
                     /db_xref="Phytozome:Brara.H00104"
     mRNA            join(859428..859645,859947..860008,860086..860188,
                     860282..860358,860452..860513,860595..860682,
                     860767..860842,860933..860963,861179..861387,
                     861477..861653,861735..862315)
                     /locus_tag="BRARA_H00104"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00104"
     CDS             join(859523..859645,859947..860008,860086..860188,
                     860282..860358,860452..860513,860595..860682,
                     860767..860842,860933..860963,861179..861387,
                     861477..861653,861735..861989)
                     /locus_tag="BRARA_H00104"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49296.1"
                     /db_xref="Phytozome:Brara.H00104"
                     /translation="MQNQRLKQQQQQAMMQQAMMQQQHHSLYHPSLMAPPPPPPQMEP
                     LPSGNLPPGFDPSTCRSVYAGNIHTQVTEVLLQEIFASTGPVESCKLIRKDKSSYGFV
                     HYFDRRSAGLAIMSLNGRHLFGQPIKVNWAYATGQREDTSSHFNIFVGDLSPEVTDAA
                     LFESFSAFNTCSDARVMWDQKTGRSRGFGFVSFRNQQDAQTAINEMNGKWISSRQIRC
                     NWATKGATFGEDKHSSDGKSVVELTNGSEDGREISISNEEAPENNPQYTTVYVGNLAP
                     EVTQLDLHRMFHTLGAGVIEEVRVQRDKGFGFVRYNTHDEAALAIQMGNSQPFLFSRP
                     IKCSWGNKPTPTGTPSNPLPPPAPVPVPGLSPMDLLAYERQLALAKMHPQAQHSLRHV
                     NAAGASAAMYDGGFQNVAAAHQQLMYYQ"
     gene            complement(862776..863999)
                     /locus_tag="BRARA_H00105"
                     /db_xref="Phytozome:Brara.H00105"
     mRNA            complement(862776..863999)
                     /locus_tag="BRARA_H00105"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00105"
     CDS             complement(862966..863895)
                     /locus_tag="BRARA_H00105"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49297.1"
                     /db_xref="Phytozome:Brara.H00105"
                     /translation="MEEEDETQSSPVDSSSPPAPSSPPVLPASNVTVASVTKPPPSSQ
                     SPSRNALALAVHTPSVTVNKNGRIGGGGGGRDDCWSEEATRVLINAWGDRFAEPGKGT
                     LKQQQWHEVAEIVNGSGQCKYTKTDVQCKNRIDTVKKKYKQEKAKNGPSKWAFFKKLE
                     SLIGGGGGGKAPVVGARSSGPMRWHFRKRSASETESESEPEHSAESLPPPLQPLPKRL
                     KMGESGVGEVAKAILGFTEAYEKAESGKIKLMLELEKERMKFVKEMELQRMQFLRTQM
                     EITQKNQEEERGKLRINDDDDDRNVKNNGDVSS"
     gene            865868..867034
                     /locus_tag="BRARA_H00106"
                     /db_xref="Phytozome:Brara.H00106"
     mRNA            join(865868..866211,866447..867034)
                     /locus_tag="BRARA_H00106"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00106"
     CDS             join(866014..866211,866447..866713)
                     /locus_tag="BRARA_H00106"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49298.1"
                     /db_xref="Phytozome:Brara.H00106"
                     /translation="MSAVAINHLFGLPETIEKLIFPTSRSGEGNETRGGSNNNIPIDI
                     LESPKEYIFYVDIPGISKSDIQATVEEERTLVIKSNGKRKREDHDVSEEGCKYIRLER
                     RLPQNLVKKFRLPEDADVEAVAAKYQDGVLTVTVGKVPPQPPKSKTVQIAVS"
     gene            <873368..>882739
                     /locus_tag="BRARA_H00107"
                     /db_xref="Phytozome:Brara.H00107"
     mRNA            join(<873368..873557,882136..882260,882348..882548,
                     882629..>882739)
                     /locus_tag="BRARA_H00107"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00107"
     CDS             join(873368..873557,882136..882260,882348..882548,
                     882629..882739)
                     /locus_tag="BRARA_H00107"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49299.1"
                     /db_xref="Phytozome:Brara.H00107"
                     /translation="MGIVSGQNIPSVALFAFGDSNFDAGNRKYLTSATLAQNFWPYGK
                     SRDDPNGKFSDGKIAPDFIAKFMGIPHDIPPALKPDADVSRGASFAVDYASILGNGTP
                     KDSLTLNQQVRKFSQMISNWKEDYIAKSLFMISIGMEDYYNFTKTTPEADASAQQAFV
                     ISVINRLKYNIEMLYSSGASKFVVHNVAPLGCLPIVRQEFNTGNECYE"
     gene            complement(888426..890299)
                     /locus_tag="BRARA_H00108"
                     /db_xref="Phytozome:Brara.H00108"
     mRNA            complement(join(888426..888914,889138..889390,
                     889463..889663,889818..889933,890008..890299))
                     /locus_tag="BRARA_H00108"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00108"
     CDS             complement(join(888538..888914,889138..889390,
                     889463..889663,889818..889933,890008..890248))
                     /locus_tag="BRARA_H00108"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49300.1"
                     /db_xref="Phytozome:Brara.H00108"
                     /translation="MANPKPHLFSLSFLSLLLLPHFPTVSLAQTLFVFGDGLYDAGNK
                     QFVSSNRVDASFPPYGMTVGEPTGRWSDGRIVPDYLASFMGVPHIPPILNGTADFSHG
                     ANFAIADATVLGSPPETLTFSQQVIKFSDNKNKWSAQARSEAVYLFYIGSDDYLKFAK
                     NNPNPSDDQKQAFVDRVITAIEAELKVIYGTGGRKFALQNLAPLGCLPAVKQANGNVQ
                     ECVKLPSEMAELHNKKLLQLLVELSRQLSGFQYSFYDFFSSIKHRVIKSKTYTFETGM
                     AACCGTGSVNGTSCSTNNVCSKPDDYLFFDGKHLTQEGNLQVGHLMWGADPVVVGPNN
                     LRELLFLPLNTTVMLADIQEAMAAMSPKQNKIESLYDIKMMESEMENQWLYQVGKAVS
                     FLI"
     gene            <909051..>910658
                     /locus_tag="BRARA_H00109"
                     /db_xref="Phytozome:Brara.H00109"
     mRNA            join(<909051..909133,909246..909488,909763..909806,
                     910225..>910658)
                     /locus_tag="BRARA_H00109"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00109"
     CDS             join(909051..909133,909246..909488,909763..909806,
                     910225..910658)
                     /locus_tag="BRARA_H00109"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49301.1"
                     /db_xref="Phytozome:Brara.H00109"
                     /translation="MPKCWSGIVQRYDDKISQDIEVLRTLNRMQQSSNGSSVGAVCGS
                     SGEQADAKVWVLNREVVVVSRRRHQEHVKRLEPNSSSGLCAGFRICNQTIVDLQRSHA
                     IVSACRWFIMKIREWTPIGSMKTATKAICDAKEWKEAQLKVISLNPIKTTRQIHGTPE
                     VVCRSDAAWKKELDAAGLEWSFLERHNERFASHSKPIAFVISSLVAEGLAIRAAMEHA
                     AILQLENVISESDLLQLIAWIISGHSFSDLHGILSDISLLSLSFNHVPF"
     gene            912823..916425
                     /locus_tag="BRARA_H00110"
                     /db_xref="Phytozome:Brara.H00110"
     mRNA            join(912823..913090,914934..915052,915371..915836,
                     915908..916425)
                     /locus_tag="BRARA_H00110"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00110"
     CDS             join(912835..913090,914934..915052,915371..915836,
                     915908..916236)
                     /locus_tag="BRARA_H00110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49302.1"
                     /db_xref="Phytozome:Brara.H00110"
                     /translation="MAGKCTLASVLGLLLVFTLFQNPLTVCGQSIPAVALFTFGDSNF
                     DAGNKQTLTQVNVAQGFWPYGKSRDDPNGKFSDGFIAPDFVATFMEIPIPIPAALKPG
                     VNVSRGASFAVADATLLGAPVQSLTLYQQITKFNEMKAANWNDDFIKQSLFMIYIGAN
                     DYFNFTKNNPNADASAQQAFVTSVTNQLKNEISFLYASGARKLMIQTLAPLGCLPIVR
                     QDYRTGMEKCYEPLNNLAIQHNEKIGPMLNEMALNAPDFQFTVFDFYNVILRRITPQR
                     SLGYRFLRTNVSCCGIGTHTAYGCGLPNVHSKLCSYQRSYLFFDGRHNSEKAQESFGH
                     LMFGADPNVIQPMNIRELVTYPVGEPMREAWLPTTSATVQARASSSSTSRGYELN"
     assembly_gap    926359..936358
                     /estimated_length=unknown
                     /gap_type="between scaffolds"
     gene            939561..943388
                     /locus_tag="BRARA_H00111"
                     /db_xref="Phytozome:Brara.H00111"
     mRNA            join(939561..939833,940101..940219,942355..942811,
                     942909..943388)
                     /locus_tag="BRARA_H00111"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00111"
     CDS             join(939578..939833,940101..940219,942355..942811,
                     942909..943237)
                     /locus_tag="BRARA_H00111"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49303.1"
                     /db_xref="Phytozome:Brara.H00111"
                     /translation="MAGKCNLASVLGGFLVLTLLHNLLNVSGQNIPAVALFTFGDSNF
                     DAGNKQTLTKANVAQGFWPYGKSRDDPNGKLSDGFITPDFVAKFMGIPIPIPAALKPN
                     VNVSRGASFAVADATLLGAPVESLTLNQQVRKFNQMKAENWNDDFIKKSVFMIYIGAN
                     DYLNFTKNNPNADASAQQAFVTSVTNKLKNDISLLYSSGASKFVIQTLAPLGCLPIVR
                     QDYNTGMDQCHELLNNLAKQHNEKIGPMLNELARTPGFQFTVFDFYSVILRRTQRPSN
                     YRFFVTNASCCGVGTHNAYGCGLPNVHSKLCEYQRSYLFFDGRHNTEKAQESFGHLLF
                     GADPNVIQPMNVRELIVYPVDEPMSEVWLPTTSAMVQASDSSSSASRGYEFY"
     gene            complement(<952313..>955415)
                     /locus_tag="BRARA_H00112"
                     /db_xref="Phytozome:Brara.H00112"
     mRNA            complement(join(<952313..952548,952630..952885,
                     952953..953183,955066..955193,955280..>955415))
                     /locus_tag="BRARA_H00112"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00112"
     CDS             complement(join(952313..952548,952630..952885,
                     952953..953183,955066..955193,955280..955415))
                     /locus_tag="BRARA_H00112"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49304.1"
                     /db_xref="Phytozome:Brara.H00112"
                     /translation="MFDAGNYKYINNNTAFQSNFFPYGQTTFKFPTGRVSDGRLITDF
                     IAENAWLPLIPPNLQPSNSNNQFTYGANFAFGGAGALVETFPGMVIDLGTQLNSFKNV
                     VRSLKSALGDAEAKTIFSRAVYLFYIGGNDLVYPLVANSSLFQSNTKEKFVDFVIGNT
                     TSVVEEVYKIGGRKFGFLNIGAYECAPVISILDTTNIGSCSKPVAELIYLYNKKFPDA
                     LRRLQHELSGFRYALHDYHTSLLERINNPSKYGFKEGKMGCCGSGPLKGINTCGNQMG
                     KSYELCENVTDYLFFDASHLTEKAHRQIAELIWSGPPNVTGPYNLQALFELN"
     gene            complement(960508..962443)
                     /locus_tag="BRARA_H00113"
                     /db_xref="Phytozome:Brara.H00113"
     mRNA            complement(join(960508..960886,960979..961234,
                     961316..961546,961931..962058,962142..962443))
                     /locus_tag="BRARA_H00113"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00113"
     CDS             complement(join(960651..960886,960979..961234,
                     961316..961546,961931..962058,962142..962406))
                     /locus_tag="BRARA_H00113"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49305.1"
                     /db_xref="Phytozome:Brara.H00113"
                     /translation="MKSSRLFSTILFLYTIILSISSINCKENNNNLVTNQAALFVFGD
                     SLFDVGNNNYINTTTRSNFFPYGQTFFKVPTGRVSDGRLITDFIAEKAWLPLIPPNLQ
                     PGNSNSQLTYGVNFASAGAGALVETFPGMVIDLGTQLNSFRNVERSLRSALGDAEAKK
                     IFSRAVYMFSIGSNDLFFPLVANSSLFQSNTKERFVDFVIGNTTSVLEEVYKMGGRKF
                     GFLNMGAYECAPPSLLLDPTNIGSCSKPVAELINLHNKKFPDALNRLQRELSGFRYAL
                     HDYHTSLLDRINNPSKYGFKVGQMGCCGSGPFRGINTCGGRMGQSYELCENVNDYLFF
                     DSSHLTEKAHQQIAELVWSGPPNVTRPYNLKALFELN"
     gene            complement(967555..970035)
                     /locus_tag="BRARA_H00114"
                     /db_xref="Phytozome:Brara.H00114"
     mRNA            complement(join(967555..967912,968053..968305,
                     968388..968612,969149..969273,969587..970035))
                     /locus_tag="BRARA_H00114"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00114"
     CDS             complement(join(967662..967912,968053..968305,
                     968388..968612,969149..969273,969587..969923))
                     /locus_tag="BRARA_H00114"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49306.1"
                     /db_xref="Phytozome:Brara.H00114"
                     /translation="MRKSTLMEKVTQRTISSSSSSSSSTFFLCFFIFSLSILFLAGKS
                     AAKVSYDGDNDDNVTALFIFGDSFLDAGNNNYINTTTLDQANFPPYGQTFFGLPTGRF
                     SDGRLISDFIAEYAKLPLIPPFLEPGDSQKKLCGVNFASAGAGALVETFQGSVISLRT
                     QLDHYKKVERLWRIKFGKEESKKRISRAVYLISIGSNDYSSPFLTNQSLSVSMSQHVD
                     IVIGNLTTFIHEIYKIGGRKFGFLNVPDLGCFPALRILKQKNDSCLRDASILASIHNK
                     ALSNLLFKMQRQVKGFKFSLFDMNKSLKLRMDHPSKFGFKEGEEACCGTGKWRGVFSC
                     GGKRIVKEYKLCENPDDYIFWDSLHLTQNTYKQFANLIWNGGHMSDSLVVGPYNVNRL
                     FQIS"
     gene            complement(973362..975497)
                     /locus_tag="BRARA_H00115"
                     /db_xref="Phytozome:Brara.H00115"
     mRNA            complement(join(973362..974246,975117..975497))
                     /locus_tag="BRARA_H00115"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00115"
     CDS             complement(join(973537..974246,975117..975372))
                     /locus_tag="BRARA_H00115"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49307.1"
                     /db_xref="Phytozome:Brara.H00115"
                     /translation="MCGGAIISDFIPPPRSRRVTSEFLWPDLKKNAKKSSKKRSSFFD
                     LDDEFEADFKGFKDDSSVDCDDAKPFVFAGARTPAVSAATADSVFGKKVADGEGERSA
                     KRKRKSQYRGIRQRPWGKWAAEIRDPREGSRVWLGTFKTAEEAARAYDAAARRIRGSK
                     AKVNFPEEKENPPAKKVAPNPSPVLSQNLDNSFDNMCFMEEKHQVNNNSNQFGGNGYH
                     QYFSSDQGSNSFGCSEFGWNDQAPITPEISSAFINNNSATFAEEADPAKQLKVMDFET
                     TYNSTEWDSSLDFFSGDAVATQDNGANPMELWSIDEIDSMIGGVF"
     gene            complement(983070..983721)
                     /locus_tag="BRARA_H00116"
                     /db_xref="Phytozome:Brara.H00116"
     mRNA            complement(join(983070..983371,983477..983721))
                     /locus_tag="BRARA_H00116"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00116"
     CDS             complement(join(983191..983371,983477..983664))
                     /locus_tag="BRARA_H00116"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49308.1"
                     /db_xref="Phytozome:Brara.H00116"
                     /translation="MTKISVGLQLVTTDSKEKLSNIVIKSSLRPNRSNPNIAERCFLK
                     TCHLCMKQLHQDKDIFMYRGDLGFCSRECRESQILIDEKKELEASTKMMLAAYRRCNS
                     GENRNLLNDLRRRRQLFIVP"
     gene            991115..993472
                     /locus_tag="BRARA_H00117"
                     /db_xref="Phytozome:Brara.H00117"
     mRNA            join(991115..991438,991551..991632,991917..991997,
                     992228..992341,992431..992532,992649..992707,
                     992795..992897,992987..993052,993134..993472)
                     /locus_tag="BRARA_H00117"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00117"
     mRNA            join(991115..991290,991376..991438,991551..991632,
                     991917..991997,992228..992341,992431..992532,
                     992649..992707,992795..992897,992987..993052,
                     993134..993472)
                     /locus_tag="BRARA_H00117"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00117"
     CDS             join(991425..991438,991551..991632,991917..991997,
                     992228..992341,992431..992532,992649..992707,
                     992795..992897,992987..993052,993134..993226)
                     /locus_tag="BRARA_H00117"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49309.1"
                     /db_xref="Phytozome:Brara.H00117"
                     /translation="MFLTRTEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGVKTKE
                     GVVLAVEKRITSPLLEPSSVEKIMEIDDHIGCAMSGLIADARTLVEHARVETQNHRFS
                     YGEPMTVESTTQALCDLALRFGEGDEESMSRPFGVSLLIAGHDENGPSLYYTDPSGTF
                     WQCNAKAIGSGSEGADSSLQEQFNKDLSLEEAETIAVSILKQVMEEKVTPNNVDIAKV
                     APAYHIYTPQEVEAVISRL"
     CDS             join(991425..991438,991551..991632,991917..991997,
                     992228..992341,992431..992532,992649..992707,
                     992795..992897,992987..993052,993134..993226)
                     /locus_tag="BRARA_H00117"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49310.1"
                     /db_xref="Phytozome:Brara.H00117"
                     /translation="MFLTRTEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGVKTKE
                     GVVLAVEKRITSPLLEPSSVEKIMEIDDHIGCAMSGLIADARTLVEHARVETQNHRFS
                     YGEPMTVESTTQALCDLALRFGEGDEESMSRPFGVSLLIAGHDENGPSLYYTDPSGTF
                     WQCNAKAIGSGSEGADSSLQEQFNKDLSLEEAETIAVSILKQVMEEKVTPNNVDIAKV
                     APAYHIYTPQEVEAVISRL"
     gene            993879..996449
                     /locus_tag="BRARA_H00118"
                     /db_xref="Phytozome:Brara.H00118"
     mRNA            join(993879..994048,994418..994499,994600..994691,
                     994772..994849,994944..995005,995132..995276,
                     995357..995575,995651..996008,996110..996449)
                     /locus_tag="BRARA_H00118"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00118"
     CDS             join(993962..994048,994418..994499,994600..994691,
                     994772..994849,994944..995005,995132..995276,
                     995357..995575,995651..996008,996110..996267)
                     /locus_tag="BRARA_H00118"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49311.1"
                     /db_xref="Phytozome:Brara.H00118"
                     /translation="MTRDIEDEIRDEKNPRPLDEDDIALLKTYGLSPYSAANKKVEKE
                     IKELAKRINDLCGIKESDTGLALPSQWDLVSDKQMMQEEQPLQVARCTKIISPNTEDA
                     KYVINVKQIAKFVVGLGDKVSPTDIEEGMRVGVDRTKYQIQIPLPPKIDPSVTMMTVE
                     EKPDVTYNDVGGCKEQIEKMREVVELPMLHPEKFVKLGIDPPKGVLCYGPPGTGKTLL
                     ARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFQMARSKKACIVFFDEVDAIGGA
                     RFDDGVGGDNEVQRTMLEIVNQLDGFDARGNIKVLMATNRPDTLDPALLRPGRLDRKV
                     EFGLPDLESRTQIFKIHTRTMNCERDIRFELLARLCPNSTGADIRSVCTEAGMYAIRA
                     RRKTVTEKDFLDAVNKVIKGYQKFSATPKYMVYN"
     gene            complement(<996763..>1000345)
                     /locus_tag="BRARA_H00119"
                     /db_xref="Phytozome:Brara.H00119"
     mRNA            complement(join(<996763..996840,996924..996980,
                     997054..997210,997294..997427,997505..997909,
                     998027..998310,998391..998698,998831..998893,
                     998981..999046,999118..999189,999269..999340,
                     999424..999495,999578..999643,999739..999810,
                     999884..1000016,1000252..>1000345))
                     /locus_tag="BRARA_H00119"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00119"
     CDS             complement(join(996763..996840,996924..996980,
                     997054..997210,997294..997427,997505..997909,
                     998027..998310,998391..998698,998831..998893,
                     998981..999046,999118..999189,999269..999340,
                     999424..999495,999578..999643,999739..999810,
                     999884..1000016,1000252..1000345))
                     /locus_tag="BRARA_H00119"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49312.1"
                     /db_xref="Phytozome:Brara.H00119"
                     /translation="MENRVVVAALFAVCIVGFELRLIHGATDASDTSALNMLFSSMHS
                     PGQLTQWTASGGDPCGQNWRGVTCSESRVTQLKLPGLELSGTLGYMLDKLTSLTELDL
                     SSNNLGGDLPYQLPPNLQRLNLANNQFTGAAQYSISNMVSLKYLNLGHNQFKGQVAVD
                     FSKLTSLTTLDFSFNSFTLSLPGTFTSLTSLKSLYLQNNQFSGTLNVLAGLPLETLNI
                     ANNDFTGWIPSTLKGINLIKDGNSFNNGPAPPPPPGTPPIHRSPSHKSGGGANRDSTS
                     NGDSKKSGIGAGVIAGIIISLLVVTALVAFFLVKRRRRSKRSSSMDIEKTDNQPFTLP
                     PSDFHENNSIQSSSSVETKKLDTSLSINLRPPPADRSFDDDEDSTRKPIVVKKSTVAV
                     PSNVRVYSVADLQIATSSFSVDNLLGEGTFGRVYRAEFNNGQVLAVKKIDSSALPHSM
                     TDDFTEIVSKIAVLDHPNVTKLVGYCAEHGQHLLVYEYHSKGSLHDFLHLSEEESKAL
                     VWNSRVKVALGTARALEYLHEVCSPSIVDKNIKSANILLDSEMNPHLSDTGLASFLPT
                     ANELLNQTDEGYSAPEVSMSGQYSLKSDVYSFGVVMLELLTGRKPFDSTRSRSEQSLV
                     RWATPQLHDIDALGKMVDPALEGLYPVKSLSRFADVIALCVQPEPEFRPPMSEVVQSL
                     VVLRANMSKRTVGVDPSQRSAETTNDYM"
     gene            1007911..1011464
                     /locus_tag="BRARA_H00120"
                     /db_xref="Phytozome:Brara.H00120"
     mRNA            join(1007911..1008123,1008600..1008659,1008742..1008920,
                     1009001..1009136,1009209..1009305,1009387..1009446,
                     1009532..1009632,1009832..1009866,1009973..1010030,
                     1010329..1010403,1010472..1010629,1010709..1010966,
                     1011043..1011464)
                     /locus_tag="BRARA_H00120"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00120"
     CDS             join(1007992..1008123,1008600..1008659,1008742..1008920,
                     1009001..1009136,1009209..1009305,1009387..1009446,
                     1009532..1009632,1009832..1009866,1009973..1010030,
                     1010329..1010403,1010472..1010629,1010709..1010966,
                     1011043..1011271)
                     /locus_tag="BRARA_H00120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49313.1"
                     /db_xref="Phytozome:Brara.H00120"
                     /translation="MKHHHKLTVALCLIWASSILYGEMFAFWVPSLFTCSWPHHHLLK
                     SDGVESDVKFTKVAIVTDPQLMDKTSFRLSSKTLALEVAQFYTDVNMRRSFFQSVLPF
                     KPDVVLFLGDYFDGGPFLPEEEWYESLSRFKHVFGMNSQGQAGDVPTFYISGNHDIGY
                     SRVASHKLDVISRYEKAFGSRNRRFMIGSTEFISIDAQAIDGNPQKELALEVWKFVQN
                     VSSDAKSHPRVLLTHIPLYRPDQTPCGPHRASSVIDQRLWRHFKDQEVMYQNYITAES
                     SKKLLELIKPTLVLSGHDHDQCTLTHKSEAGSVTEHTLGTISWQQGNLYPSFMLLSVP
                     NAIHQNSSDQDNMLHTQLCFLPRQLFIYIWYLSLFVVTLLALLLWPNHGVSFLNNAAD
                     TISNVMKLSFLSDVTKEKNEDENCEYEMVWDAEGSMHLVKKVLQAPVKRQSDKSHVER
                     GNAVMRSAARKNDIENVMDSNVGAGVSDPLMRSASKSRTKLVIQRVIRTIMMSIVIAA
                     FNVPIYMMLLFKDWVEK"
     gene            complement(<1011810..>1011956)
                     /locus_tag="BRARA_H00121"
                     /db_xref="Phytozome:Brara.H00121"
     mRNA            complement(<1011810..>1011956)
                     /locus_tag="BRARA_H00121"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00121"
     CDS             complement(1011810..1011956)
                     /locus_tag="BRARA_H00121"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49314.1"
                     /db_xref="Phytozome:Brara.H00121"
                     /translation="MAELKSKLNKGHAFTSKCASLVKEQRARLYILRRCATMLCCWYI
                     HGDE"
     gene            1014971..1016524
                     /locus_tag="BRARA_H00122"
                     /db_xref="Phytozome:Brara.H00122"
     mRNA            join(1014971..1015075,1015432..1015524,1015611..1016524)
                     /locus_tag="BRARA_H00122"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00122"
     gene            <1015036..>1015633
                     /locus_tag="BRARA_H00123"
                     /db_xref="Phytozome:Brara.H00123"
     mRNA            join(<1015036..1015075,1015432..1015524,1015611..>1015633)
                     /locus_tag="BRARA_H00123"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00123"
     CDS             join(1015036..1015075,1015432..1015524,1015611..1015633)
                     /locus_tag="BRARA_H00123"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49315.1"
                     /db_xref="Phytozome:Brara.H00123"
                     /translation="MDQQPEPVTYVCGDCGQENTLKSGDVIQCRECGYRILYKKRTRR
                     VVQYEAR"
     CDS             1015882..1016343
                     /locus_tag="BRARA_H00122"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49316.1"
                     /db_xref="Phytozome:Brara.H00122"
                     /translation="MCNVGFEWNRSNLLVGGGWVVRNERGVVQCHSRRAFNNIHSLDE
                     AKLVVILWALESMGSHRMSNIIVACDFSELVGAVERPQAWPSFLHQVGEIELAMARIE
                     GCRLISVGNEANKGATFIAQSVTRQGLIRSYVQNGHPPWLFELFVNESRCL"
     gene            <1038779..>1039030
                     /locus_tag="BRARA_H00124"
                     /db_xref="Phytozome:Brara.H00124"
     mRNA            <1038779..>1039030
                     /locus_tag="BRARA_H00124"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00124"
     CDS             1038779..1039030
                     /locus_tag="BRARA_H00124"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49317.1"
                     /db_xref="Phytozome:Brara.H00124"
                     /translation="MCRLLCCCFCRKKKKPRDVKMGKKGKKDGGLVVVKPTKTKKRRN
                     EPVDVSGCADLCCCFGGGGGGGDCGGGGCGGGGCGGGGG"
     gene            <1043365..>1044241
                     /locus_tag="BRARA_H00125"
                     /db_xref="Phytozome:Brara.H00125"
     mRNA            join(<1043365..1043718,1044014..>1044241)
                     /locus_tag="BRARA_H00125"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00125"
     CDS             join(1043365..1043718,1044014..1044241)
                     /locus_tag="BRARA_H00125"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49318.1"
                     /db_xref="Phytozome:Brara.H00125"
                     /translation="MKGYIIALIVCGCFAIIVVGLILWCLQNRKKKKAWSPSPPPPVS
                     DVEKCRSSVVPRDGGLLVLTGTAVTTPVVAAAVTTGISKDISGGSGGDEGGGECDGGA
                     NGGGLLWLWRFWRAWRNSNYSKILTIRKWKGLFENVFVTTQFVETIHSMGKLICRPIG
                     MEILLKGEILDLRNIKRINNLHIRVSEDLHVKN"
     gene            <1058982..>1059311
                     /locus_tag="BRARA_H00126"
                     /db_xref="Phytozome:Brara.H00126"
     mRNA            <1058982..>1059311
                     /locus_tag="BRARA_H00126"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00126"
     CDS             1058982..1059311
                     /locus_tag="BRARA_H00126"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49319.1"
                     /db_xref="Phytozome:Brara.H00126"
                     /translation="MDTFVIVIIIVCAGIVLPSLVLCCVLTHRKQRPLVSQSRDLEMG
                     QTGSKDGGLVVLTRNVSTTATTVAAAVIIADSGGGGGCCCGCDDGGGGDGGGDGGGCG
                     GCGGCGG"
     gene            1079336..1081508
                     /locus_tag="BRARA_H00127"
                     /db_xref="Phytozome:Brara.H00127"
     mRNA            join(1079336..1079622,1079835..1079963,1080051..1080158,
                     1080241..1080375,1080748..1080789,1080890..1080949,
                     1081029..1081107,1081202..1081508)
                     /locus_tag="BRARA_H00127"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00127"
     CDS             join(1079386..1079622,1079835..1079963,1080051..1080158,
                     1080241..1080375,1080748..1080789,1080890..1080949,
                     1081029..1081107,1081202..1081293)
                     /locus_tag="BRARA_H00127"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49320.1"
                     /db_xref="Phytozome:Brara.H00127"
                     /translation="MVVATRFSRLQHLLLLQPRFQQSRVLRRPLIRTPTLIRSVMGSS
                     SSSSSKLLFRQLFEKESSTYTYLLADISHPDKPALLIDPVDKTVDRDLKLINELGLKL
                     VYAMNTHVHADHVTGTGLLKTKVPGVKSVISKASGSKADKFVEHGERVSIGDLYLEVR
                     ATPGHTAGCVTYVTGEGADQPQPRMAFTGDAVLIRGCGRTDFQGGCSDQLYESVHSQI
                     FTLPKDTLIYPAHDYKGFEVSTVGEEMQHNPRLTKDKETFKTIMSNLNLPYPKMIDVA
                     LPANMVCGLQDLPSQAN"
     gene            <1101317..>1102518
                     /locus_tag="BRARA_H00128"
                     /db_xref="Phytozome:Brara.H00128"
     mRNA            join(<1101317..1101426,1102044..>1102518)
                     /locus_tag="BRARA_H00128"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00128"
     CDS             join(1101317..1101426,1102044..1102518)
                     /locus_tag="BRARA_H00128"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49321.1"
                     /db_xref="Phytozome:Brara.H00128"
                     /translation="MVKNVFNIQYGNQQNESCRMYEGYVVLCSLTRREDKTLKQTNRK
                     GDALRHTYPSPKIRYGSRRRQLHSSPASLLLAMLCSLLSCFSFLCYFASRISRGVWFC
                     GSLRRGWLRSSSLLSLQASFDGWGLPPRTPPAAVHTDDCSFSLSWLDFIDLRLNSVSD
                     KPSWLQHGNVEAAKTTFHHPQLRRSDNFHQNPSS"
     gene            complement(1108534..1112250)
                     /locus_tag="BRARA_H00129"
                     /db_xref="Phytozome:Brara.H00129"
     mRNA            complement(join(1108534..1109028,1109277..1109479,
                     1109554..1109847,1110192..1110315,1110402..1112250))
                     /locus_tag="BRARA_H00129"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00129"
     CDS             complement(join(1108725..1109028,1109277..1109479,
                     1109554..1109847,1110192..1110315,1110402..1112080))
                     /locus_tag="BRARA_H00129"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49322.1"
                     /db_xref="Phytozome:Brara.H00129"
                     /translation="MAADSNDNRRDVVVKIDGEDNDSSNNGEGGKFWRESSYNFWHGD
                     QKDKNGKPHGGGDDGSFDFMHRRNEKTAETDPPSKLINQFLDKQKAAGDEISLDMEPN
                     MPELQSNTVSPSPVTGSASPGGYRNETVDAVRRRHNRVTLSPSVKESDSSEEDENRVD
                     ESEVVKCSSNRSLRTKTLMKMKTRSRLMDPPTPSYPEMVSGRTPKSGHLKTGKNTKPG
                     TPVQDLEEEEDPFSEEDFPEGYKKDKLNLGIVMEWIFLILIIAGLICSLVIPFLRGKK
                     LWNLALWKWEVMVLVLICGRLVSSWIVKIFVFFVESNFMLRKRVLYFVYGIRKPVQNC
                     LWLGLVLIAWHFLFDKKVERETNTTVLKYVTKVLVCLLVAVIIWLIKTLLVKVLASSF
                     HMSTYFDRIQESLFTQYVIETLSGPPRVVIHIEEEKVANGMGGAKQSPSGPKTVSSAS
                     PQVTIGSGRLQRSPTRVGKSPALSRSGSKKEGEDDGIRIDHLQRMNTKNVSAWKMKRL
                     MNVIRKGALSTLDEQIDTSTHEDDKATQIRSEFEAKLAARKIFQNVAEPGSRYIYIED
                     FMRFLTEDESERAMDLFEGASESHKISKSCLKNWVVNAFRERRALALTLNDTKTAVNR
                     LHRIINVLVSIVIVIIWLLILGIATTKFLLVISSQLLLVVFVFGNSCKTIFEAVIFVF
                     VMHPFDVGDRCEIDGVQMIVEEMNILTTVFLRYDNQKIVYPNSLLGTKPIANYYRSPD
                     MQDAIEFFVHIATPHEKITALKQRILSYVDNKKDHWHPSPMMVFRDMCGLNSVKIAMW
                     PTHKMNHQDMGERFVRRGQLLEEIGRSCRELDIEYRLYPLNINVKSIPPAATPITSDR
                     IPLSWTQQRNA"
     gene            1113542..1114218
                     /locus_tag="BRARA_H00130"
                     /db_xref="Phytozome:Brara.H00130"
     mRNA            1113542..1114218
                     /locus_tag="BRARA_H00130"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00130"
     CDS             1113570..1113791
                     /locus_tag="BRARA_H00130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49323.1"
                     /db_xref="Phytozome:Brara.H00130"
                     /translation="MVIVPSGTSDKIGTIQRRLAWPLRKDDTHKSRNGPNFFFSFFFS
                     NRSPSSSSSVKPVSRFHDSQFKFWMSIRS"
     gene            <1120777..>1121895
                     /locus_tag="BRARA_H00131"
                     /db_xref="Phytozome:Brara.H00131"
     mRNA            <1120777..>1121895
                     /locus_tag="BRARA_H00131"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00131"
     CDS             1120777..1121895
                     /locus_tag="BRARA_H00131"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49324.1"
                     /db_xref="Phytozome:Brara.H00131"
                     /translation="MARKRKRSGDGINTPLDLTVEILHRLPAKSLARTRCVSKQWRTI
                     IDDYIVKNSVVTRSLSQPSPDAPHFILDTLLDCGVVFSYTYSRQIRSERNQIVEKMFA
                     MTATAREFQYVRGLIGFWSCTRGQFTLHNPTTRRSVPLPDTGIPPRRFYLFGYDPLRN
                     QYKVACIARPTSEPEQSCKVFTLGDLGQEWRNIKCCIERHSPFGTAVCIGGTIYYTAK
                     AENQRNVIISFNVVSEKFSHVFQVPEKLNVRYGKSSLVDYQGKLGCICYNYLNNEDMD
                     VWVIENAEKQEWSKITHMAVLQGIPSSMCRFGVTHPGGEIVIVPYFYYYLGSEGYYYN
                     PNINSRRSFVIQSPRLGGTDLVRIWPVTDPVENIMSLM"
     gene            1131122..1136728
                     /locus_tag="BRARA_H00132"
                     /db_xref="Phytozome:Brara.H00132"
     mRNA            join(1131122..1131162,1131555..1131673,1135066..1136728)
                     /locus_tag="BRARA_H00132"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00132"
     mRNA            join(1131224..1131673,1135066..1136728)
                     /locus_tag="BRARA_H00132"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00132"
     CDS             1135066..1136406
                     /locus_tag="BRARA_H00132"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49325.1"
                     /db_xref="Phytozome:Brara.H00132"
                     /translation="METVKPRAVAPKGKFRRTFAKVLNIHKLTGVAPDVKKIKLDSKN
                     SNISESFYKLEEEYERRLSLEALLAKLFATLSTIKAGYAQLQHSQSPYDAIGIQKADN
                     LVVSELKTLSELKQCFLKKQMDPNPERTLVLAEIQELRSLLKTYEVMGRKLESQCKLK
                     DSEILFLREKLEETTKQNKLTEKRLNQSGQLCNPLDNLHLSALNPTHFVAYLNHTVKS
                     IRGFVKLMVQQMKLAGWDLSMAANSIQPGVVYYKQDHKCFPFEHFVSNVMFEAFHLPH
                     FSTDSRSFKKQSKTEKQSKTEREAFFERFTELRSMKARDYLNARPRSRFARFCRAKFL
                     QLIHPKMEEAFFGHTHLRNQVSAGVFPETSLCSGFLEMAKRVWLLHCLALSFEHEAEI
                     FRVQKGCRFSEVYMKSVAEEALEETELPRVAFTVVPGFRVGNSLVQCEVYLSGS"
     CDS             1135066..1136406
                     /locus_tag="BRARA_H00132"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49326.1"
                     /db_xref="Phytozome:Brara.H00132"
                     /translation="METVKPRAVAPKGKFRRTFAKVLNIHKLTGVAPDVKKIKLDSKN
                     SNISESFYKLEEEYERRLSLEALLAKLFATLSTIKAGYAQLQHSQSPYDAIGIQKADN
                     LVVSELKTLSELKQCFLKKQMDPNPERTLVLAEIQELRSLLKTYEVMGRKLESQCKLK
                     DSEILFLREKLEETTKQNKLTEKRLNQSGQLCNPLDNLHLSALNPTHFVAYLNHTVKS
                     IRGFVKLMVQQMKLAGWDLSMAANSIQPGVVYYKQDHKCFPFEHFVSNVMFEAFHLPH
                     FSTDSRSFKKQSKTEKQSKTEREAFFERFTELRSMKARDYLNARPRSRFARFCRAKFL
                     QLIHPKMEEAFFGHTHLRNQVSAGVFPETSLCSGFLEMAKRVWLLHCLALSFEHEAEI
                     FRVQKGCRFSEVYMKSVAEEALEETELPRVAFTVVPGFRVGNSLVQCEVYLSGS"
     gene            1138087..1139551
                     /locus_tag="BRARA_H00133"
                     /db_xref="Phytozome:Brara.H00133"
     mRNA            1138087..1139551
                     /locus_tag="BRARA_H00133"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00133"
     CDS             1138111..1139226
                     /locus_tag="BRARA_H00133"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49327.1"
                     /db_xref="Phytozome:Brara.H00133"
                     /translation="MILANLPNDLESEILARVPAKSLSQLKTTCKRWYALLRDPKFVE
                     KNKKMSSEAARESMLLSNHEVYSIAGDIHSSGDVAQPLEFTGKLSKDLDLYTISHCDG
                     LMLCQAKNNSSVVVWNPCTGETKMIEPRTRYQIRDRFALGYDSSRRGYKILRFGYYQN
                     EEKVWFVECEMYDLSSGSWRVVDSFTLDYRMYCSGVSLRGDTYFVAGDQDSSFFLMKF
                     DFTAERFVRLPLPFQTFDPEDTAVLSVVRDEKLSVCHQEIHSWSNVMRIWVSNKVDEE
                     GKVLSWRKDFVLTVDFDKFQLRCVVNVASFLLDEEKKVAVCCDVCDEDMKGEAKNRIY
                     IVGEDMYKQVHNDGIVNASLLNCPLVLTYVPSLVHIH"
     gene            complement(1145034..>1146201)
                     /locus_tag="BRARA_H00134"
                     /db_xref="Phytozome:Brara.H00134"
     mRNA            complement(1145034..>1146201)
                     /locus_tag="BRARA_H00134"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00134"
     CDS             complement(1145185..1146201)
                     /locus_tag="BRARA_H00134"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49328.1"
                     /db_xref="Phytozome:Brara.H00134"
                     /translation="MNLGVKMVQKKVAVLYHYPCHDGVFAALAAHLYFSANSIPSLFF
                     PNTVYSPITISQLPLQDISHLYLLDFTGPPGFVQQVSPKVDSVVILDHHKTAIDTLGD
                     VSTTCKNVTKVLDITRSGATIAFDYFTQKLKDETRGNCREMSDFKRMRRVFEYIEDAD
                     IWKWKLPESKAFNSGIIDLGIEYNFNQNSSLFQQLLSLDHDSVINRGKESLCRKHKLI
                     HEALEHSYEIVLGGAEEFGRCLAVNADEIAELRSELGNQLAEKSKGMRLRGVGAVVYR
                     VPELGDETKLKISLRSVAEEDTTVVSQRFGGGGHKNASSFLLSSTEFEQWKVKRISCY
                     NTIN"
     gene            complement(1146478..1147938)
                     /locus_tag="BRARA_H00135"
                     /db_xref="Phytozome:Brara.H00135"
     mRNA            complement(1146478..1147938)
                     /locus_tag="BRARA_H00135"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00135"
     CDS             complement(1146519..1147898)
                     /locus_tag="BRARA_H00135"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49329.1"
                     /db_xref="Phytozome:Brara.H00135"
                     /translation="MSAVKKVSSFRLASLLRRENDPSAAIKLFRNPDPESTNPQKPFR
                     YSLLCYDLIITKLGRSKMFDELDQILLQLKSDTRIVPTEILFCNVIKYFARGRLPTRA
                     LHVFDEMPQYRCQRTMKSANSLLNALLKCGAFDETKEVLTRVGEFGKPDACTYNILIN
                     GYSQSGRFDEALKLFDEMVKKKVKPTGVTFGTIIRMLCNDLKVKEALKMKHDMLKVYG
                     VFPTVHIYASLIKALCQVGELGLAFKLKDEVKADSAIYSTLISSLIKAGRSDEVSGIL
                     EEMREMGCEPDTVTYNVLINGFCLENDLKSAYKVLDEMVEKGLKPDVISYNVILGALF
                     RIQNWKEGAYLFEDMPRRGCVPDVLSYRIVFDGLCEGVQFEEAAVILDEMVFKGYKPR
                     RDRLKRYLQRLCESGKVEILGDVISSLNKGNAYDADFWSVTVPEVCKEPVLSDSIDLL
                     LNKLKEECP"
     gene            1150793..1153540
                     /locus_tag="BRARA_H00136"
                     /db_xref="Phytozome:Brara.H00136"
     mRNA            join(1150793..1151220,1152049..1152136,1152565..1152694,
                     1152771..1153540)
                     /locus_tag="BRARA_H00136"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00136"
     CDS             join(1150864..1151220,1152049..1152136,1152565..1152694,
                     1152771..1153374)
                     /locus_tag="BRARA_H00136"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49330.1"
                     /db_xref="Phytozome:Brara.H00136"
                     /translation="MPLSRSLLSRRFSISFRESQGGKTPPEADSHQPPPPTTTKMMLP
                     PPPSNGAAGTSWSAMLPELLGEIIRRVEDSEDQWPHRRDVVSCACVSKKWREIAQEMV
                     RSPLNSGKITFPSCLKLPGPREFSNQCLIKRNKKTSTFYLYLALTPSFTDKGKFLLAA
                     RRFRTGAYTEYIISLDADDFSQGSNAYVGKLRSDFLGTNFTVYDSQPPHNGAKPSNGK
                     ASRRFASKQISPQVPAGNFEVGHVSYKFNLLKSRGPRRMISTLRCPSSSPPPPSSSST
                     DHQNPCDVVTKIMKKPNKDGSGLTILKNKAPRWHEHLQCWCLNFHGRVTVASVKNFQL
                     AATVDQSQPGGKGDEETVLLQFGKVGDDTFTMDYRQPLSAFQAFAICLTSFGTKLACE
                     "
     gene            complement(<1159342..>1159900)
                     /locus_tag="BRARA_H00137"
                     /db_xref="Phytozome:Brara.H00137"
     mRNA            complement(join(<1159342..1159396,1159749..>1159900))
                     /locus_tag="BRARA_H00137"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00137"
     CDS             complement(join(1159342..1159396,1159749..>1159900))
                     /locus_tag="BRARA_H00137"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49331.1"
                     /db_xref="Phytozome:Brara.H00137"
                     /translation="KQKPSLYRDGVTKEIVPSGTSDKIGTIQRRLAWPLRKDDTHKSR
                     NGPNFFWRLHLRLEEGPGASMAFL"
     gene            1164417..1169222
                     /locus_tag="BRARA_H00138"
                     /db_xref="Phytozome:Brara.H00138"
     mRNA            join(1164417..1164536,1164701..1164885,1165314..1165708,
                     1165782..1165866,1165948..1166274,1166353..1166443,
                     1166522..1166676,1166754..1167752,1168222..1168608,
                     1168694..1169222)
                     /locus_tag="BRARA_H00138"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00138"
     CDS             join(1164718..1164885,1165314..1165708,1165782..1165866,
                     1165948..1166274,1166353..1166443,1166522..1166676,
                     1166754..1167752,1168222..1168608,1168694..1168981)
                     /locus_tag="BRARA_H00138"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49332.1"
                     /db_xref="Phytozome:Brara.H00138"
                     /translation="MPHGKLEKMASMDVHLRQLVPGKVSEDDKLVEYDALLLDRFLDI
                     LQELHGEDLRETVQELYEHSAEYEGKHEPKKLEELGNVLTSLDPGDSIVIAKAFSHML
                     NLANLAEEVQIAYRRRIKKLKKGDFVDESSATTESDLEETFKKLVGDLNKSPEEIFDA
                     LKNQTVDLVLTAHPTQSVRRSLLQKHGRIRDCLAQLYAKDITPDDKQELDEALQREIQ
                     AAFRTDEIKRTPPTPQDEMRAGMSYFHETIWKGVPKFLRRVDTALKNIGIEERVPYNA
                     PLIQFSSWMGGDRDGNPRVTPEVTRDVCLLARMMAATMYFNQIEDLMFELSMWRCNDE
                     LRVRADELHVNRRKDAAKHYIEFWKSIPPTEPYRVVLGDVRDKLYHTRERARQLLSNG
                     TSDVPEEATFNNLEEFLEPLELCYRSLCSCGDRPIADGSLLDFLRQVSTFGLSLVRLD
                     IRQESDRHTDVLDAITTHLEIGSYREWSEERRQEWLLSELSGKRPLFGSDLPKTEEIA
                     DVLDTFHVIAELPSDSFGAYIISMATAPSDVLAVELLQRECHVKRPLRVVPLFEKLAD
                     LEAAPAAVARLFSVDWYKNRINGKQEVMIGYSDSGKDAGRLSAAWQLYKAQEELVKVA
                     KEYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTINGSLRVTVQGEVIEQSFGEEHL
                     CFRTLQRFTAATLEHGMRPPVSPKPEWRELLDEMAVVATEEYRSVVFQEPRFVEYFRL
                     ATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTRFHLPVWLGFGAAIRHVV
                     EKDVKNLHMLQDMYQHWPFFRVTIDLIEMVFAKGDPGIAALYDKLLVSEELWPFGEKL
                     RANFEETKKLVLQTAGHKDLLEGDPYLKQRLRLRNSYITTLNVCQAYTLKRIRDPSYN
                     VTLRPHISKEIAESSKELIELNPTSEYAPGLEDTLILTMKGVAAGLQNTG"
     gene            complement(1172137..1175481)
                     /locus_tag="BRARA_H00139"
                     /db_xref="Phytozome:Brara.H00139"
     mRNA            complement(join(1172137..1172686,1172762..1173073,
                     1173143..1173661,1173895..1174090,1174360..1175481))
                     /locus_tag="BRARA_H00139"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00139"
     CDS             complement(join(1172534..1172686,1172762..1173073,
                     1173143..1173661,1173895..1174090,1174360..1175192))
                     /locus_tag="BRARA_H00139"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49333.1"
                     /db_xref="Phytozome:Brara.H00139"
                     /translation="MSPSGKPVPPRDSSLTSEINKPDFRELDLGSPVSPLRSQPRGLT
                     TTTTTSSSSSSSSGSVTRQHAPVNGRSGSVRGSSQSGSSSGNLRTSQARSDSVTSNSQ
                     QPLVSSSTQSSATSPATAANVLPTGNICPSGKIQLTGMTQSRSRSDVLGSGTGTYGHG
                     SIMRGGGGSGVSPAKPVAPVTVGGSIRSSPAAMLGSDAEEVKRVGNEMYRKGLFGEAL
                     KLYDRAIALSPANAAYRSNRAAALTGLGRVGEAVKECEEALRLDPNYGRAHQRLASLL
                     IRLGQVDNARKHLCVLGKPSDPMELQKLEAVEKHISKCADARKLGDWKAALMGVDAAI
                     VAGADFSPQLGMCKVEALLKLHRLDAAQSKLLEALKVEPFPASCSQTRFSGIACEAYT
                     YFVKAQIEMALGRFENAVMAAEKASKLDPRSNEVAMLHNTVTLVARSRVRGNDLYKSE
                     RYTEASSAYAEGLRLDPCNAILYCNRAACWFKLGMWERSIEDCNHALRFQPRYTKPLL
                     RRAASNSKVERWAAAVSDYEALRKELPHDKEVAESLFHAQVALKKSRGEEVLNMEFGG
                     EVEEVYSREQFKAAMNLPGVSVIHFSTASDHQCKQLSPFVDSLCTRYPSIHFLKVDID
                     KCPSIGNAENVRVVPTVKIYKNGTRVKEIVCPSKEVLEYSVRHYSS"
     gene            1182937..1185280
                     /locus_tag="BRARA_H00140"
                     /db_xref="Phytozome:Brara.H00140"
     mRNA            join(1182937..1183087,1183166..1183366,1183470..1183619,
                     1183712..1183897,1184220..1184300,1184435..1184635,
                     1184710..1184850,1184963..1185280)
                     /locus_tag="BRARA_H00140"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00140"
     CDS             join(1182959..1183087,1183166..1183366,1183470..1183619,
                     1183712..1183897,1184220..1184300,1184435..1184635,
                     1184710..1184850,1184963..1185160)
                     /locus_tag="BRARA_H00140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49334.1"
                     /db_xref="Phytozome:Brara.H00140"
                     /translation="MAFHCLNPITATPFSSTRLHRSTWRRTSRSFSVSATMASPAKRV
                     LIPVAHGTEPFEAVAMIDVLRRGGADVTVASVENQVGVDACHGIKIVADALLSDVNDS
                     VFDLIMLPGGLPGGETLKNCKPLENMVKKQDSEGRLNAAICCAPALALGTWGLLEGRR
                     ATCYPVFMEKLGATCGTAVESRVEVDGRIVTSRGPGTTMEFSVTLVEQLFGKEKAAEV
                     SAPLVMRPNPGDEYTITELNQMNWSFDSTPQILVPIADGSEEMEAVAIIDFLRRAKAN
                     VVVAALGNSLEVVASRKVKLVADVLLDEAVKNSYDLIVLPGGLGGAEAFASSEKLVNM
                     LKKQAESSKPYGAICASPALVFEPHGLLKGKKATAFPAMCNKLSDQSHIEHRVLVDGN
                     LITSRGPGTSLEFALTIVEKFYGREKGLQLAKATLV"
     gene            complement(<1185347..>1187113)
                     /locus_tag="BRARA_H00141"
                     /db_xref="Phytozome:Brara.H00141"
     mRNA            complement(<1185347..>1187113)
                     /locus_tag="BRARA_H00141"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00141"
     CDS             complement(1185347..1187113)
                     /locus_tag="BRARA_H00141"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49335.1"
                     /db_xref="Phytozome:Brara.H00141"
                     /translation="MELPVKAPVSGCRKISYKLETKNLSYRLYGNTSKFSNLCGLLNE
                     KEEKVILKDVSCDARSGEITAIAGPSGAGKTTLLEILAGKVSQGKVSGQVLVNGRPMN
                     GPEYRRVSGFVPQEDALFPFLTVQETLTYSALLRLKTNRKEAKAKVKKLMEELGLEHV
                     ADSRIGEGSRSGISGGERRRVSIGVELVHDPNVILIDEPTSGLDSASALQVVMLLKDM
                     TIKQGKTIVLTIHQPGFRILEQINRIVLLSSGLVVQNGSVNSLYQKIKFFGHQIPRRV
                     NVLEYAIDIAGSLEPVLTQSCREISCYGHGKTWKSNNAGREFHQPDSHSNSVLEEVQI
                     LGQRSCKNIFRTKQLFTTRALQASIAGLILGSIYLNVGNQKQEGRVLRTGFFAFTLTF
                     LLSSTTEGLPIFLQDRRILMRETSRRAYRVLSYVLADTLIFIPFLLIISMLFATPVYW
                     LVGLRRELDGFLYFSLVIWIVLLMSNSFVACFSALVPNFIMGTSVISGLMGSFFLFSG
                     YFIAKDRIPVYWEFMHYLSLFKYPFECLMINEYRGDVFLKEQDLEESQKWSNLGIMAS
                     FIVGYRVLGFFILWYRCYKTKR"
     gene            complement(1188649..>1189436)
                     /locus_tag="BRARA_H00142"
                     /db_xref="Phytozome:Brara.H00142"
     mRNA            complement(join(1188649..1188960,1189044..>1189436))
                     /locus_tag="BRARA_H00142"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00142"
     CDS             complement(join(1188736..1188960,1189044..>1189436))
                     /locus_tag="BRARA_H00142"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49336.1"
                     /db_xref="Phytozome:Brara.H00142"
                     /translation="DETKEKIRASMKQIWAERLRSKRLKEKFTSLWSESIAEAARRGG
                     SGEVELDWDSYEKAKLEILSEEKARTKEQNRVRAEEAKTEKKVRRVVERQKERQERDQ
                     RGGKTRKPQQSKESATTASRSKLKKRLTKIHKKKTSLGKVAIGKDKVVSVAAKLEKLD
                     LELIMKERRRGDISLSDQIQAAKNQRGNDFSSRFGLFAMKSMDFD"
     gene            1191814..1193866
                     /locus_tag="BRARA_H00143"
                     /db_xref="Phytozome:Brara.H00143"
     mRNA            join(1191814..1192111,1192256..1192429,1192727..1192895,
                     1192986..1193047,1193131..1193252,1193323..1193440,
                     1193537..1193866)
                     /locus_tag="BRARA_H00143"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00143"
     CDS             join(1191869..1192111,1192256..1192429,1192727..1192895,
                     1192986..1193047,1193131..1193252,1193323..1193440,
                     1193537..1193674)
                     /locus_tag="BRARA_H00143"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49337.1"
                     /db_xref="Phytozome:Brara.H00143"
                     /translation="MFRSALVRSSASAKQSLLRRSFSSGSVPERKVAILGAAGGIGQP
                     LALLMKLNPLVSSLSLYDIANTPGVAADVGHINTRSQVVGYMGDDNLAKALEGADLVI
                     IPAGVPRKPGMTRDDLFNINAGIVKNLCSAIAKYCPHALVNMISNPVNSTVPIAAEIF
                     KKAGMYDEKKLFGVTTLDVVRAKTFYAGKANVPVAEVNVPVIGGHAGVTILPLFSQAT
                     PQANLSGDVLTALTKRTQDGGTEVVEAKAGKGSATLSMAYAGALFADACLKGLNGVPD
                     VVECSYVQSTITELPFFASKVRLGKNGVEEVLDLGPLSDFEKEGLEALKPELKSSIEK
                     GVKFANQ"
     gene            1202254..1203686
                     /locus_tag="BRARA_H00144"
                     /db_xref="Phytozome:Brara.H00144"
     mRNA            1202254..1203686
                     /locus_tag="BRARA_H00144"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00144"
     CDS             1202350..1203378
                     /locus_tag="BRARA_H00144"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49338.1"
                     /db_xref="Phytozome:Brara.H00144"
                     /translation="MADEESNHHHSIHSPSSLGMRHQSVFSTAAEHGGCGEIVEVEGG
                     HIVRSTGKKDRHSKVCTAKGPRDRRVRLSAPTAIQFYDVQDRLGLDRPSKAVDWLIMK
                     AKSAIDNLAELPPWNPADTIRQAAANKPKRPKTVIPPPETGIHGGSGKETEHHHHQSS
                     FLPASLSTPDYHPPPSSRANAQSQDLRLSLHSFQNGPAFADETEHALFSGQSNPLVFD
                     SSTASCDQSPEFGKMQRLVTWNNGGAADSAAFGGGGFVFASPATTTSFQPQSQVFSQR
                     GPLQSINTPMPPRAWFDPYHDHHHNHHHHPYHISPAIHQSAIPARYLSEEDGHGDKPS
                     SASSDSRH"
     gene            complement(1210878..1213922)
                     /locus_tag="BRARA_H00145"
                     /db_xref="Phytozome:Brara.H00145"
     mRNA            complement(join(1210878..1211592,1211670..1211949,
                     1212428..1212573,1212666..1212847,1212923..1213108,
                     1213451..1213922))
                     /locus_tag="BRARA_H00145"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00145"
     CDS             complement(join(1211029..1211592,1211670..1211949,
                     1212428..1212573,1212666..1212847,1212923..1213108,
                     1213451..1213844))
                     /locus_tag="BRARA_H00145"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49339.1"
                     /db_xref="Phytozome:Brara.H00145"
                     /translation="MRFRSLISLLFLLFFTSSAYARLVSLHPSSTDLISDGVNGEPLI
                     NSRSIIKTVVSAEEKEEACEQTYGFMPCTKTALGNVFLILVYGFLMFTAATYLSAGSE
                     LLLEILGPGIVGGLFLPMLGALPDAMLIMVSGLSGDAATAQTQVSVGMGLLAGSTVML
                     LTVIWGTCTVVGKCDLRDSIAVNNQDTKGFHLKDSGVTVDVWTSYAARIMAISVIPFI
                     IVQLPQMLDSTSGRHLAVLVALILSVLMLISYCVYQVFQPWIQRRRLAFAKHKHVISG
                     ILRHLKQHALGRLLNDEGQPDEHVIRRLFETIDANKDGHLSAAELKALIIGISFEDID
                     FDKDDAVGKVLQDFDKTLDEQVDQEEFVRGIKRWLIQAMGAAGPSGPDAGPRTMKFLD
                     HFHVQTKREHALLGDNENGENDEESGEVADPKWITIKAALLLLLGAAIAAAFADPLVD
                     TVNNFSAATGIPSFFISFIALPLATNSSEAVSAIIFASRKKIRTASLTFSELCGGVTM
                     NNILCLSVFLAIVYLRGLTWNFSSEVLVILIVCLVMGGFASFRTTYPLWTCFIAYLLY
                     PFSLGLVYILDYWFGWS"
     gene            complement(1229861..1231286)
                     /locus_tag="BRARA_H00146"
                     /db_xref="Phytozome:Brara.H00146"
     mRNA            complement(join(1229861..1230266,1230353..1231286))
                     /locus_tag="BRARA_H00146"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00146"
     CDS             complement(join(1229985..1230266,1230353..1231099))
                     /locus_tag="BRARA_H00146"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49340.1"
                     /db_xref="Phytozome:Brara.H00146"
                     /translation="MNLSSSSESLIDDLLDDYWFFENLFTRRSRVLRYCHSDPYPSSS
                     SSLTSPEKVGDLDEKKSLEASTGRCLIRAASIDGRKGETKQFSEKTRVQEPRPVGSFL
                     RQKEPVVLPKSAGSCSAPGKIQEASTDRCLVRAPSLPPRIEKRNVDYEAKKMISKLTR
                     QFSEKIRVLEPKTTGERYLHKKKRNSERNMTEGGSSSSSSSSSVKISLQRTQTMPNNI
                     REEDELEDHETDSRMGFLIREALASSQNVPKVSINPRQRPPRQLRSEETVMVKQGSSS
                     SKTLRKTVSSIETTKEIQRLKGYDDQLVEPHGLATPPRVPKDSRKEMKDQIKFWARAV
                     ASNVRQEC"
     gene            1245188..1246092
                     /locus_tag="BRARA_H00147"
                     /db_xref="Phytozome:Brara.H00147"
     mRNA            1245188..1246092
                     /locus_tag="BRARA_H00147"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00147"
     CDS             1245304..1245870
                     /locus_tag="BRARA_H00147"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49341.1"
                     /db_xref="Phytozome:Brara.H00147"
                     /translation="MTKMGFKPDPNPNPIQGNAKEIRYRGVRKRPWGRYAAEIRDPRK
                     KTRVWLGTFDTAQQAARAYDAAAREFRGAKAKTNFPTSLELNVNDGGYSRSPSQSSTV
                     DSASPTAARLVTPPQLELSLGNGGGACCQIPVARHVYFFNMTAFPLAATCGVQSESDS
                     SSVVDFEGGAEKKSQPLDLDLNLAPPAE"
     gene            complement(1249339..1250770)
                     /locus_tag="BRARA_H00148"
                     /db_xref="Phytozome:Brara.H00148"
     mRNA            complement(1249339..1250770)
                     /locus_tag="BRARA_H00148"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00148"
     CDS             complement(1249611..1250708)
                     /locus_tag="BRARA_H00148"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49342.1"
                     /db_xref="Phytozome:Brara.H00148"
                     /translation="MSLLLGYSPKLFIRKPVLVRASGGGSSSLVQTPPCFILGADPCG
                     ADHVLLEYAYSMKNHPRLRKKAPEQLVYNDAEVTTIGSSHGWVASLMHGVGTLCLHDD
                     LNPVASDANPKRILLPPLVTVPHCQTQIVTNVSLSSPSPEDEDCVVAVKFLGPQLSYC
                     RPSSALGSKSKWFNIRIANPSFFSSRVMFSEKLNMFRIPGAGGQVIGSWDLCKDQHTP
                     KILVLRYRYLPELSEAEREVMDTCFTTEHLVESQSTGETFLVKCFRQSVNGGTSWETK
                     AVMVFRVLPLGNALYTQDIGDLTIFISKSEAFCVRASSFPDVRPNEVYILEDTEIAFF
                     RLADSDISGHTKRVVAPYFIPPQNIEYQVWD"
     gene            <1253217..>1254353
                     /locus_tag="BRARA_H00149"
                     /db_xref="Phytozome:Brara.H00149"
     mRNA            <1253217..>1254353
                     /locus_tag="BRARA_H00149"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00149"
     CDS             1253217..1254353
                     /locus_tag="BRARA_H00149"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49343.1"
                     /db_xref="Phytozome:Brara.H00149"
                     /translation="MSLILSHSPKIFIRKPVLVRASAGGSSSPLQTPPCYIIGAKFAP
                     DNVELRFAYTSTDYPKPIKKAPVELVYNDINDPITPWLAEKFKEGNKVSDAAVTIGSS
                     HGWIASLLHGVGILRLHDDLNPAASDANPKRISLPPLVTLPHCQTQIITNVSLSSLSP
                     EEEDCVVAVKFMGPQLSFCRPSAQGDSKWFNIRIANPCFYSSRVMFSKKHNMFRIPGS
                     GGQLIASWDLCKDIKHTPKFQELRYHFLPEPTEAEREVMDTCLTTEHLVESQSTGETF
                     LVRCFRQTVKKGLLETKAVMVFNVSPKGNAVYTQDIGDLTIFISKAEPFCVRASSFPG
                     VRPNHVYMLDVMEIAFFKLADSFITTLTERMMAPYFFPPQNIEY"
     gene            <1260499..>1261605
                     /locus_tag="BRARA_H00150"
                     /db_xref="Phytozome:Brara.H00150"
     mRNA            <1260499..>1261605
                     /locus_tag="BRARA_H00150"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00150"
     CDS             1260499..1261605
                     /locus_tag="BRARA_H00150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49344.1"
                     /db_xref="Phytozome:Brara.H00150"
                     /translation="MSLLLSHSPKIFIRKPVLVRASAGRSSSPLQTPPCFVRGEDPCG
                     PDHVELRIAYATRSFPKVIKKAPVELVYNDASDAAVTTIGSSHGWVASLMHDVGTLRL
                     HDDLNPVASNSDPKRILLPPLVTLPHCQTQIITNVSLSSLSPEEEDCVVAVKFLGHQL
                     SFCRPASQSNSEWFNIKIDNPCFFSSRVMFSKRHNMFRIPGAGGQLIGSWDLCEDKHT
                     PKFQELRYHNLPELSKAERETMHSCFTSEHLVESRSTGETFLVKLFRQTVDGTSLKVK
                     GTKLKTKGVMVFKVDDHGNAVYTQDIGDLAIFLSKSEPFCVCASFLPGVLPNYVNILD
                     VRELAYFKLTDSSLISYTHRFKAPYFCPPQNIEY"
     gene            complement(1268031..1271314)
                     /locus_tag="BRARA_H00151"
                     /db_xref="Phytozome:Brara.H00151"
     mRNA            complement(join(1268031..1268469,1268543..1269014,
                     1269092..1269192,1269265..1269492,1269879..1270481,
                     1270565..1271314))
                     /locus_tag="BRARA_H00151"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00151"
     CDS             complement(join(1268251..1268469,1268543..1269014,
                     1269092..1269192,1269265..1269492,1269879..1270481,
                     1270565..1270921))
                     /locus_tag="BRARA_H00151"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49345.1"
                     /db_xref="Phytozome:Brara.H00151"
                     /translation="MGCVWCKPSAIEDSPKERLSSKPSSEYRVSRPVGSSRREESVRT
                     KERSDVVSVVRPVLSNSSRREKKLENVATPHFPIAKAAEGEYVAAGWPPWLASVAGEA
                     IKGWVPRRADSFEKLDKIGQGTYSNVYRARDLNQKKIVALKKVRFDNLEPESVRFMAR
                     EIQILRRLDHPNIIKLEGLVTSRMSCSLYLVFEYMEHDLAGLASHPAVKFSEPQVKCY
                     LQQLLSGLDHCHSRGVLHRDIKGSNLLIDNSGVLKIADFGLASFFDPRQTQPLTSRVV
                     TLWYRPPELLLGATRYGAAVDLWSTGCILAELYAGKPIMPGRTEVEQLHKIFKLCGSP
                     SEEYWVKSKLPHATIFKPTQPYKRVVDETFKEFPQPALALLETLLSVNPDDRGTATSA
                     LHSEFFSTRPLPCDPSSLPKYPPSKELDARMRDEESRRQGGGNREQRHQERRGTKESR
                     AIPAPEANAELVTSMQKRQSQSSTNRSRSEKFNPHPEEVASGFPIDPPRPSSQAFEPN
                     RESQGNIVLPPHKRASHSGPLTRRSASAKGRRTYQDPQKVSLQQETCRGMTRLPGSFK
                     EVSEEANQEENGRSNKKDPILLGYGSKGHKIHYSGPLVVPSGNMDQVLKDHDRHIQEA
                     VRRARIDKARVRKHQPEEDSSQQVSTNHPSSVSSR"
     gene            1283194..1286096
                     /locus_tag="BRARA_H00152"
                     /db_xref="Phytozome:Brara.H00152"
     mRNA            join(1283194..1283292,1283372..1283416,1283498..1283757,
                     1283826..1284068,1284206..1284401,1285518..1285689,
                     1285765..1286096)
                     /locus_tag="BRARA_H00152"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00152"
     CDS             join(1283613..1283757,1283826..1284068,1284206..1284401,
                     1285518..1285689,1285765..1285956)
                     /locus_tag="BRARA_H00152"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49346.1"
                     /db_xref="Phytozome:Brara.H00152"
                     /translation="MLTSNSKDKERSLSFLCCWYLGRRRVAMLLLLSLAFVVFVLGSY
                     TINKESSNSPNIHQSIETIEFGINQTPLSRELSSFYTGDSNNDQTTRGSDVDIIHPPP
                     SLPSHHPCDSFSFPPPPPPGLRRPGPRPCPVCYLSPEEALAHMPKHQFESPVLKNLTF
                     IHEESPVKHEEGQGGSEFGGYPSLEDRTNSFDIKEEHIPITNLFTCVWFNEVDRFTSR
                     DQLSFAVARDKIREKVDWSINMFLDCERRNFVKQVYHRDVLMNMKPPRASSSKVLPEP
                     LPLPRGKSVGGRANTGKKSPGQRGKRRHRKVSAGGRNMR"
     mRNA            join(1285498..1285689,1285765..1286096)
                     /locus_tag="BRARA_H00152"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00152"
     CDS             join(1285651..1285689,1285765..1285956)
                     /locus_tag="BRARA_H00152"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49347.1"
                     /db_xref="Phytozome:Brara.H00152"
                     /translation="MFLDCERRNFVKQVYHRDVLMNMKPPRASSSKVLPEPLPLPRGK
                     SVGGRANTGKKSPGQRGKRRHRKVSAGGRNMR"
     gene            1293585..1294843
                     /locus_tag="BRARA_H00153"
                     /db_xref="Phytozome:Brara.H00153"
     mRNA            join(1293585..1293717,1293787..1294216,1294460..1294843)
                     /locus_tag="BRARA_H00153"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00153"
     CDS             join(1293635..1293717,1293787..1294216,1294460..1294738)
                     /locus_tag="BRARA_H00153"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49348.1"
                     /db_xref="Phytozome:Brara.H00153"
                     /translation="MAKKVLMTANGDEVSRNIAIQLAKHGCRLVLMGNEASLRSTVDY
                     IRVSVDGAFPVELIGADMEADSEEAFYVAVQKAWTRLGSLDAFVNCCTYQGKMQDILR
                     VSEDEFKKITRINLTATWFILKAVASMMKENGTGGSIVFLATIASGERGLYPGADAYA
                     TAAAAIHQLVRASAMSLGKHKIRVNMISRGLHLGDEYPVSVGIDRAQKLVKDAAPLGQ
                     WLNPEKDIYSTVIYLISDGSCFMTGTTVMVDGAQSLTRPRLKSYM"
     gene            1321054..1324279
                     /locus_tag="BRARA_H00154"
                     /db_xref="Phytozome:Brara.H00154"
     mRNA            join(1321054..1321200,1321686..1322192,1322281..1322344,
                     1322424..1322563,1322636..1322947,1323163..1323470,
                     1323949..1324279)
                     /locus_tag="BRARA_H00154"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00154"
     CDS             join(1321129..1321200,1321686..1322192,1322281..1322344,
                     1322424..1322563,1322636..1322947,1323163..1323470,
                     1323949..1323994)
                     /locus_tag="BRARA_H00154"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49349.1"
                     /db_xref="Phytozome:Brara.H00154"
                     /translation="MDPDVMEIDPPPSASATRTRKPRKVNLEVIDVEQYHVDKMNKGK
                     AIQDGYNPSSHVSNGVIPIDVDSYTVVLKDIPTGVKVVMSTTQPCEFQNYSSKGTSKS
                     SRNSSNPFLATPSSAPQSLDFASLSASFAQNNQTVSSSAVQPVDSDASASSSSAEAVP
                     SSQANFLRDFKRFDTVEDFSDHHYLSKGKASKQHSKTWLKKVQADWKILENDLPETIF
                     VRACESRMDLLRAVIIGAEGTPYHDGLFFFDIQFPDSYPSAPPKVHYHSGGLRINPNL
                     YNCGKVCLSLLGTWTGNKREKWLPQESTMLQLLVSIQALILNQKPYFNEPGYEPTKGT
                     VSGEAHSKVYSENVFILSLKTMVYSMRKPPKHFEEFVHSHYFVRALDIAKACNAYKDG
                     APVGSILKGGVQGIEETSQSGSKKFRTDVAAFMKTVVGEFVKLGIKELEEKPKPPPVV
                     NANTESNTANRKRSRSSSIKEFLANIGRCVFQ"
     gene            1330067..1332474
                     /locus_tag="BRARA_H00155"
                     /db_xref="Phytozome:Brara.H00155"
     mRNA            join(1330067..1330361,1330430..1330475,1331277..1331363,
                     1331443..1331567,1331644..1331783,1331859..1331910,
                     1332005..1332115,1332181..1332474)
                     /locus_tag="BRARA_H00155"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00155"
     CDS             join(1330146..1330361,1330430..1330475,1331277..1331363,
                     1331443..1331567,1331644..1331783,1331859..1331910,
                     1332005..1332115,1332181..1332273)
                     /locus_tag="BRARA_H00155"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49350.1"
                     /db_xref="Phytozome:Brara.H00155"
                     /translation="MALSSSPSSQKTWIVHGILAGTAIAAAIGARAYLGRSRKFRSRV
                     VGIIPARYASSRFEGKPLVQILGKTMIQRTWERSKLASTLDHVVVATDDERIADCCRG
                     FGADVIMTSESCRNGTERCNEALEKLEKKYDVVVNIQGDEPLIEPEIIDGVVKALQVA
                     PDAVFSTAVTSLKPEDGLDPNRVKCVVDNRGYAIYFSRGLIPYNKSGKVNPDFPYMLH
                     LGIQSFDSKFLKVYSELQPTPLQLEEDLEQLKVLENGYKMKVIKVDHEAHGVDTPDDV
                     EKIESLMRERNLL"
     gene            <1343686..>1344257
                     /locus_tag="BRARA_H00156"
                     /db_xref="Phytozome:Brara.H00156"
     mRNA            join(<1343686..1343755,1343833..>1344257)
                     /locus_tag="BRARA_H00156"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00156"
     CDS             join(1343686..1343755,1343833..1344257)
                     /locus_tag="BRARA_H00156"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49351.1"
                     /db_xref="Phytozome:Brara.H00156"
                     /translation="MEKRVLYGLVVMLMYLVGGGYSQGVVEWIRDKAEWEEILVKTEI
                     HIGVMVTSPLCGAPCDIVNDQVARFVETYGDRIKFYKVNILETLFFALDYKILTVPTV
                     IIFKEGTINIRFESLSDWSMFYELLVNSSIIDFPPDLSPAPAPAPSDSDPDADLPPPL
                     QSGE"
     gene            complement(1357131..>1358061)
                     /locus_tag="BRARA_H00157"
                     /db_xref="Phytozome:Brara.H00157"
     mRNA            complement(join(1357131..1357386,1357519..1357724,
                     1357972..>1358061))
                     /locus_tag="BRARA_H00157"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00157"
     CDS             complement(join(1357155..1357386,1357519..1357724,
                     1357972..1358061))
                     /locus_tag="BRARA_H00157"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49352.1"
                     /db_xref="Phytozome:Brara.H00157"
                     /translation="MASKLVIIIVFILDLIAVGLAIAAEQRRSVGKVVPDKEKVYEYC
                     EYGSDIATSYGAGAFVLLLTTQVIIMLASKCFCCGKALSPGGSRACAIILFLICWVFF
                     LIAEICLLAASIRNAYHTKYRKMWNVDEPPSCEVIRKGVFAAGASFALFTAIVSQFYY
                     VCYSRARDDYKNPPY"
     gene            <1359772..>1361161
                     /locus_tag="BRARA_H00158"
                     /db_xref="Phytozome:Brara.H00158"
     mRNA            join(<1359772..1360908,1361093..>1361161)
                     /locus_tag="BRARA_H00158"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00158"
     CDS             join(1359772..1360908,1361093..1361161)
                     /locus_tag="BRARA_H00158"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49353.1"
                     /db_xref="Phytozome:Brara.H00158"
                     /translation="MDLLSAPPPAPSEPPWPPDLCLISREASSIPAGNLASSMFLHPE
                     VPPLHPLLPLLPSPQITSPPLLVPLAPPASSSKPSTATAGPSSSPSSASWVSKLKSSA
                     HNLKKMASPTFAEDGTPVVMAPESVILKSSDIWKGYLVAQFHGTPPSPAKIFADLNPI
                     WGKQGRIRVRYHSKNVCLIFIPCEIIRKWVLDVGFWHSGKCAFSVFEWSPKINLAPMR
                     LEYAPVWVLFRGIPQELWSLECFSTFATGVGFPVQSEFPKLPPYSNGVVKLKVIIKLA
                     GKRASTVKVVDKLGNSVFISAEYLKVPHKCGICSEFGHSELRCPDRQLQNTAIATDNA
                     APPPAFAASPAGSAASPAASPADNLNNAAQSSTSARAAVVPTPPSLWPTLHLSDQSLL
                     LNSIQKKSL"
     assembly_gap    1365023..1375022
                     /estimated_length=unknown
                     /gap_type="between scaffolds"
     gene            complement(<1375274..>1376987)
                     /locus_tag="BRARA_H00159"
                     /db_xref="Phytozome:Brara.H00159"
     mRNA            complement(join(<1375274..1375504,1375596..1375713,
                     1376491..1376547,1376578..>1376987))
                     /locus_tag="BRARA_H00159"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00159"
     CDS             complement(join(1375274..1375504,1375596..1375713,
                     1376491..1376547,1376578..>1376987))
                     /locus_tag="BRARA_H00159"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49354.1"
                     /db_xref="Phytozome:Brara.H00159"
                     /translation="TIASSTEPYKKLLSVVFEEAVGLRPKPETSETQEEEEGNELKRK
                     LFELEKKLTELKNTEPVIKKKLKKVVGTVPELQTEKSRNLYTLFKANEEKREEEHDVV
                     RVYKELPLEMVSFVKLLHKKGYLNKANFISGEKLETFVKFAAERFGKDYQEIAKWLSG
                     SDLKNIVLFGCPSLEKRAIFAAKTLRKFFDIHENNVCEKCVLKDKCKFPNQSVWDGKS
                     QNLHLSVVMKVITLYPLDLTHPKLQVPQEVQDSVSRLLTEIQNLSRTICTPLA"
     assembly_gap    1377044..1387043
                     /estimated_length=unknown
                     /gap_type="between scaffolds"
     gene            complement(1418462..>1419347)
                     /locus_tag="BRARA_H00160"
                     /db_xref="Phytozome:Brara.H00160"
     mRNA            complement(join(1418462..1418648,1418768..1418908,
                     1419291..>1419347))
                     /locus_tag="BRARA_H00160"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00160"
     CDS             complement(join(1418508..1418648,1418768..1418908,
                     1419291..1419347))
                     /locus_tag="BRARA_H00160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49355.1"
                     /db_xref="Phytozome:Brara.H00160"
                     /translation="MSSNQELSYKAGEATGQVQLKKEECLDNVSHSMNKNADHHTQLQ
                     SHSEHDQNNPSLISQASNVIQQTGGQVKNMAQGAADAVKNSLGMSPATNNPSSPAGMT
                     RPSNPSSRNN"
     gene            complement(<1431934..>1436251)
                     /locus_tag="BRARA_H00161"
                     /db_xref="Phytozome:Brara.H00161"
     mRNA            complement(join(1431934..1432281,1432381..1432474,
                     1432628..1432710,1432783..1432933,1433023..1433127,
                     1433244..1433279))
                     /locus_tag="BRARA_H00161"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00161"
     mRNA            complement(join(<1432197..1432281,1432381..1432474,
                     1432628..1432710,1432783..1432933,1433023..1433127,
                     1435766..1435855,1436040..1436095,1436193..>1436251))
                     /locus_tag="BRARA_H00161"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00161"
     CDS             complement(join(1432197..1432281,1432381..1432474,
                     1432628..1432710,1432783..1432933,1433023..1433127,
                     1435766..1435855,1436040..1436095,1436193..1436251))
                     /locus_tag="BRARA_H00161"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49357.1"
                     /db_xref="Phytozome:Brara.H00161"
                     /translation="MIQIHLFSFIPHFDIIPLICEFGYRSTTMSYSHQSMGSGSRNAR
                     GYEFGRTYVVRPKGKHQATLVWLHGFDVGEISEDGHDDMESLDASASHIANLLCSEPA
                     DVKVGIGGFSMGAAISLYSATCYALGRYGTGHSYPINLRAVVGLSGWLPGWKSIRNKI
                     ESSYEAARRASSLPVILTHGIADDVVPYRFGEKSAQSLGMAGFRQTVFKPYQGLGHYT
                     VPKEMDEVVHWLTTRLGLEGSR"
     CDS             complement(join(1432197..1432281,1432381..1432474,
                     1432628..1432710,1432783..1432933,1433023..1433086))
                     /locus_tag="BRARA_H00161"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49356.1"
                     /db_xref="Phytozome:Brara.H00161"
                     /translation="MESLDASASHIANLLCSEPADVKVGIGGFSMGAAISLYSATCYA
                     LGRYGTGHSYPINLRAVVGLSGWLPGWKSIRNKIESSYEAARRASSLPVILTHGIADD
                     VVPYRFGEKSAQSLGMAGFRQTVFKPYQGLGHYTVPKEMDEVVHWLTTRLGLEGSR"
     gene            <1461106..>1463063
                     /locus_tag="BRARA_H00162"
                     /db_xref="Phytozome:Brara.H00162"
     mRNA            join(<1461106..1461840,1461920..1462463,1462669..>1463063)
                     /locus_tag="BRARA_H00162"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00162"
     CDS             join(1461106..1461840,1461920..1462463,1462669..1463063)
                     /locus_tag="BRARA_H00162"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49358.1"
                     /db_xref="Phytozome:Brara.H00162"
                     /translation="MTRSSLPVSAITSGKSPLQAVGGTKSFWFEGDGFVHDVDCFVKT
                     IATIKANGARPDHIGSVIAHYASTRLPDLSGVVMENQQQYSHSVTACVMKKRFLVETL
                     IGILPPEKDSVSCNFLLRLLRTANIVGADTDFKADLEVRISWQLEEASLTELMIPSFS
                     HTCAALLDVELVTRVVKNFARIYNEGIKSGTSLIKVAKLVDSYLAEAAADLNLSLIEF
                     ITLTDALPRHSRVTEDGLYLALDTYLKAHPDVTKQERRRLCGLIGIKKLSMEASLHAA
                     ENPRLPVRTIIQILFTEQTKLSHGRHNNSIDCNVSSLSRNPSGSHFSEPTPSWCMSKF
                     DMNVQQAEISRLRTGIGKLHNECEAMRRQLKKEKKGGRSSTGNTCGSKWYFRWKMLRF
                     STCFTTNDVEKKNGGEFGDNKEGEEEFELEDLTTVLGDAIASSGQVDNREDPTALIIP
                     DQQIKRNREGKKLKKEMNQLMEQLVEGDRKINTTSSSAQKIVDEATHHRDQNLPNPDK
                     FGLLTKTTRINNHIHVPADSDLCTLKYGGSNQPINARYCCSTPPLFKEV"
     gene            <1471857..>1472977
                     /locus_tag="BRARA_H00163"
                     /db_xref="Phytozome:Brara.H00163"
     mRNA            join(<1471857..1472239,1472328..1472664,1472730..1472757,
                     1472802..>1472977)
                     /locus_tag="BRARA_H00163"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00163"
     CDS             join(1471857..1472239,1472328..1472664,1472730..1472757,
                     1472802..1472977)
                     /locus_tag="BRARA_H00163"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49359.1"
                     /db_xref="Phytozome:Brara.H00163"
                     /translation="MVSLETTPALQLPVIDFTSPNLKPGTVEWDSVRGDVRRALEEYG
                     CFEALYDKVPVQLREAVFNVSEEAFQLPLETKQRVVSKRKYRGYVGQIPTLPLFEVMG
                     VDFAENEDKVNEFTHKLWPQGNASFSEAVMSFTEKVSKLDLMTRRMIMESFGISENYI
                     DKHLKSTKCLMRMMKYQGVEEETEEELGMEVHTDRNMLTILCQNDVKDGLEVRARDNK
                     RWIKANPSQDSSFIVLGGATLHVLLNGRVFTAGLFSVPKKDHLIYAPDEMVDAEHPRL
                     FKPFDFESYFQFTTEGPGRRDLAALRTYCGL"
     gene            complement(<1475355..>1476235)
                     /locus_tag="BRARA_H00164"
                     /db_xref="Phytozome:Brara.H00164"
     mRNA            complement(join(<1475355..1475439,1475685..>1476235))
                     /locus_tag="BRARA_H00164"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00164"
     CDS             complement(join(1475355..1475439,1475685..1476235))
                     /locus_tag="BRARA_H00164"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49360.1"
                     /db_xref="Phytozome:Brara.H00164"
                     /translation="MISRLFDFMKQSKSIQLNNKHSLDIYTNTYTYHKASSSSSTPKA
                     LCDVFINHRGTDTKKTLATLLYDNLKARNLRPFLDYKTLKPGDHIFDHINGAIHTSKV
                     AVTVFSPNYGHSYSCLHELALIMESKKRIIPIFFDIKPSQLDVVIERVRCPDDEIQRF
                     RWALQEARDIVGLRGGSSDVISMGNLSEVVTSASDIIVQRLVELEAEDESV"
     assembly_gap    1489974..1499973
                     /estimated_length=unknown
                     /gap_type="between scaffolds"
     gene            complement(1509274..1515071)
                     /locus_tag="BRARA_H00165"
                     /db_xref="Phytozome:Brara.H00165"
     mRNA            complement(join(1509274..1509526,1509608..1509665,
                     1509759..1509846,1509940..1509985,1510055..1510090,
                     1510185..1510256,1510388..1510500,1514917..1515071))
                     /locus_tag="BRARA_H00165"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00165"
     mRNA            complement(join(1509274..1509526,1509608..1509665,
                     1509759..1509846,1509940..1509985,1510055..1510090,
                     1510185..1510256,1510388..1510515,1514917..1515071))
                     /locus_tag="BRARA_H00165"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00165"
     CDS             complement(join(1509476..1509526,1509608..1509665,
                     1509759..1509846,1509940..1509985,1510055..1510090,
                     1510185..1510256,1510388..1510500,1514917..1514995))
                     /locus_tag="BRARA_H00165"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49362.1"
                     /db_xref="Phytozome:Brara.H00165"
                     /translation="MGWLGETVDSVKSIQIRQLLTQAISLGMIVTSSLIIWKALICVT
                     GSESPVVVVLSESMEPGFQRGDILFLHMSKDPIRAGEIVVFNIDGRDIPIVHRVIKVH
                     ERKNTGEVDVLTKGDNNPGDDRLLYAKGQLWLHRHHIMGRAVGFLPYVGWVTIIMTEK
                     PIIKYILIGALGLLVISSRD"
     CDS             complement(join(1509476..1509526,1509608..1509665,
                     1509759..1509846,1509940..1509985,1510055..1510090,
                     1510185..1510256,1510388..1510515,1514917..1514995))
                     /locus_tag="BRARA_H00165"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49361.1"
                     /db_xref="Phytozome:Brara.H00165"
                     /translation="MGWLGETVDSVKSIQIRQLLTQAISLVCCLIGMIVTSSLIIWKA
                     LICVTGSESPVVVVLSESMEPGFQRGDILFLHMSKDPIRAGEIVVFNIDGRDIPIVHR
                     VIKVHERKNTGEVDVLTKGDNNPGDDRLLYAKGQLWLHRHHIMGRAVGFLPYVGWVTI
                     IMTEKPIIKYILIGALGLLVISSRD"
     gene            1515210..1516554
                     /locus_tag="BRARA_H00166"
                     /db_xref="Phytozome:Brara.H00166"
     mRNA            join(1515210..1515403,1515502..1515559,1515662..1515769,
                     1516075..1516167,1516269..1516554)
                     /locus_tag="BRARA_H00166"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00166"
     CDS             join(1515238..1515403,1515502..1515559,1515662..1515769,
                     1516075..1516167,1516269..1516350)
                     /locus_tag="BRARA_H00166"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49363.1"
                     /db_xref="Phytozome:Brara.H00166"
                     /translation="MAILAPASFGRLTVPSRAQVRVRVSASANPRTSVDWVKETSSFF
                     EQDKRPIMLFDGVCNLCNGGVKFVRDHDHNRSIRFEALQSEAGKKLLMRSGRAPDDIS
                     SVVLVEKDRSYVKSEAVLKIMKYIDLPFPQLAFFLQFAPLFVRDFLYENVANNRYALF
                     GRSDSCEI"
     gene            1517770..1521016
                     /locus_tag="BRARA_H00167"
                     /db_xref="Phytozome:Brara.H00167"
     mRNA            join(1517770..1517932,1518009..1519708,1520433..1521016)
                     /locus_tag="BRARA_H00167"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00167"
     CDS             join(1517834..1517932,1518009..1519708,1520433..1520802)
                     /locus_tag="BRARA_H00167"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49364.1"
                     /db_xref="Phytozome:Brara.H00167"
                     /translation="MEEFLLHGRLHATIYEVDSLHGSEGGRSGFFGKILANVEETIGV
                     GKGEPQLYATIDLEKARVGRTRKITNEPNNPKWHESFHIYCGHMAKHVIFTVKDDNPI
                     GATLIGRAYIPVEDILHGEEVDRWVEILDTEKKPVEGGSKIHVKLQYFGVEKDKNWNR
                     GIKSVKFPGVPYTFFSQRRGCKVSLYQDAHIPGNFVPKIPLAGGKYYEANRCWEDIFD
                     AITNAKHLIYITGWSVYAEISLVRDSRRPKEGGDLTIGEILKKKASEGVKVILLVWDD
                     RTSVDLLKQDGLMATHDEETENFFQGTDVNCVLCPRNPDDGGSIVQNLQVSTMFTHHQ
                     KIVVVDSEMPGESSRTKSRRIVSFIGGLDLCDGRYDTPFHSLFRTLDTVHHDDFHQPN
                     FPGAAITKGGPREPWHDIHCRLEGAIAWDVLYNFEQRWNRQGGKDILVKIRDLDDIII
                     PPSPVLFSEDHDSWNVQLFRSIDGGAAAAFPDSPEAAAEAGLVSGKDNIIDRSIQDAY
                     IHAIRRAKDFIYIENQYFLGSSFAWSADGIKPEEINALHLIPKELSLKIVSKIKAGER
                     FKVYVVVPMWPEGIPESGSVQAILDWQRRTMEMIDSEIAMGGYQPFHLSVRQPARGQI
                     HGFRMSLWYEHLGMLDETFLDPSSQECVKKVNRVADKYWDLYSSESLEHDLPGHLLRY
                     PIGIASQGDITELPGCECFPDTKARILGTKSDYMPPILTT"
     gene            1525714..1527144
                     /locus_tag="BRARA_H00168"
                     /db_xref="Phytozome:Brara.H00168"
     mRNA            join(1525714..1525764,1525844..1527144)
                     /locus_tag="BRARA_H00168"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00168"
     CDS             1525858..1527012
                     /locus_tag="BRARA_H00168"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49365.1"
                     /db_xref="Phytozome:Brara.H00168"
                     /translation="MLSVCKRTRKTVTGDLCLPLDIIVEILKKLPTKSLVRFRSVSKQ
                     WSTIISSDRDLIESIVTRSLRHPPLKLPVFIFHHCVPETFFTVSPVFSPTTTDHVVTI
                     PRPSRPCTFHYQYSRGLICCSSFESHLVTIYNPTTRQVFPLPEIQAPTRSGLSSCFFG
                     YDPITNQYKVLSIIFDCDERKQTYHVFTLGCQQSWRKVKGIDEDSYPNDYSVCIDGTI
                     YYSAYRKPRETILLSFDLRSERFDRVLVPEALSKALLARINHQRLVNHLGKLGCICCN
                     DGDTSIWIMDDAKKQEWSRTILCLPNYPVKLLGADVDTFSGATPAGEIYATQCNYFFD
                     KSLYVYYYDMNQNSFRRVHIEGGVRDKTKKRRYCVEVFAIHDHVENTMSL"
     gene            1549247..1549747
                     /locus_tag="BRARA_H00169"
                     /db_xref="Phytozome:Brara.H00169"
     mRNA            1549247..1549747
                     /locus_tag="BRARA_H00169"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00169"
     CDS             1549329..1549565
                     /locus_tag="BRARA_H00169"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49366.1"
                     /db_xref="Phytozome:Brara.H00169"
                     /translation="MCYKKIIPLVIPPESFHENVPAAGVTVATEVVATVGRHRDGRGE
                     KKKCVCSPSTHPRSFKCRYHHHEYQWVPSSSLHK"
     gene            1552256..1554113
                     /locus_tag="BRARA_H00170"
                     /db_xref="Phytozome:Brara.H00170"
     mRNA            join(1552256..1552611,1553329..1554113)
                     /locus_tag="BRARA_H00170"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00170"
     CDS             join(1552568..1552611,1553329..1554010)
                     /locus_tag="BRARA_H00170"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49367.1"
                     /db_xref="Phytozome:Brara.H00170"
                     /translation="MSTQNTASSSLPTQRLLGKVALITGGATGIGESIVHLFHKHGAK
                     VCIVDLQDELGDKLCNRLAVDSACFIHGDVTVEDDISKAVNFTVNRFGTLDILINNAG
                     LSGAPCPDIRNNSLSEFNTVFDVNVEGAFPRDETRSSCNDPGQELGQHGIRVNCVSPY
                     AVVTKLALAHLPEEERTDDALVGFRNFAAANANLKGVELTVDDVANVVLFLASDESRY
                     VSGDNLMIDGGFTCTSHSFKVFR"
     gene            complement(1559690..1562486)
                     /locus_tag="BRARA_H00171"
                     /db_xref="Phytozome:Brara.H00171"
     mRNA            complement(join(1559690..1560365,1560871..1561435,
                     1561517..1561936,1562009..1562066,1562147..1562486))
                     /locus_tag="BRARA_H00171"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00171"
     CDS             complement(join(1559840..1560365,1560871..1561435,
                     1561517..1561936,1562009..1562066,1562147..1562233))
                     /locus_tag="BRARA_H00171"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49368.1"
                     /db_xref="Phytozome:Brara.H00171"
                     /translation="MELTWGFCRKQALVLISCLSLFYLASFDTITSESPAQNATAFKN
                     RSHKVSCPTNWVLGPNQTKCYASFRNSTSWEKSETFCIASGGHLASPSSNKELFFLQK
                     LCNANATSCWIGGRTLNSSNSGFNWTWSDPKSPQWNQTMFPKVPVRTRCVNSSCRADI
                     CMVLTNGSLQVFGERCNTSHAFICAIDSDIKCRNCHGEYQIILLVVSGLILFTTFAII
                     LWFLIYKRSKKRRKSRKVSSPASALVPPPSWKIFTSEELRSMTKNFSEANRLAGDAKT
                     GGTYTGGLADGTKVAVKRLKRSSFQRKKEFYSEIKRAAKLHHTNVVAIKGCCYDHGER
                     FIVYEFIANGPLDRWLHHVPRGGRSLDWNMRLNIATTLAQGIAFLHDKVKPQVVHRDI
                     RASNVLLDEEFGAHLMGVGLSKFVPWEVMQERTVMAGGTYGYLAPEYVYRNELTTKSD
                     VYSFGVLLLEIVSGRRPTQAVNSSVGWQSIFEWATPLVQANRWLELLDPVITSGLPEA
                     SVVQKVVDLVYACTQNVPSMRPRMSHVVHQLQLLVPPSEIVSS"
     gene            1565083..1566334
                     /locus_tag="BRARA_H00172"
                     /db_xref="Phytozome:Brara.H00172"
     mRNA            join(1565083..1565135,1565224..1565359,1565866..1565967,
                     1566069..1566334)
                     /locus_tag="BRARA_H00172"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00172"
     CDS             join(1565133..1565135,1565224..1565359,1565866..1565967,
                     1566069..1566115)
                     /locus_tag="BRARA_H00172"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49369.1"
                     /db_xref="Phytozome:Brara.H00172"
                     /translation="MTKGTGSFGKRRNKSHTLCVRCGRRSFHIQKSRCSACAYPAARK
                     RTYNWSVKAIRRKTTGTGRMRYLRNVPRRFKTGFREGTEAKPRNKSAASSS"
     gene            1567865..1570871
                     /locus_tag="BRARA_H00173"
                     /db_xref="Phytozome:Brara.H00173"
     mRNA            join(1567865..1568333,1568712..1569065,1569305..1569391,
                     1569470..1569540,1569624..1569700,1569786..1569936,
                     1570006..1570167,1570240..1570871)
                     /locus_tag="BRARA_H00173"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00173"
     CDS             join(1567985..1568333,1568712..1569065,1569305..1569391,
                     1569470..1569540,1569624..1569700,1569786..1569936,
                     1570006..1570167,1570240..1570542)
                     /locus_tag="BRARA_H00173"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49370.1"
                     /db_xref="Phytozome:Brara.H00173"
                     /translation="MSSNNTIPSAANPPDPVFPFTQPANTTTSSPSPPSPIEPSSTPP
                     FPAARASDRGLAPGVLAGLITGAVLGATFVLIGVCVFVCFYKRKKRKLQRRRDAEAAI
                     DGDSPLPSLSDQKLDNSNNLQQWNQSTTSSDNVFTYQDLAKATDNFSSTNLIGQGGFG
                     YVHKGVLTDGTEVAIKQLKAGSGQGEREFQAEIQTISRVHHRHLVSLLGYCITGSQRL
                     LVYEFVPNKTLEFHLHEKGRPVMEWGKRMKIALGAAKGLSYLHEDCNPKTIHRDVKAA
                     NILIDDSYEAKLADFGLARSSLDTDTHVSTRIMGTFGYLAPEYASSGKLTDKSDVFSF
                     GVVLLELITGRRPVDKSQPFVDDDSIVDWAKPLMIQALNDSNFYGLVDPRLEGNFDIS
                     EMTRVVACAAASVRHSAKRRPKMSQIVRAFEGNISLDDLTEGVTPGHSTIYSLDGSSD
                     YSSTQYKEDLKKFKKMALESQTFGSSECSGLTTSDNGQNPSGSSSITEGLRTTQEIEP
                     EKKTDETTS"
     gene            1573863..1575694
                     /locus_tag="BRARA_H00174"
                     /db_xref="Phytozome:Brara.H00174"
     mRNA            join(1573863..1573978,1574066..1574092,1574183..1574282,
                     1574730..1574876,1574956..1575036,1575110..1575255,
                     1575346..1575694)
                     /locus_tag="BRARA_H00174"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00174"
     CDS             join(1573926..1573978,1574066..1574092,1574183..1574282,
                     1574730..1574876,1574956..1575036,1575110..1575255,
                     1575346..1575412)
                     /locus_tag="BRARA_H00174"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49371.1"
                     /db_xref="Phytozome:Brara.H00174"
                     /translation="MSSRRRVLLKVIILGDSGVGKTSLMNQFVNRKFSNQYKATIGAD
                     FLTKEVQIDDRIFTLQIWDTAGQERFQSLGVAFYRGADCCVLVNDVNVMKSFENLNNW
                     REEFLIQASPSDPENFPFVVLGNKTDVDGGKSRVVSEKKAKAWCASKGNIPYFETSAK
                     EGFNVDAAFECITKNAFKNEPEEEPYMPDTIDVARGQQQRSTGCEC"
     gene            complement(1575346..1578737)
                     /locus_tag="BRARA_H00175"
                     /db_xref="Phytozome:Brara.H00175"
     mRNA            complement(join(1575346..1575689,1575763..1575816,
                     1575888..1576103,1576190..1576258,1576351..1576422,
                     1576600..1576689,1576770..1576850,1576931..1577049,
                     1577132..1577297,1577391..1577520,1578083..1578737))
                     /locus_tag="BRARA_H00175"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00175"
     CDS             complement(join(1575594..1575689,1575763..1575816,
                     1575888..1576103,1576190..1576258,1576351..1576422,
                     1576600..1576689,1576770..1576850,1576931..1577049,
                     1577132..1577297,1577391..1577520,1578083..1578570))
                     /locus_tag="BRARA_H00175"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49372.1"
                     /db_xref="Phytozome:Brara.H00175"
                     /translation="MSMNPKLSVSTFILLLLLTFLLIPSHSSSSDEESDDDLEQLLAV
                     DEQSQEDRPQHQQSEAETVSKAQRIVLELTGDNAKRVVDGNEFVLVLGYAPWCARSAD
                     LMPRFSEAATGLKEIGSSVLMAKIDGDRYGKVASELEIKGFPTLLLFVNGTSQPYSGG
                     FSAEDIVIWVQKKTGSPIITVNTLDEAQIFLNKYHTFVVGLFHKFEGSEYNEFVKAAK
                     SDNEIQFVETSDNDVAKLLFPQLKTNTVFIGLVKPEAERYTAYDGPFKMEKLLEFLGN
                     NKFPLITRLTESNTVWVYSSPVKLQVMLFSKAYVFQSLAQPLEDLARKFKSKLMFIYV
                     DIANENLAMPFLTLFGIEHANKTVVAAFDNNLNSKYLLESDPSPSNIEDFCSGLADGT
                     VSRYYRSEPVPDNENASIVTVVGKTFDELVLHSPENVLLEVHTPWCVNCEAMSKQVLK
                     LAKHFKGFENLVFARIDASVNEHGKLQVDDFPTILLYKSGEKEKPLKLSTKLSAKDMA
                     VFINEELKPKEGSARDEL"
     gene            1581908..1582534
                     /locus_tag="BRARA_H00176"
                     /db_xref="Phytozome:Brara.H00176"
     mRNA            join(1581908..1582152,1582241..1582534)
                     /locus_tag="BRARA_H00176"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00176"
     CDS             join(1582015..1582152,1582241..1582387)
                     /locus_tag="BRARA_H00176"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49373.1"
                     /db_xref="Phytozome:Brara.H00176"
                     /translation="MLEGKAMVEDSDMPVKMQVQAMSLASQALDIFDVVDCKSIAGHI
                     KKEFDERYGSGWQCVVGSNFGCFFTHSKGTFIYFQLETLKFLIFKGASTP"
     gene            complement(1582595..1583410)
                     /locus_tag="BRARA_H00177"
                     /db_xref="Phytozome:Brara.H00177"
     mRNA            complement(join(1582595..1582916,1582998..1583124,
                     1583200..1583410))
                     /locus_tag="BRARA_H00177"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00177"
     CDS             complement(join(1582737..1582916,1582998..1583124,
                     1583200..1583330))
                     /locus_tag="BRARA_H00177"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49374.1"
                     /db_xref="Phytozome:Brara.H00177"
                     /translation="MASLATIAAVQPSATVKGLGGSSLAGSKLFIKPSRQSFKPKSTR
                     AGAVVAKYGDKSVYFDLEDLGNTTGQWDLYGSDAPSPYNPLQSKFFETFAAPFTKRGL
                     LLKFLILGGGSLLTYVSASSTGDVLPIKRGPQEKPKLGPRGKL"
     gene            1589926..1591347
                     /locus_tag="BRARA_H00178"
                     /db_xref="Phytozome:Brara.H00178"
     mRNA            join(1589926..1590142,1590356..1590496,1591008..1591347)
                     /locus_tag="BRARA_H00178"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00178"
     CDS             join(1589984..1590142,1590356..1590496,1591008..1591184)
                     /locus_tag="BRARA_H00178"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49375.1"
                     /db_xref="Phytozome:Brara.H00178"
                     /translation="MVHPALPKVTAYLGELSNASLDYFPGSILQGIQAIHVGKGIIEC
                     KLIIEDRVLGEDGTIHTGAIAAIMENIGATAIFSAGGSDHASVDFNYSLYSTAKKQDE
                     VKIEARVIGRKDDLTSAVIEIRRECDEELIATGRLWMVQRRSLNVKHNGVDLPSKL"
     gene            1607285..1611513
                     /locus_tag="BRARA_H00179"
                     /db_xref="Phytozome:Brara.H00179"
     mRNA            join(1607285..1607844,1607922..1608081,1608164..1608264,
                     1608336..1608426,1608554..1608649,1608733..1609077,
                     1609159..1609233,1609305..1609417,1609495..1609684,
                     1609764..1609940,1610012..1610092,1610155..1610289,
                     1610366..1610694,1610769..1610874,1610945..1611094,
                     1611175..1611513)
                     /locus_tag="BRARA_H00179"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00179"
     CDS             join(1607636..1607844,1607922..1608081,1608164..1608264,
                     1608336..1608426,1608554..1608649,1608733..1609077,
                     1609159..1609233,1609305..1609417,1609495..1609684,
                     1609764..1609940,1610012..1610092,1610155..1610289,
                     1610366..1610694,1610769..1610874,1610945..1611094,
                     1611175..1611321)
                     /locus_tag="BRARA_H00179"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49376.1"
                     /db_xref="Phytozome:Brara.H00179"
                     /translation="MAMSYKDGKMGCMDNGKYVRYTPEQVEALERLYHDCPKPSSIRR
                     QQLIRECPILSNIEPKQIKVWFQNRRCREKQRKEASRLQAVNRKLTAMNKLLMEENDR
                     LQKQVSQLVHENSYFRQHTPNPTLPAKDTSCESVVTSGQHQLASQNPPRDASPAGLLS
                     IAEETLAEFISKATGTAVEWVQMPGMKPGPDSIGIIAISHGCAGVAARACGLVGLEPT
                     RVAEIVKDRPSWFRECRAVDVMNVLPTANGGTIELLYMQLYAPTTLAPPRDFWLLRYT
                     SVLEDGSLVVCERSLKCGPSMPPVQHFVRAEMLPSGYLIRPCDGGGSIIHIVDHMDLE
                     ACSVPEVLRPLYESPKVLAQKTTMAALRQLKQIAQESSQTNSSVNGWGRRPAALRALS
                     QRLSRGFNEAVNGFTDEGWSVIGDSMDDVTITVNSSPDKLMGLNLTFSNGFAPVSNVV
                     LCAKASMLLQNVPPAILIRFLREHRSEWADNNIDAYLAAAVKVGPCSARVGGYGGQVI
                     LPLAHTIEHEEFMEVIKLEGLGQSPEDAIVPRDIFLLQLCSGMDENALGTCAELIFAP
                     IDASFADDAPLLPSGFRIIPLDSTKEASSPNRTLDLASALEIGPAGTTKASTDQSGNS
                     TCARSVMTIAFEFGIESHMQEHVASMARNYVRGIIASVQRVALALSPSHISSQVGLRT
                     PLGTPEAQTLARWICQSYRCYMGVELLNLNSEGNESILKNLWHHTDAIICCSMKAMPV
                     FTFANQAGLDMLETTLVSLQDITLEKIFDDSGRKTLCSEFPQIMQQGFGSLQGGICIS
                     SMGRPVSYERAVAWKVLNEEENTHCICFVFINWSFV"
     gene            complement(<1615813..>1626299)
                     /locus_tag="BRARA_H00180"
                     /db_xref="Phytozome:Brara.H00180"
     mRNA            complement(join(<1615813..1616155,1616254..1616741,
                     1624173..1624337,1624467..>1626299))
                     /locus_tag="BRARA_H00180"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00180"
     CDS             complement(join(1615813..1616155,1616254..1616741,
                     1624173..1624337,1624467..>1626299))
                     /locus_tag="BRARA_H00180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49377.1"
                     /db_xref="Phytozome:Brara.H00180"
                     /translation="YGFTGETDRIALLDLKSQVSEDKQNVLSSWNNSFPLCNWKGVTC
                     GLKHKRVTRLDLGGWQLGGVISPSIGNLSFLISLDLSDNSIGGTIPHQVGNLFRLEYL
                     DMSHNFLGGGIPTSMSNCSRLLSLRLTSNSLGEGVPSELGSLARLEILNLGRNNLTGK
                     IPPSLGNLTSLTRVIFSSNKIEGGVPNALARLTQLVSLRLGMNKFSGVFPPSIYNFSS
                     LEILSIFHSGFSGSLKPDFGNLLPNLRRLHMGRNHFTGPIPTTLSNISNLENFGIVFN
                     KMMGSVPSSFGKLQNLQYLALASNSLGSYSSGDLEFLKALANCTQLHTLLVNGNRLGG
                     DFPTSITNLSTNLWKLDLGMNLISGTIPYDIGNLISLQKLMLDDNLLTGPLPSSIGKL
                     SRLVVLNLTSNRLSGEIPSSIGNITRLGKLYFSNNSFEGTIPPSLGQCRFMLYLWIGS
                     NKLNGTIPQEIMQIQSLVHLDLSDNSLTGSLPKYIKPLEGLCILSVAHNKLSGQLPQV
                     LGNFLSLENLYLQGNFFDGDIPNIKGLMGAKRLDFSNNNLSGSIPGYFANFSSLEYLN
                     LSINNFQGIVPTEGNLKNATVLLVFGNKDLCGGIKELKLKPCIMQQQTNHPTSSSALE
                     VCHEQISYAYLQKATDGFSSSNMIGSGSFGTVFKALLPTENKRRGAMKSFVTECESLK
                     DIRHRNLVKLLTACSSTDFQGNDFRALVYELMPNGSLDMWLHPEEVEEIRRPSRALTL
                     FERLNIAVDVISVLEYLHVYCHEPIAHCDLKPSNVLLDKDLTGHVSDFGIARMLMKLD
                     QGSLFNQQSSVGVRGTIGYAAPGKLYHTSVLIWNGRTTSIYGDMYSFGVLLLEMFTGK
                     RPTDELFGGNVTLNSYIKLAFPERVLDIADNSILNSSLRVGFPLGECLTLVLEVGLKC
                     CEETLKNRLATSEARKDLILIRERFFKH"
     gene            1634396..1636716
                     /locus_tag="BRARA_H00181"
                     /db_xref="Phytozome:Brara.H00181"
     mRNA            join(1634396..1634516,1634594..1634774,1634849..1634950,
                     1635036..1635087,1635300..1635421,1635505..1635602,
                     1635680..1635738,1635844..1635900,1636048..1636093,
                     1636237..1636316,1636410..1636716)
                     /locus_tag="BRARA_H00181"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00181"
     CDS             join(1634427..1634516,1634594..1634774,1634849..1634950,
                     1635036..1635087,1635300..1635421,1635505..1635602,
                     1635680..1635738,1635844..1635900,1636048..1636093,
                     1636237..1636316,1636410..1636503)
                     /locus_tag="BRARA_H00181"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49378.1"
                     /db_xref="Phytozome:Brara.H00181"
                     /translation="MREMENKVLPLTCLDLANFDLHQSAVSLKQACMDCGFFYVINHG
                     ISEELKEEVFEQSKKFFDLPLEDKMKALRNETHRGYSPALEQNQIHGDYNKESFFMGT
                     EGLKDDSLGAKPFYRPNIWPDSDVLPGWRTTMENYHLELLRVCKAIARILALALDLDA
                     DYFDTSEMLENPIAYMRLLHYEGMSDPSRGIYGCGSHTDHGMMTLLATDGVMGLQICK
                     DKDMKPQKWEYVPSIDGAYIVNLGDVLERWSNGLFKSTLHRVLANGQDRYSIPFFLSP
                     SHDCLIECLPTCQSEKNLPKYPAIKCSAYLTQRYKESHRETRASPENRPK"
     gene            1646458..1647316
                     /locus_tag="BRARA_H00182"
                     /db_xref="Phytozome:Brara.H00182"
     mRNA            1646458..1647316
                     /locus_tag="BRARA_H00182"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00182"
     CDS             1646526..1647140
                     /locus_tag="BRARA_H00182"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49379.1"
                     /db_xref="Phytozome:Brara.H00182"
                     /translation="MDQNEPISKKLWNIVRFLLYMIRKGVSKHKLIADFNATLKRGKN
                     LMFHHRRRVPAADTSSSAAANAPQRQEYEFSCSNTPNYSFPFPNIGFMKKKSHNNLFA
                     CGQTPQTLDDDAAAARAVLELLNGVGDKGNVTPAYLSAALSPYFPGFGRTPLVRPLRV
                     TDSPFPLTPENGGVANGHVDQAADDFIKKFYKNLNQQKKMIEFS"
     gene            <1662803..>1663999
                     /locus_tag="BRARA_H00183"
                     /db_xref="Phytozome:Brara.H00183"
     mRNA            join(<1662803..1662988,1663417..1663535,1663798..>1663999)
                     /locus_tag="BRARA_H00183"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00183"
     CDS             join(<1662803..1662988,1663417..1663535,1663798..1663999)
                     /locus_tag="BRARA_H00183"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49380.1"
                     /db_xref="Phytozome:Brara.H00183"
                     /translation="LEARGGNGGNQWDDGAEHEGVSKIYIREGRNGIESIKFDYVKNG
                     EPKDGPIHGGSGQSFTESFDLNHTIDEHIVSIKCYYDEGVIQGLVINRAGSLGGGGKR
                     APNRVEPALVIKTNIRTSALMGYNLGTKFKLGVKGKKIIGFHGSSDKNLNSLGAYFTT
                     LSPDNLDV"
     gene            complement(1664659..1668020)
                     /locus_tag="BRARA_H00184"
                     /db_xref="Phytozome:Brara.H00184"
     mRNA            complement(join(1664659..1665579,1666155..1666919,
                     1667091..1667128,1667218..1667439,1667663..1668020))
                     /locus_tag="BRARA_H00184"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00184"
     CDS             complement(join(1664824..1665579,1666155..1666919,
                     1667091..1667128,1667218..1667413))
                     /locus_tag="BRARA_H00184"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49381.1"
                     /db_xref="Phytozome:Brara.H00184"
                     /translation="MTLVPSSESSYMMIITKHKRDVNLVVLQLGAALAVTFAGFLFSR
                     FRKNTKSTIRPTLPPLRPQPSDHGYRDSSNEPIHRETQRTSKEESLLVFSPRSECDAD
                     EKDVFLLPEFEDEVKKLDLLVYDDECESPKSDMSSAPLAFPSAEEGDHVNEIKRLRNT
                     VRALRERERCLEDKLLEYYSLKEQQKIAMELRSRLKLNQMETKVFNLKIKSLQAENEK
                     LKAQCSEHSKVALELDLAKSEVHVLKKKLNIKTQQHVEQLLSLKERVAKLQEDEIKAT
                     LPDRDADKMVQRLRDLEGEINELRNSNTRLQFENFELAEKLESVQIIASSKLEDPEEM
                     ETLRQESNRLKSENEELKKEIEQLQGDRCTDLEQLVYLKWINACLRYELRTYQPPAGK
                     TVARDLSTTLSPTSEEKAKQLILEYAHEEDHTDYDQWSSSQEESSSMITDSMFLDDSS
                     VDTLFATKTKKSGKKKLMHKLMKILHGKDSTQEGKKRAGSSEPSSSSTGVHSTPRRPH
                     SMDFQMLLRGEDEEDFKDHMKMLHRKSEGAEASNYGEEECLESDQNRKKELIKYAEAL
                     RKSRSTKKLHKKSVSFFF"
     gene            1675647..1680037
                     /locus_tag="BRARA_H00185"
                     /db_xref="Phytozome:Brara.H00185"
     mRNA            join(1675647..1675691,1675920..1676137,1676224..1676685,
                     1676766..1677212,1677311..1677718,1677802..1678533,
                     1678905..1680037)
                     /locus_tag="BRARA_H00185"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00185"
     CDS             join(1675940..1676137,1676224..1676685,1676766..1677212,
                     1677311..1677718,1677802..1678533,1678905..1679834)
                     /locus_tag="BRARA_H00185"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49382.1"
                     /db_xref="Phytozome:Brara.H00185"
                     /translation="MNTMSEKVGAVGGNKGGPFDDGVFDGVKKIIVGKDFNSVSYIKI
                     EYEKDGKFETREHGTIRGELQEFTVDYPNEYITSVGGSYELVLCYGTVLIRSLIFKTS
                     YKRTSPIFGRTTLFGHPAGREFMLEGKNGGKLLGFHGRSGQALDAIGAHFFSVKSPLK
                     HFNLQGGNGGSAWDDGAYDGVRKILVGRGSKFVSYVRFEYAKGQGMVPHAHGKKQEAP
                     QEFVVDYPNEQITLVEGTIDGYLTSLRFKTSKGRTSPVFGNVVGRKFVFEEKDFKLVG
                     FCGRSGDAIDALGAHFAPLPPPPPAPTPDPATSKMGPLGGDKGNTFDDGVLDGVKKVT
                     IGADEYSVTYIKIEYANDGNVEIREHGTNRGELKEFSVAYPNEYITAVGGSYKHIFNY
                     DTTLITSLYFTTSKGLTSPLFGEIKGREFEYKDENGGNLVGFHGRGGYAIDAIGVHFA
                     PAPNSSIPTPPNKLSKVYITSGNEGIEEINFYNVENGVTKEVFLHGVKGKNLISTLVI
                     SNPPDECLVSVESWYSSYNVSQGIKFKTDTNGSNFFGYKFSEDTGRPFSLQVKGKKII
                     GVQKFPDSNLISPGTYFVLSRSSSPDKVEAIGGKGGETFDDGAFNHVRKVFVGKGDSG
                     IAYVKFDYEKDGRIVTQEHGQKTSQETEVFEIGQDDDITSVKAYYETLDGSKTETITY
                     LAFKTLKGINSQPFGKTPVIVNENTKLSLLEGGKITGFHGSSTDVLHSIGAYISASPP
                     TMLHGKWIQVEQNGKTPGPRCSHAIAMVGNKMYSFGGELKPNFHIDRDLYFFDFETRR
                     WSIADPDGDVPELPCLGVCMVAIGTTLYVFGGRDGFRNYNGFYSYDTVKSEWKLITHV
                     NNGPAPRSFHSMAADGNNIYIFGGVTTKERVNTLHAYNIVDQKWTELPNPGESCKGRG
                     GAGLVVVQGKIWVVYGFIGEEVEDVHCFDPVESKWTKVETRGEKPWARSVFALAVVGK
                     YIIISGGEIEMDVKAHLGPGSLTGGAFVLDTESLVWEKLEEGHSPRGWIASTTASIDG
                     KKGLLMYGGKAPTNGRYEDIYFYGVDSA"
     gene            <1693324..>1695219
                     /locus_tag="BRARA_H00186"
                     /db_xref="Phytozome:Brara.H00186"
     mRNA            join(<1693324..1693521,1694196..1694657,1694734..>1695219)
                     /locus_tag="BRARA_H00186"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00186"
     CDS             join(1693324..1693521,1694196..1694657,1694734..>1695219)
                     /locus_tag="BRARA_H00186"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49383.1"
                     /db_xref="Phytozome:Brara.H00186"
                     /translation="METMSEKVGAVGGNKGGPFDDGVFDGVKKITVGKDFHSVSYIKI
                     EYEKDGKFETREHGTIRGELQEFTVDYPNEYITSVGGSYEHVLSYGTVLIKSLRFKTS
                     YGRTSPILGHTTLFGNPDGREFLLEGKDGGKLLGFHGRSGQALDAIGPHFFAVKSPLK
                     HYNRQGGNGGSAWDDGAFDGVRKILVGRGGKFVSYVRFEYAKDQGMVPHAHGKRQEVP
                     QEFVVDYPDEHIALVEGTIDGYLTSLMFKTSKGRTSPAFGNVVGRKFVFEEKDFKLVG
                     FCGRSGDAIDAIGAHFAPLPPPPPPPAPTPAPTPAPAPTPAPTTTTKMGPLGGNKGNT
                     FDDGILDGVKKIIIAADEYSITYIKIEYEKDGKVEIREHGTNRGELKE"
     gene            <1695938..>1698063
                     /locus_tag="BRARA_H00187"
                     /db_xref="Phytozome:Brara.H00187"
     mRNA            join(<1695938..1696666,1697134..>1698063)
                     /locus_tag="BRARA_H00187"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00187"
     CDS             join(<1695938..1696666,1697134..1698063)
                     /locus_tag="BRARA_H00187"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49384.1"
                     /db_xref="Phytozome:Brara.H00187"
                     /translation="FSVAYPNEYITAVGGSYKHIFNYDTTLITSLYFTTSKGFTSPLF
                     GEMKGTEFEFKGENGGKLVGFHGRGGYAIDAIGAHFSQATTSSSSSLIKVEAVGGKGE
                     VTFDDGSFDHVRKVFVGQGNSGVSYIKFEYEKDGRIVTHEHGQKTSLGTEEFEVGQGD
                     DITSVKVYYDKLYGSKAEIITSLTFKTLKGITSQPFGMTSANLSLLEGGKITGFHGSL
                     TDVLHSIGAYISASPRTMLHGKWIQVEQKGKTPGPRCSHAIAMVGNKMYAFGGELTPN
                     FHIDRHLYFFDFKTHRWSVADPDGDVPELPCLGVCMVAIGTTLYVFGGRDGHRNYNGF
                     YSYDTVKSEWKLITHVNKGPAPRSFHSMAADNKNIYVFGGVSTTVRVNTLHAYNIIDQ
                     KWTELPNPGESCKGRGGAGLAVVQGKIWVVYGFIGDEVDDVHCFDLVERKWTKVETRG
                     EKPWARSVFALAVVGKYIIISGGEIEMDPKAHLGPGKLAGGTFVLDTESLLWEKLEEG
                     HSPRGWIASTTASIDGKRGLLMHGGKAPTNGRYEDIFFYGVDSA"
     gene            <1706115..>1708604
                     /locus_tag="BRARA_H00188"
                     /db_xref="Phytozome:Brara.H00188"
     mRNA            join(<1706115..1706306,1706405..1706854,1706960..1707406,
                     1707864..>1708604)
                     /locus_tag="BRARA_H00188"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00188"
     CDS             join(1706115..1706306,1706405..1706854,1706960..1707406,
                     1707864..1708604)
                     /locus_tag="BRARA_H00188"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49385.1"
                     /db_xref="Phytozome:Brara.H00188"
                     /translation="MSERVGAMGGNMGIPFDDGVFDGVRKIIVGKDWDCVSYMKIEYE
                     NSDGNFETREHGTIRGGLQEFTVDYPSEYITSVGGRYEHVPRYGTVLIRSLIFKTSGG
                     RTSPILGYTTSFGHPAGREFMLEGKNGGRLLGFHGRSGQALDAIGPHFFAVNSPLKHF
                     NRQGGNGGSAWDDGAFDGVRRILVGLGGRFISFLRFEYAKGQRIVPHAHGKRQEFVVD
                     YPNEHITVVEGTIDGYLTSLRFKTSKGRTSPAFGNVVGRKFVFEEKKFKLIGFSGRSG
                     DVIDALGANFGPYPAPTPAPTQASASTKMGPLGGNKGNAFDDGIMDGVKKITVGADEY
                     SITYIKIEYEKEGKDEIRDHGTKRGELKEFFVDYPNEYITAVGGSYKHIFNYDTTLVK
                     SLYFTTSKGFTSPLVGEMTGTEFEFKGENGGKLVGFHGRGGYAIDAIGAHFSQAPISS
                     PSSVIKVEAVGGKGEETFDDGSFHHVRKVSVGQGNSHISYIKFEYEKDGRRITQEHGQ
                     RTSRGTEVFEVGQNDGITSVKAYYEKLDGWKTETITHLAFKTLKGINSQPFGKTPVIV
                     NERTKLSLLEGGKITGFHGSSSDVLHSIGAYISAFPQTMLHGK"
     gene            <1736834..1738327
                     /locus_tag="BRARA_H00189"
                     /db_xref="Phytozome:Brara.H00189"
     mRNA            join(<1736834..1737025,1737120..1738327)
                     /locus_tag="BRARA_H00189"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00189"
     CDS             join(1736834..1737025,1737120..1738151)
                     /locus_tag="BRARA_H00189"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49386.1"
                     /db_xref="Phytozome:Brara.H00189"
                     /translation="MSERMGAMGGTMGSPFDDGVFDGVRRIIVGRDWDCVSYIKIEYE
                     NSAGNFETREHGTNRGGIQEFTVDYPSEYITSVGGSFSRVFRYGTELIQSLIFRTSRG
                     RTSPILGHSFLGFQLGTRFTLEGKNGGKLLGFHGRSGQALDAIGPYFFAANPPLRHFN
                     PQGWNGGSAWDDGAFDGVRRILVGRGGSFVSFLRFEYARGQRTVPHDHGRRQEVPQEV
                     LIVDIKYMCNCISLCLLRFILLIIKIFWLKFVVDHPNEHITVVEGTIDGFLTSLRFQT
                     SIGRTSPAFGNVVGRRFVFQENNFKLVGFSGRSGDVIDALGANFGPLPAPTPIPAPVP
                     APAPAPAPRPSPAPGPAGRWPPAPAPAPAPGPAPAPGPAPAPGPAPGQGPAPGRAPGP
                     APGRAPGPAPGPAGR"
     gene            1741495..1745542
                     /locus_tag="BRARA_H00190"
                     /db_xref="Phytozome:Brara.H00190"
     mRNA            join(1741495..1741675,1741899..1742141,1743025..1743321,
                     1743408..1743575,1743683..1743850,1743936..1744013,
                     1744132..1744198,1744339..1744436,1744569..1744638,
                     1744733..1744803,1744879..1744928,1745025..1745137,
                     1745254..1745542)
                     /locus_tag="BRARA_H00190"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00190"
     CDS             join(1741637..1741675,1741899..1742141,1743025..1743321,
                     1743408..1743575,1743683..1743850,1743936..1744013,
                     1744132..1744198,1744339..1744436,1744569..1744638,
                     1744733..1744803,1744879..1744928,1745025..1745137,
                     1745254..1745300)
                     /locus_tag="BRARA_H00190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49387.1"
                     /db_xref="Phytozome:Brara.H00190"
                     /translation="MYRTAASRARALKGSLSRGLGPARYASSSAVATSSSSQGFLGWL
                     TGGSSGSLTSLDMPLQGVSLPPPLADRVEPSKLKITTLPNGLKIASEMSPNPAASVGL
                     YVDCGSIYEAPYFHGATHLLERMAFKSTTNRSHLRLVREIEAIGGNTSASASREQMSY
                     TIDALKTYVPEMVEVLIDSVRNPAFLDWEVNEELRKMKVEIAELAKNPMGFLMEAVHS
                     AGYSGALANPLYAPESALHKLNGELLEEFMTENFTAARMVLAASGVEHEDLLKVAEPL
                     TSDLPNVPRQAEPKSQYTGGDFRQHSGGEATHFALAFEVPGWKNEKEALIASVLQMLM
                     GGGGSFSAGGPGKGMHSWLYLRILNEYQQVQSCTAFTSIFDNTGLFGIYGCSSPEFAA
                     KAIELAAKELKDVAGGKVNQKHLDRAKAATKSAVLMNLESRMIAAEDIGRQILTYGER
                     KPVEQFLKAVDELTLKDITDFTSKIISKPLTMGSFGDVLSVPSYDTVSSKFC"
     gene            complement(<1748792..1749875)
                     /locus_tag="BRARA_H00191"
                     /db_xref="Phytozome:Brara.H00191"
     mRNA            complement(join(<1748792..1749229,1749324..1749521,
                     1749636..1749875))
                     /locus_tag="BRARA_H00191"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00191"
     CDS             complement(join(1748792..1749229,1749324..1749521,
                     1749636..1749872))
                     /locus_tag="BRARA_H00191"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49388.1"
                     /db_xref="Phytozome:Brara.H00191"
                     /translation="MGRATRWFKRLFSTKKSLDSDSEKEQNKQAIAVATTTATTAEAA
                     VSAAKAAESVVTGDIITRDERWAAMKIQKVFRGSLARKALRALKGIVKLQALVRGYLV
                     RKRAAVMLHNMQTLVRVQTVMRSKRNRRLNKEYNDMFQPRHSLAEVAAGDALKRRSKS
                     RKKHDVASMSEHKDGFVYQRNDLELNLPKEKWKFARTPRLSSSLHSHSANNRYYVMQS
                     PGKSVCGNATCEYGMSTPGYMEKTQSFKAKVRSHSAPHQRSERMRLSLDEVIASRSSV
                     SGESLQQQPRYSCS"
     gene            complement(1751278..1753467)
                     /locus_tag="BRARA_H00192"
                     /db_xref="Phytozome:Brara.H00192"
     mRNA            complement(join(1751278..1751534,1751624..1751691,
                     1751803..1751935,1752013..1752305,1752653..1753467))
                     /locus_tag="BRARA_H00192"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00192"
     CDS             complement(join(1751500..1751534,1751624..1751691,
                     1751803..1751935,1752013..1752305,1752653..1752936))
                     /locus_tag="BRARA_H00192"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49389.1"
                     /db_xref="Phytozome:Brara.H00192"
                     /translation="MEGSSRNGEISPKLLHLIPQGRRNWFHHEKASVYNTEEKNLELK
                     LGPPGEDEDEDGSSLTRRFKKEQKDKSILSLAGNHHFSPSITTNKPTSQKRNAPGPVV
                     GWPPVRSFRKNLANGSSSKLGNESTSVLKNQKCDDDNGREKTKEPKRQGGLFVKINMY
                     GVPIGRKVDLSAHDSYEQLSLTVDKLFRGLLAAQRESLSFGKEEKPITGLLDGNGEYT
                     LTYEDNEGDKMLVGDVPWHMFVSSVKRLRVIKTSEISSALTYANGKQENMGS"
     gene            1768857..1772609
                     /locus_tag="BRARA_H00193"
                     /db_xref="Phytozome:Brara.H00193"
     mRNA            join(1768857..1769640,1769967..1770050,1770154..1770450,
                     1770518..1770663,1771008..1771097,1771183..1771288,
                     1771370..1771521,1771610..1771707,1771785..1771932,
                     1772004..1772111,1772222..1772609)
                     /locus_tag="BRARA_H00193"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00193"
     CDS             join(1768908..1769640,1769967..1770050,1770154..1770450,
                     1770518..1770663,1771008..1771097,1771183..1771288,
                     1771370..1771521,1771610..1771707,1771785..1771932,
                     1772004..1772111,1772222..1772386)
                     /locus_tag="BRARA_H00193"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49390.1"
                     /db_xref="Phytozome:Brara.H00193"
                     /translation="MSEISSDLNLFLTSPLTKPIKTHFDSPFTFIKSRSFLLKSLLSM
                     NLSASSFLILLSFFFILPNLSSSKPMNCTDTSRLCTSFLAFRPNPNQTFSIIQSMFDA
                     LPSDITADSTGEDDGGGYIYVKKNCSCLTTTPHQYATNTTFTIRQNRGYVYDAVVSAY
                     SGLALPPNTTRASSAGAVVSVQLLCGCSSGLWNYLMSYVTVSGDSVQSLSSRFGVSMD
                     RIEQVNGISNPDNVTTGDLIFIPLDSVPGVPYEARKINPPAPSPSPVLTNSNISATDE
                     VNHTSKGGHVPYIWIVGGLTVVLALLVMCILVCICLRSSSCGSSDEDGNEHNFQILRK
                     SSFFCGSSRYNCCGSGDFRPTNGEETQSHHQAVAIPKALGDGVFEIEKPMVFTYEEIC
                     AATDGFSDSNLLGHGNYGSVYFGLLREQEVAVKRMTATKTKEFAAEMKVLCKVHHSNL
                     VELIGYAATNDELFVVYEYVQKGMLKNHLHDPQSKGNTPLSWIMRNQIALDAARGLEY
                     IHEHTKTHYVHRDIKTSNILLDEAFRAKISDFGLAKLVEQTGEGEISVTKVVGTYGYL
                     APEYLSDGRATSKSDVYAFGVVLFEIISGREAVIRTEAMGTKNPERRPLASIMLAALK
                     NSPDSMNMLSLKEFVDPNMMDLYPHDCLFKIAMLAKQCVDDDPILRPNMKQVVISLSQ
                     ILLSSIEWEATLAGNSQVFSGLVQGR"
     gene            <1774125..>1774484
                     /locus_tag="BRARA_H00194"
                     /db_xref="Phytozome:Brara.H00194"
     mRNA            <1774125..>1774484
                     /locus_tag="BRARA_H00194"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00194"
     CDS             1774125..1774484
                     /locus_tag="BRARA_H00194"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49391.1"
                     /db_xref="Phytozome:Brara.H00194"
                     /translation="MDDIDIAILELTIFMFMIICCCCCCRTGPVELPPQFIDKTPQTQ
                     QDIETGQIKGILFKDIKEKEEEEGCGKRCCPICLEEYEDDHEIRRLEKCRHVFHRFCI
                     DSWLQQKQNCPSCRRSV"
     gene            <1785075..>1786095
                     /locus_tag="BRARA_H00195"
                     /db_xref="Phytozome:Brara.H00195"
     mRNA            join(<1785075..1785143,1785796..>1786095)
                     /locus_tag="BRARA_H00195"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00195"
     CDS             join(1785075..1785143,1785796..1786095)
                     /locus_tag="BRARA_H00195"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49392.1"
                     /db_xref="Phytozome:Brara.H00195"
                     /translation="MKRGRPQLISNLLFKLVKEKGIRGCIVLSIIIVIILIACGSCGI
                     CAPHLPPELIYQTPQPQQDIETGQEKGLMFKDIKEERCDKRSCQICLEEYEDDHEITR
                     LKKCRLTEKRSCPICRCYVV"
     gene            <1786730..>1787134
                     /locus_tag="BRARA_H00196"
                     /db_xref="Phytozome:Brara.H00196"
     mRNA            <1786730..>1787134
                     /locus_tag="BRARA_H00196"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00196"
     CDS             1786730..1787134
                     /locus_tag="BRARA_H00196"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49393.1"
                     /db_xref="Phytozome:Brara.H00196"
                     /translation="MDQSHESLWKHLNESHPMELTVFLVLMLIVCYYCGRNDHMGSPL
                     EPIHQTPQQDIETGRQLPLTKVILFKDIKVEEGGGGGCGKSSCPICLEEYDDDHEITK
                     LNKCGHVFHRFCIDSWLSNDPRRSCPNCRGTV"
     gene            complement(1788018..1790565)
                     /locus_tag="BRARA_H00197"
                     /db_xref="Phytozome:Brara.H00197"
     mRNA            complement(join(1788018..1789269,1789339..1790365,
                     1790475..1790565))
                     /locus_tag="BRARA_H00197"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00197"
     mRNA            complement(join(1788018..1789269,1789339..1790421))
                     /locus_tag="BRARA_H00197"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00197"
     CDS             complement(join(1788991..1789269,1789339..1790331))
                     /locus_tag="BRARA_H00197"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49394.1"
                     /db_xref="Phytozome:Brara.H00197"
                     /translation="MDKISELPDELLLKILSIVPTKVAVSTSILSKRWRFLWMWLPEL
                     EYSDSQGKSLLALRDFINKSLPLHRSPVIERLCLDLWEESHDSKVNPEDIKLWVETAV
                     SRHVRELEVSYLSESNANMFPSGFFTCESLVVLKLRYMTLMDVPSTGCCCLPSLKTLQ
                     LESLTYVGVDSLQNLLSMCHVLEDLEVRFIQDEYPQMFTVIFPLLRRLTLSLPDCEWD
                     LDEYEIDTPFLEYLKLEDWNESLWLFKKNMPSLREAYVHVESYALKSVVRSITSVKRL
                     TVCSEVEEDQDVYGFVFDQLEHLELCVCKDDSLNLLVQFLKDSSNLRALDISILDCHG
                     DKKTDDKFAWYKLSCVPECVLPSLQVFNWSRYIGRPRDRDIAFYVLRNAPNLRTATFR
                     FEQGVPNPKTLKMELTLFPPASSTCELVFVE"
     CDS             complement(join(1788991..1789269,1789339..1790331))
                     /locus_tag="BRARA_H00197"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49395.1"
                     /db_xref="Phytozome:Brara.H00197"
                     /translation="MDKISELPDELLLKILSIVPTKVAVSTSILSKRWRFLWMWLPEL
                     EYSDSQGKSLLALRDFINKSLPLHRSPVIERLCLDLWEESHDSKVNPEDIKLWVETAV
                     SRHVRELEVSYLSESNANMFPSGFFTCESLVVLKLRYMTLMDVPSTGCCCLPSLKTLQ
                     LESLTYVGVDSLQNLLSMCHVLEDLEVRFIQDEYPQMFTVIFPLLRRLTLSLPDCEWD
                     LDEYEIDTPFLEYLKLEDWNESLWLFKKNMPSLREAYVHVESYALKSVVRSITSVKRL
                     TVCSEVEEDQDVYGFVFDQLEHLELCVCKDDSLNLLVQFLKDSSNLRALDISILDCHG
                     DKKTDDKFAWYKLSCVPECVLPSLQVFNWSRYIGRPRDRDIAFYVLRNAPNLRTATFR
                     FEQGVPNPKTLKMELTLFPPASSTCELVFVE"
     gene            1790720..1792947
                     /locus_tag="BRARA_H00198"
                     /db_xref="Phytozome:Brara.H00198"
     mRNA            join(1790720..1790837,1790941..1791006,1791081..1791148,
                     1791319..1791355,1791452..1791521,1791614..1791671,
                     1791841..1791969,1792044..1792135,1792246..1792324,
                     1792412..1792493,1792582..1792947)
                     /locus_tag="BRARA_H00198"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00198"
     CDS             join(1790831..1790837,1790941..1791006,1791081..1791148,
                     1791319..1791355,1791452..1791521,1791614..1791671,
                     1791841..1791969,1792044..1792135,1792246..1792324,
                     1792412..1792493,1792582..1792640)
                     /locus_tag="BRARA_H00198"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49396.1"
                     /db_xref="Phytozome:Brara.H00198"
                     /translation="MTEYKEEQEMEIEALESILADDFKEIHSSESGLNTSNRCFQITV
                     TPQDDDLEESSSIPPVQLGLVFSHTENYPDEAPLLDVKSIRGIHVGDLTILKEKLEQE
                     ATENLGMAMMYTLASSAKDWLSEHYGQDDGDDYAEEEAAKEDEVIVPHGEPVTLETFV
                     AWRERYEAELALERAKLMPESALTAPKEKKLTGRQWFESGKARGTVVTADQESEDEDD
                     EDIDFEDEDFEDDEEDMLEHYLAEKSDARA"
     gene            complement(<1793158..1797540)
                     /locus_tag="BRARA_H00199"
                     /db_xref="Phytozome:Brara.H00199"
     mRNA            complement(join(<1793158..1793233,1793320..1793393,
                     1793481..1793561,1794850..1794936,1795015..1795074,
                     1795157..1795243,1795315..1795516,1795608..1795737,
                     1795819..1796466,1797300..1797540))
                     /locus_tag="BRARA_H00199"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00199"
     CDS             complement(join(1793158..1793233,1793320..1793393,
                     1793481..1793561,1794850..1794936,1795015..1795074,
                     1795157..1795243,1795315..1795516,1795608..1795737,
                     1795819..1796374))
                     /locus_tag="BRARA_H00199"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49397.1"
                     /db_xref="Phytozome:Brara.H00199"
                     /translation="MFGGLGMNPSMDDINLIQQAQRHQLVVTNLGEEIDLEIGTAEDE
                     AAFATNSLIGGTPREPSTGEHDETKHMVLVSDLPGEDQDMSKGQPSAKRKKKVVKRWR
                     EEWADTYKWAYVDMKEGTARIFCSVCREYGRKHRRNPYGNEGSRNMQLSALEEHNNSL
                     LHKEALRLQTASKDKIVVEKPLYVKTLMSKSAGSIVEGALKRDPNEVEFIQSVQESVH
                     ALERVIAKNSHYVNIMERLLEPERMIVFRVPWIDDRGETHVNRGFRVQFNQALGPCRG
                     GIRFHPSMNLSIAKFLGFQQTLKNALSPYKLGGASGGSDFDPKGRSDNEIMRFCQSFM
                     NEMYRYMGPDKDLPSEEVGVGTREMGYLFGQYRRLAGQFQVAAGEIEVLRESNSMQWS
                     AEDFESRLQEALKQTYEKALKAANDFGYQKESPEALLHGATIAAFLNIAQAMTDQGCV
                     "
     gene            1798656..1802570
                     /locus_tag="BRARA_H00200"
                     /db_xref="Phytozome:Brara.H00200"
     mRNA            join(1798656..1798792,1798969..1799114,1799189..1799224,
                     1799298..1799405,1799795..1799895,1799979..1800105,
                     1800186..1800245,1800334..1800452,1800790..1800898,
                     1801044..1801132,1801268..1801337,1801409..1801489,
                     1801568..1801654,1801745..1801793,1801884..1802012,
                     1802100..1802174,1802289..1802570)
                     /locus_tag="BRARA_H00200"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00200"
     CDS             join(1798783..1798792,1798969..1799114,1799189..1799224,
                     1799298..1799405,1799795..1799895,1799979..1800105,
                     1800186..1800245,1800334..1800452,1800790..1800898,
                     1801044..1801132,1801268..1801337,1801409..1801489,
                     1801568..1801654,1801745..1801793,1801884..1802012,
                     1802100..1802174,1802289..1802344)
                     /locus_tag="BRARA_H00200"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49398.1"
                     /db_xref="Phytozome:Brara.H00200"
                     /translation="MLTVSVKWQKKVFEGIEIDVTLPPYVFKAQLYDLTGVPPERQKI
                     MVKGGLLKDDADWSAIGVKDGQKLMMMGTADEIVKAPEKAIVFAEDLPEEEQATNLGY
                     SAGLVNLGNTCYMNSTVQCLKSVPELKSALSNYSLAGRSNDVDQTSHMLTVATRELFG
                     DLDRSVNAVSPTQFWMVLRKKFPQFSQLQNGMHMQQDAEECWTQLLYTLSQSLKAPTS
                     SEDSDAVKALFGVNLRSRVHCQESGEESSETESVYSLKCHISHEVNHLHEGLKHGLKG
                     ELEKISPALGRTAIYLKESLIDSLPRYLTVQFVRFFWKRETNQKAKILRKVDYPLELD
                     IYDLCSEDLRKKLEAPRQKLRDEEGKKLGLQTKSSSKDGDVKMTDAEAPSNESGESST
                     AAQQEGAGGSSSEKGTHMTGIYDLVSVLTHKGRSADSGHYVAWVKQESGKWIQYDDSY
                     PSVQREEDITKLSGGGDWHMAYIIMYKARFVSM"
     gene            complement(<1808508..>1809107)
                     /locus_tag="BRARA_H00201"
                     /db_xref="Phytozome:Brara.H00201"
     mRNA            complement(<1808508..>1809107)
                     /locus_tag="BRARA_H00201"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00201"
     CDS             complement(1808508..1809107)
                     /locus_tag="BRARA_H00201"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49399.1"
                     /db_xref="Phytozome:Brara.H00201"
                     /translation="MQEDLTSAAAYYHHQSMIMTAKQQQPELPEQEQLNCPRCASPNT
                     KFCYYNNYNLSQPRHFCKNCRRYWTKGGSLRNIPVGGGTRKNSSKRSSVGSSSSAPSS
                     SSPKSKTVAVSDQESRTTGNSGQEMDPTRMLYGLPVGDPSGGSFSSLLVSNMQQIRGV
                     NYETGSGWYPGMELGLGSGIRRNDDAALTDLAMNRVEKN"
     gene            complement(<1811420..>1814350)
                     /locus_tag="BRARA_H00202"
                     /db_xref="Phytozome:Brara.H00202"
     mRNA            complement(join(<1811420..1811550,1811625..1811683,
                     1811781..1811858,1811931..1812022,1812110..1812178,
                     1812252..1812355,1812472..1812576,1812670..1812788,
                     1812907..1812998,1813096..1813203,1813491..1813610,
                     1813697..1813795,1813889..1813992,1814245..>1814350))
                     /locus_tag="BRARA_H00202"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00202"
     CDS             complement(join(1811420..1811550,1811625..1811683,
                     1811781..1811858,1811931..1812022,1812110..1812178,
                     1812252..1812355,1812472..1812576,1812670..1812788,
                     1812907..1812998,1813096..1813203,1813491..1813610,
                     1813697..1813795,1813889..1813992,1814245..1814350))
                     /locus_tag="BRARA_H00202"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49400.1"
                     /db_xref="Phytozome:Brara.H00202"
                     /translation="MNGEVVSASADPSPPLEWRFSQVFGERSAGEEVHEVDVISAIQF
                     DNSGDHLATGDRGGRVVLFERTDAKNSSGGARRDLEETYYPLRHPEFGYKTEFQSHDP
                     EFDYLKSLEIEEKINKIRWCQTANDALFLLSTNDKTIKFWKVQDKKIKKICDVNSDLS
                     RTVVNGEVPEANSSSLRLPVTSHESSPVARCRRVYSHAHDYHINSISNNSDGETFISA
                     DDLRINLWNLEITNQSFNIVDVKPEKMEDLSEVITSAEFHPTHCNMLAYSSSKGSIRF
                     IDLRQSALSGSKSFFTEIIASVSDMKFAKERRCLLSRDFMTLKLWDINMDSGPVSTFQ
                     VHEHLKPKLCDLYENDSIFDKFECCISGNGLQAATGSYSNMFRVFGVSPGSTETASLE
                     ASRNPTRRHVPVPSSPFKALSRVVSRESPGVDGNSNALDYTTKLLHLAWHPSENSIAC
                     AAGNSLYMYYA"
     gene            complement(<1819079..>1820146)
                     /locus_tag="BRARA_H00203"
                     /db_xref="Phytozome:Brara.H00203"
     mRNA            complement(<1819079..>1820146)
                     /locus_tag="BRARA_H00203"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00203"
     CDS             complement(1819079..1820146)
                     /locus_tag="BRARA_H00203"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49401.1"
                     /db_xref="Phytozome:Brara.H00203"
                     /translation="MKPVQSAPVKSRPRRRPDLSLPLPQRDVSLAVPLPLPPTSSGSS
                     SSSSSAPSSAGSSAPKNYSDLERGNRIGSGAGGTVYKVTHRPTSREYALKVIYGNHEE
                     NVRRQICREIEILRDVNHQNIVKCHEMFDQNGEIQVLLEFMDGGSLENRHVSNERDLA
                     HLSHQILNGLAYLHGRHIVHRDIKPSNLLINSDKIVKIADFGVSRILAQTMDPCNSSV
                     GTIAYMSPERINTDLNQGRYDGYAGDIWSLGVSILEFYLGRFPFNVSRQGDWASLMCA
                     ICMSQPPEAPATASPDFRNFISCCLRREPARRMTATQLLQHPFIRRAVSQGQNRSPQN
                     LHQLLPPPPRTLSSSSSSPTT"
     gene            complement(1824891..1825887)
                     /locus_tag="BRARA_H00204"
                     /db_xref="Phytozome:Brara.H00204"
     mRNA            complement(join(1824891..1825145,1825595..1825887))
                     /locus_tag="BRARA_H00204"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00204"
     CDS             complement(join(1825027..1825145,1825595..1825778))
                     /locus_tag="BRARA_H00204"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49402.1"
                     /db_xref="Phytozome:Brara.H00204"
                     /translation="MASSAAVPFWRAAGMTYITYSNICANLVRNCLKEPFKEEALSRE
                     KVHFSISKWADGKPEKPILRSHTWSLKFLTFKVNNGAGARNCCVTSATKMIFFYLL"
     gene            1829946..1832031
                     /locus_tag="BRARA_H00205"
                     /db_xref="Phytozome:Brara.H00205"
     mRNA            join(1829946..1830198,1830401..1830545,1830629..1830699,
                     1830772..1830857,1830933..1831506,1831585..1832031)
                     /locus_tag="BRARA_H00205"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00205"
     CDS             join(1830097..1830198,1830401..1830545,1830629..1830699,
                     1830772..1830857,1830933..1831506,1831585..1831863)
                     /locus_tag="BRARA_H00205"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49403.1"
                     /db_xref="Phytozome:Brara.H00205"
                     /translation="MGVDLRQVVAGILTITMFVMLGQMLHRDYFDANQVQGDAHDIEF
                     HGSKVSLEDGLVRSSEGTKGPWMEDSNDLKSCWSISESDEAVSSKGYVTFSLTNGPEY
                     HVSQITDAVMVAKHLGATLVLPDIRGSKPGDEMNFEDIYDVDKLVKSLESVIKVVKKL
                     PSHVSLRDIAIVKVPTRVAEDYIKEHISPIFKSKGNIRVTTYFPSVNLRKSSLDGGET
                     DPVSCLAMFGSLELQPGVNELVEAMIQRLKKKSNGRFIAIDLRVEILEKKNCRETGAG
                     GSKTCYNAQEIAVFLRKLGFDGDTTIYLTQPRWESSLNILKDIFPKTFTKEAIMPAEK
                     KSKYLELENSEYENVIDFYISSRSDVFVPAIPGLFYANTVGKRIALGKPQVLVPAEIS
                     GTSGLSTDYISPYISKKNHLAYSCFC"
     gene            complement(1833161..1835356)
                     /locus_tag="BRARA_H00206"
                     /db_xref="Phytozome:Brara.H00206"
     mRNA            complement(join(1833161..1833575,1833687..1833792,
                     1833915..1834049,1834120..1834253,1834398..1834484,
                     1834562..1834898,1835143..1835356))
                     /locus_tag="BRARA_H00206"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00206"
     CDS             complement(join(1833426..1833575,1833687..1833792,
                     1833915..1834049,1834120..1834253,1834398..1834484,
                     1834562..1834873))
                     /locus_tag="BRARA_H00206"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49404.1"
                     /db_xref="Phytozome:Brara.H00206"
                     /translation="MDDDELHGSNGRMHIAEAQDPLHHVHYGHHALQHIHNGSGMVDD
                     HADGSGGGMSDGVDTDVPSHPGNITDNRGEVVDRGSEQGDQLTLSFQGQVYVFDSVLP
                     EKVQAVLLLLGGREVPQAPPTGLGASHQNNRGLPGTPQRCSMPQRLASLVRFREKRKE
                     RNFDKKIRYTVRKEVALRMQRNKGQFTSAKSNNGEAAADGSSWESSQTWAIEGSEAHH
                     NQEISCRHCGIGEKSTPMMRRGPEGPRTLCNACGLMWANKGALRDLSRGAPQTFQNLP
                     VNNEVSNMQEEANLEADQMMGTVANDISNSQ"
     gene            1836069..1839665
                     /locus_tag="BRARA_H00207"
                     /db_xref="Phytozome:Brara.H00207"
     mRNA            join(1836069..1836385,1836555..1836602,1836679..1836840,
                     1836948..1837060,1837137..1837202,1837358..1837532,
                     1837755..1837844,1838013..1838137,1838220..1838285,
                     1838357..1838465,1838547..1838645,1838727..1838807,
                     1838879..1839049,1839133..1839665)
                     /locus_tag="BRARA_H00207"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00207"
     CDS             join(1836227..1836385,1836555..1836602,1836679..1836840,
                     1836948..1837060,1837137..1837202,1837358..1837532,
                     1837755..1837844,1838013..1838137,1838220..1838285,
                     1838357..1838465,1838547..1838645,1838727..1838807,
                     1838879..1839049,1839133..1839351)
                     /locus_tag="BRARA_H00207"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49406.1"
                     /db_xref="Phytozome:Brara.H00207"
                     /translation="MARGRSITSSGIWRYLNPAYYLRRPKRLALLFFVFVSVSMVVWD
                     RMNLAREHEVEVYKLNEEVSRLEQMLEELKSVGNGKTLMTQKDVPQNPVDIERRQKVK
                     EAMIHAWSSYEKYAWGKDELQPRTKDGTDSFGGLGATMIDSLDTLYIMGLHEQFQKAR
                     EWVATSLDFDKDYDASMFETTIRVVGGLLSTYDLSGDKLFLDKAKDIADRLLPAWNTP
                     TGIPYNIINLRSGSAHNPSWAAGGASILADSGTEQLEFIALSQRTGDPKYQQKVEKVI
                     TELNKNFPADGLLPIYINPDNGNPSYSTTTFGAMGDSFYEYLLKVWVQGNKTSEVKLY
                     REMWEKSMKGLLSLINKSTPSSFTYIREKNGNNFIDKMDELACFAPGMLALGASGYGP
                     DDEKKFLTLAEELAWTCYNFYQSTPTKLAGENYFFNAGQDMSVGTSWNILRPETVESL
                     FYLWRLTGNKTYQEWGWNIFQAFEKNSRIESGYVGLKDVNTGAKDNKMQSFFLAETLK
                     YLYLLFSPPSVISLDEWVFNTEAHPLKIVARNEQRKPTITLRQRRFGGIIKG"
     gene            complement(1839131..1841835)
                     /locus_tag="BRARA_H00208"
                     /db_xref="Phytozome:Brara.H00208"
     mRNA            complement(join(1839131..1839662,1839754..1839939,
                     1840013..1840074,1840158..1840371,1840443..1840694,
                     1840760..1841140,1841220..1841835))
                     /locus_tag="BRARA_H00208"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00208"
     CDS             complement(join(1839525..1839662,1839754..1839939,
                     1840013..1840074,1840158..1840371,1840443..1840694,
                     1840760..1841140,1841220..1841813))
                     /locus_tag="BRARA_H00208"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49405.1"
                     /db_xref="Phytozome:Brara.H00208"
                     /translation="MDFPSSKRPATASAESVQFRLLCPASRTGAIIGKGGSVIRHLQS
                     LTGSKIRVIDDIPVPSEERVVLITAPNATKKDDSSNACDPENPSSDQTKPPETAAADK
                     PGEEAPPPPPSSSALVRVLERIVFGDDAANGDGSELDKGEFEGLCRVLVRGNQVDYLM
                     SQGGMMMQRIRDESGASVRIASTDQIPPCAFPGDVVIQINGKFSNVKKALLMITSSLQ
                     ESGAPPTWEECSFPPPGYPPDYHSMEYHQWDHPPNPMAEDVGPFNRPPIVEEEVAFRL
                     LCPADKVGSLIGKGGAVVRALQNETGASIKVSDPTHETEERIVVISARENLERRHSLA
                     QDAVMCVHNRIVEIGFEPSAAVVARLLVHSPFIGRLLGKGGHVISEMRRATGASIRVF
                     AKDQATKYESQHDEIVQIIGNVKTVQDALFQITSRLREAMFPGRIPFPGMGGPPPPFM
                     GPYPEPPPPFGPRPYPASPDRYHSPVGPYHERHCHGPGFDRPPSPMSWTPQPPIDGHP
                     GGMVPDVNHGFALRNEPIGGENLPMTSANVEIVVPQAYLGHVYGENCSNLNYIKQVTG
                     ANVVVHDPKAGTTEGLVVVSGTSDQAHFAQSLLHAFILCGQS"
     gene            complement(<1842510..>1844255)
                     /locus_tag="BRARA_H00209"
                     /db_xref="Phytozome:Brara.H00209"
     mRNA            complement(<1842510..>1844255)
                     /locus_tag="BRARA_H00209"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00209"
     CDS             complement(1842510..1844255)
                     /locus_tag="BRARA_H00209"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49407.1"
                     /db_xref="Phytozome:Brara.H00209"
                     /translation="MSSLHKTTWTQAGVFEAIMASTKGFVKNTDLLLGIAEKWCPDTN
                     TFFFPWGEATITLEDVMFLLGFSVLGSPVFAALDESGERVKEKLVKESLRIKKDNNFV
                     FVSQVEWMRRFMNDDDDDDELEHVAFLALWLSYFVFPSGYYHIDEVVFSVAVHVSRGT
                     RIALAPAVLAHLYAELTLLKRHIREFITIEDKIELKGLFKLVQVWTWERFKELQPEKA
                     NPLLKGEARLSIWCDDSTQKRSSNVRKVLEEAKVESFEWRPYTKALENWEFPLFYPEE
                     AMWVPVDAALDDEFITFARCVKVSKLVGIDCVENYFPNRVAAQFGLLQDVTCHVERKS
                     LSKEEAWDEYNNPLDELTLYIPSRCIIPWWKKSSSEWWKKLSPEENQAVESLTPRNII
                     GDDDDYTSNSASSGCKRWKSMKRFYEDDEDDSLTIAQVMRLRKKDTSKVLSLSEVLKK
                     MGDGFPKKLKRSRYIRTRRSVRSEIEKGKIGDCGGSASRGVLLDDLFDKELVKRKSEC
                     LGKKRAREEDDEICYDDITTAEMIICREKSGGDASEDETVVATREIKQEETDTRSKAA
                     NENNSLDHPLLWWKL"
     gene            1845079..1846893
                     /locus_tag="BRARA_H00210"
                     /db_xref="Phytozome:Brara.H00210"
     mRNA            join(1845079..1845370,1845645..1845781,1846188..1846342,
                     1846619..1846893)
                     /locus_tag="BRARA_H00210"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00210"
     CDS             join(1845106..1845370,1845645..1845781,1846188..1846342,
                     1846619..1846664)
                     /locus_tag="BRARA_H00210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49408.1"
                     /db_xref="Phytozome:Brara.H00210"
                     /translation="MANIEAEAVDFEPEEDDLMDEDVGASDLSPRAGHPRLRSAIAGA
                     NDESANRKTKGRGFREEKDSDRQRRLSSRDFESLGSDGGPGPQRSIEGWIVLVTGVHE
                     EAQEDDISNAFGDFGEIKSLHLNLDRRTGFVKGYALIEYEKSEEAQSAIKAMNGAELL
                     TKNVSVDWAFSNGPNNAGSYRRRNMRSGRSQRSRSPRRRF"
     assembly_gap    1859196..1869195
                     /estimated_length=unknown
                     /gap_type="between scaffolds"
     gene            1877089..1878424
                     /locus_tag="BRARA_H00211"
                     /db_xref="Phytozome:Brara.H00211"
     mRNA            join(1877089..1877292,1877395..1877431,1877717..1878424)
                     /locus_tag="BRARA_H00211"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00211"
     mRNA            join(1877089..1877292,1877717..1878424)
                     /locus_tag="BRARA_H00211"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00211"
     CDS             join(1877170..1877292,1877395..1877431,1877717..1878255)
                     /locus_tag="BRARA_H00211"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49410.1"
                     /db_xref="Phytozome:Brara.H00211"
                     /translation="MRFSLWKREKPKPFFFLSSPIFSASAGSLQQRRSFLGEIRTGLI
                     DQPRLLGQSEMDHDETGCQSPPEGPKLCINNCGFFGSSATMNMCSKCHKAILFQQEQG
                     ARFASAVSGCTSSSSNILKETFAATALVDAETKSVEPVAVFVQPSSVQVVVAEVVAPE
                     AAASIPKEGPSRCATCNKRVGLTGFKCRCGDLFCGTHRYADIHNCSFNYHAAAQEAIA
                     KANPVVKAEKLDKI"
     CDS             join(1877184..1877292,1877717..1878255)
                     /locus_tag="BRARA_H00211"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49409.1"
                     /db_xref="Phytozome:Brara.H00211"
                     /translation="MEERKAETFFFSLVSNFLSFCWISPAETILPWRDSYEMDHDETG
                     CQSPPEGPKLCINNCGFFGSSATMNMCSKCHKAILFQQEQGARFASAVSGCTSSSSNI
                     LKETFAATALVDAETKSVEPVAVFVQPSSVQVVVAEVVAPEAAASIPKEGPSRCATCN
                     KRVGLTGFKCRCGDLFCGTHRYADIHNCSFNYHAAAQEAIAKANPVVKAEKLDKI"
     gene            complement(1878707..1883561)
                     /locus_tag="BRARA_H00212"
                     /db_xref="Phytozome:Brara.H00212"
     mRNA            complement(join(1878707..1879026,1879239..1879453,
                     1879552..1879656,1879747..1880310,1880405..1881199,
                     1881290..1881418,1881726..1881869,1881953..1882084,
                     1882196..1882282,1882358..1882458,1882544..1882742,
                     1882804..1882860,1882934..1883107,1883177..1883561))
                     /locus_tag="BRARA_H00212"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00212"
     CDS             complement(join(1879023..1879026,1879239..1879453,
                     1879552..1879656,1879747..1880310,1880405..1881199,
                     1881290..1881418,1881726..1881869,1881953..1882084,
                     1882196..1882282,1882358..1882458,1882544..1882742,
                     1882804..1882860,1882934..1883107,1883177..1883422))
                     /locus_tag="BRARA_H00212"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49411.1"
                     /db_xref="Phytozome:Brara.H00212"
                     /translation="MNAEKMDERRRTSRKKSSVAAAVRAKIPRSALRKINCQKLLTSQ
                     YILAKVFRKDGPSLGFQFDHLPPSSSSVDQQRVGRKRKVSEQHTSQDDCVVVKKKQYG
                     IGKGLMTAWRVMNPNSHERATLAQSNPKKTKTQLASILKQKQKKKSTEKKRTSINTET
                     TEELNKDETVGFSEKCELGEVFKETCQTMSILVDDEELERQEGLVNPPLTCSCHTATC
                     GSCFLCKDLLPKFPPSSVGMRLPFALHPWNSSPESVKKLFKVVHFLYTYSVTLDICPF
                     TIDEFTRAFHDKDSLLLGKIHLSLLKLLLVDVETELQRGSFSTLSISCKFLALLQSVE
                     SQIRILDMWKDSLNSLTWAEILRQILVAAGFGSVKRAAGQSEELSKERRLMKKYGLRL
                     GTLKGELFRMLNEQGGKNGLKISELANAAVEVAALNLATASEEERECSICSTLASDIT
                     LFEKISESTYRARVSCFSEDHESDSGESGSVDDDEESGDEMGRVSESFVFRKAKRRKH
                     RSKMLEVCSEIDESHPGEAWLLGLMEGEYSDLSIEEKLDVFIALIDLLSSGSTIRMED
                     LPRAMVDCVPSIYSHGSGGKIKRASSSNHPRVSWVHGGERIEKLSKSSDSHPVDSSSI
                     VGADFAKLAGDNVHPMQSVYLGSDRRFNRYWLFLGPCNANDPGHRCVYFESSEDGHWE
                     VISHKEALRALLSVLDDRGRREARLIESLEKRESFLCQAMLRRIDHVVREDSSSSPVS
                     DIDNNNLCLNEIANDQQAAIVFEKRGNSLLWSLVQEFDEWIWDKYYLNLNAVKHSRRS
                     YLDSLTRCKSCHDLYWRDEKHCKICHATFELDIDLEERYAIHEATCSRKNEETSDSFP
                     DHKVLSSQLQSLKAAVYAIESAMPEDALIGAWKKSAHRLWAKRLRRSSTLSEITQVIG
                     DFVGAINEDWLWHFGEEDGEIITSFPSMPRTTSAIALWLVKLDTLIASYVVEKAPQPE
                     GNQLNRTRKHK"
     gene            <1884453..>1884971
                     /locus_tag="BRARA_H00213"
                     /db_xref="Phytozome:Brara.H00213"
     mRNA            join(<1884453..1884659,1884775..1884841,1884874..>1884971)
                     /locus_tag="BRARA_H00213"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00213"
     CDS             join(1884453..1884659,1884775..1884841,1884874..1884971)
                     /locus_tag="BRARA_H00213"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49412.1"
                     /db_xref="Phytozome:Brara.H00213"
                     /translation="MLKGNIYFFAKENLFSESENTVYINIVGDPILYIYDDVVLKEKD
                     AHVKNSICDDDENNFIKIARISDGHEGPTRCATCKKRVGLTGFKCRSDIHNCSFNYHV
                     AVQEPIAKANPVVKAEKLDKI"
     gene            <1886530..>1898449
                     /locus_tag="BRARA_H00214"
                     /db_xref="Phytozome:Brara.H00214"
     mRNA            join(<1886530..1887575,1898425..>1898449)
                     /locus_tag="BRARA_H00214"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00214"
     CDS             join(1886530..1887575,1898425..1898449)
                     /locus_tag="BRARA_H00214"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49413.1"
                     /db_xref="Phytozome:Brara.H00214"
                     /translation="MEARRLSAAAKGKKIATDLYQAPRTGRIQVEETENAYLTHKHAL
                     TLIGRVTNPSAQKVWAVIAFFSEHWKTERKIVGADLGQGLFQFQFELETDLLAVLDKR
                     PYHYGRWMIILQRWEPTTSPHFPSLIPFWIKVQGIPVHLWTEDTIRRLGEDIGVFEEA
                     DITSLAVRMRVHINGRLPLIKESVIEYKGGSEVIAHFVYEKLEKHCSMCQRLDHELRD
                     CLEAKARKRDALKEKEEAKERLEGQPAGERHRQNREVNFRASGAREYDRRRPAESETY
                     SRRGRDAQERNKYPPRHHPYARSTRENSRDRGSQQHSSFFQRHVQTSYQPRDQNSQER
                     VHKPISKDTNSQEQGTLIRYPS"
     assembly_gap    1887726..1897725
                     /estimated_length=unknown
                     /gap_type="between scaffolds"
     gene            complement(1927766..1929646)
                     /locus_tag="BRARA_H00215"
                     /db_xref="Phytozome:Brara.H00215"
     mRNA            complement(join(1927766..1928040,1928127..1928245,
                     1929145..1929259,1929349..1929646))
                     /locus_tag="BRARA_H00215"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00215"
     CDS             complement(join(1927989..1928040,1928127..1928245,
                     1929145..1929259,1929349..1929572))
                     /locus_tag="BRARA_H00215"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49414.1"
                     /db_xref="Phytozome:Brara.H00215"
                     /translation="MQFFGGSEINPSPQVPTASGNNAHMMYVFNRNGVCLLYKEWNRP
                     LHTLNPQQDHKLMFGLLFSLKSLTAKMDPVNADKGNLGVPQLPGQGCSFHSFRTNTYK
                     LSFMETPSGIKIILVTHPKTGDLRESLKYIYGLYVEYVVKNPIYNPGSPIKSELFNTA
                     LDQYVRSIS"
     gene            <1940002..>1941105
                     /locus_tag="BRARA_H00216"
                     /db_xref="Phytozome:Brara.H00216"
     mRNA            <1940002..>1941105
                     /locus_tag="BRARA_H00216"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00216"
     CDS             1940002..1941105
                     /locus_tag="BRARA_H00216"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49415.1"
                     /db_xref="Phytozome:Brara.H00216"
                     /translation="MGMRSNTGLFFSQPQPIIDDDGHTDDEFDVDKLEKRIWRQGMRL
                     QRLKERSKNKERDDEQLISKCMFKMMEVCNAQGFVYGIIPENGKPIISASHNLQEWWK
                     DKVRFDLNGPIAIAKHQKSNNMVCESNEEGNNIANQLSQKLLRDLQDPTLGWLLSALM
                     PHCDPPQRRFPFEKRVRPPWWPTGEEYWWPKDQGPAPPYKKPHDLKKSWKIGVLTSVI
                     KHLSPGTMREIVTQTKSLWNKMTTKEKDIWFNVIDQEEASKHENMLNTSNFEINVGFQ
                     DMNSRENNQPICRNRNGHFASSKFHVMPMHDRNINGNQSCLVEGNQSVNLQPEAQNHQ
                     EHWHFGRTEGNIFERSSVEDLMKLSSNNNKRTV"
     gene            complement(<1949737..>1950756)
                     /locus_tag="BRARA_H00217"
                     /db_xref="Phytozome:Brara.H00217"
     mRNA            complement(<1949737..>1950756)
                     /locus_tag="BRARA_H00217"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00217"
     CDS             complement(1949737..1950756)
                     /locus_tag="BRARA_H00217"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49416.1"
                     /db_xref="Phytozome:Brara.H00217"
                     /translation="MVILHEISNEAKTTTEASGSSNSFLRLATKPTASTTTRIALSNT
                     ATTKYKGVVQQQNGHWGAQIYAEHRRIWLGTFKSAAEAAAAYDSASIKLRGFDGNSHR
                     NFPWSEITVHEPDFQILYTTEAVLNMIRDGSYHHKFRDHVMSRSRMANFNMVESKQES
                     NKCFSCTQLFHKELTPSDVGKLNRLVIPKKYAVKHLPFISDDQEEGEAVDDVEVVFYD
                     STMRQWKFRYCYWRSSQSFVFTRGWNGFVKEKNLKEKDVIVFYSCDVPSNVRRLEGQS
                     NKFLMIDVDHKGFVAPKEENKMVHNRSEGEMKTENFFNSKLEDEETKQEEKKGGFMLF
                     GVRIQ"
     gene            complement(<1951536..>1952300)
                     /locus_tag="BRARA_H00218"
                     /db_xref="Phytozome:Brara.H00218"
     mRNA            complement(join(<1951536..1951724,1951755..1951850,
                     1951897..1951949,1952051..1952132,1952289..>1952300))
                     /locus_tag="BRARA_H00218"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00218"
     CDS             complement(join(1951536..1951724,1951755..1951850,
                     1951897..1951949,1952051..1952132,1952289..1952300))
                     /locus_tag="BRARA_H00218"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49417.1"
                     /db_xref="Phytozome:Brara.H00218"
                     /translation="MAEKVTIMKLTVDLACSKCYKKAKKAIRKFPQIRDELYDEKTNT
                     IIIKVSIVILEPPKPPPAQAQPSEKPKEPEKVPAPAPAPAPAPAPAPQLMPISAYHCG
                     PYYEAQQYEYSWRPVNESWGGGPHPPHCCHEVTYQQSCSIM"
     gene            <1967548..>1968331
                     /locus_tag="BRARA_H00219"
                     /db_xref="Phytozome:Brara.H00219"
     mRNA            join(<1967548..1967832,1967900..>1968331)
                     /locus_tag="BRARA_H00219"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00219"
     CDS             join(1967548..1967832,1967900..1968331)
                     /locus_tag="BRARA_H00219"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49418.1"
                     /db_xref="Phytozome:Brara.H00219"
                     /translation="MGDKIRKSDLICELPDELVLKILSLLPSKDVVATSVLSKRWHSL
                     WKEMKTFRYNDELRCGITVSKFTRFISRRSRVEILQLKLNPCYEKPINKRLLPESLFS
                     CPQLETLILEKLSLVDVPPNADLACLKHLHLLSVRFSCEESVKTLLSICPRLEELVVR
                     RSSYTNVKIFVINVPTLRSLSIDNSSGKSRPKGVHGFVINAHSLRSFSIRDSFSNYLR
                     FRNMPKLVNSTVKVVCDIMI"
     gene            complement(1970206..1971103)
                     /locus_tag="BRARA_H00220"
                     /db_xref="Phytozome:Brara.H00220"
     mRNA            complement(join(1970206..1970782,1970872..1971103))
                     /locus_tag="BRARA_H00220"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00220"
     CDS             complement(join(1970570..1970782,1970872..1971060))
                     /locus_tag="BRARA_H00220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49419.1"
                     /db_xref="Phytozome:Brara.H00220"
                     /translation="MAGRGKTLGSAAAKKATTRSSKAGLQFPVGRIARFLKKGKYAER
                     VGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKTRIVPRHIQLAVRNDEELSKLLGDV
                     TIANGGVMPNIHNLLLPKKAGGSSKPSGDDD"
     gene            complement(<1977752..>1986259)
                     /locus_tag="BRARA_H00221"
                     /db_xref="Phytozome:Brara.H00221"
     mRNA            complement(join(<1977752..1977797,1978005..1978107,
                     1980228..1980324,1980442..1980473,1980556..1980691,
                     1984342..1984426,1984560..1984684,1984794..1985037,
                     1985162..1985249,1985338..1985415,1985537..1985612,
                     1985710..1985768,1985883..1985943,1986071..>1986259))
                     /locus_tag="BRARA_H00221"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00221"
     CDS             complement(join(1977752..1977797,1978005..1978107,
                     1980228..1980324,1980442..1980473,1980556..1980691,
                     1984342..1984426,1984560..1984684,1984794..1985037,
                     1985162..1985249,1985338..1985415,1985537..1985612,
                     1985710..1985768,1985883..1985943,1986071..1986259))
                     /locus_tag="BRARA_H00221"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49420.1"
                     /db_xref="Phytozome:Brara.H00221"
                     /translation="MAVPKAHYSLAILVILFVVSNCQNACNPECKAKEPFNCDNSLTF
                     NRTGFPKNFTFGAATSAYQIEGAAHRALNGWDYYTHRYPERVPDRSSGDVACDSYDLY
                     KEDVKLLKRLKVQAYRLSIAWSRVLPKGRLTGGVDENGITYYNNLINELKANGIEPFV
                     TIFHWDVPQTLEDEYGGFLSPRIVEDFKNYAELLFQRFGDRVKFWITLNQPYSLSSKG
                     YGDGSYPPGRCTGCEFGGDSGTEPYIVTHHQLLAHAEAVSLYRKRYQKFQGGKIGTTL
                     IGRWFAPLNETSDLDQAAARRAFQFFVLDGTFLDPLVYGEYPTIMRELVGDRLPKFTP
                     QQESDLVKGSLDFLGLNYYVTQYASDASPPPQTHPSVLTDPRVTLGYYRNGVPIGVES
                     PSFVYYPPGFRQILNHIKDNYQNPLTYITENGVADYGNLTVANALADNGRIQNHCSHL
                     SCLKCSIEEKDSGKWYSRFVAK"
     assembly_gap    1987602..1997601
                     /estimated_length=unknown
                     /gap_type="between scaffolds"
     gene            <2013205..>2014563
                     /locus_tag="BRARA_H00222"
                     /db_xref="Phytozome:Brara.H00222"
     mRNA            <2013205..>2014563
                     /locus_tag="BRARA_H00222"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00222"
     CDS             2013205..2014563
                     /locus_tag="BRARA_H00222"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49421.1"
                     /db_xref="Phytozome:Brara.H00222"
                     /translation="MLSPTPQESKRNRLKPHIMVFPYPAQGHLLPLLDLTHQLCLHGN
                     VTVSIIVTPKNLPHLSPLLSAHPSAVSAVTLPLPHSPSGVENVKDLGCTPHIMASLRQ
                     LREPIIKWLRSHPNPPVALISDFFLGWTNDLGVPRFAFFSSGAFFASLVHYVSDKRHL
                     YDQTEPVYISDLPRSPVLKTEHLPLTPQSPLSRDVNIVRDMTMNFSSHGCIFNSCNCL
                     EEEYMEYLKLKVAHNRVFGVGPVSSVGLGKGKSELNVDVKTLFSWLDGCPDGSVLYIC
                     FGSQKVLSKEQCDALALGLEKSMTRFVWVAKTDPIPDGFEDRVAGRGMIIIGWAPQVA
                     VLSHVAVGGFLSHCGWNSVLEAVASGTTILAWPMEADQFVDAKLLVEYTGVAVSVCEG
                     GKTVPNPHELGRVIAETMGEKGRELRVRAKEMGKKARAATEVRGSSTIDLERLVKELG
                     SL"
     gene            complement(<2024766..>2026739)
                     /locus_tag="BRARA_H00223"
                     /db_xref="Phytozome:Brara.H00223"
     mRNA            complement(join(<2024766..2026301,2026332..2026411,
                     2026475..>2026739))
                     /locus_tag="BRARA_H00223"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00223"
     CDS             complement(join(2024766..2026301,2026332..2026411,
                     2026475..2026739))
                     /locus_tag="BRARA_H00223"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49422.1"
                     /db_xref="Phytozome:Brara.H00223"
                     /translation="MFHSDGRSVEALLIHMPKRRIWDVEGRVRGTNLGNNRFHFDFDK
                     EEDLLKVLDKRPCHFNRWSFSLERWTPTIKEEFPNSLPFWAVVSVFDKADVDRSRVRV
                     FVNGDLPLKFECKVTIQYEDLYRYCYSCKRISHEEGTCPELNDNQRERYRLARIDQKD
                     KEDRATKEAFSQPQRSPRDYTDIYNRESRGRELRSIYQEAPESRRDGRREEERYNDLR
                     KHLKERRDAHSKNVWKRLEPGNHSELPRDRERYHPYQHSSGALSKGRTRDAASSSEWR
                     PKRVQENRYEQQPTKHRDQGFMGSRSRMSMDSQRTISENPKRLGAISSGRGRNSRSPP
                     SGVLEWRPVNRERVTEKPRGLLKKNTLPTNFKDNPEEEVRADSIRRRSNSNDHDLGKG
                     SQSIHGMEAVSTERTQVEGANITAEKAPLSSDLDQVMHLEEDPKKGQETEKDREEKEL
                     EKSIAEFADHDMTEDMINEDDLLADFEEMEKQTQAEDKEDGRIEAISQLSPQRPHNKT
                     AEEAAPTDKQIKKRVLKEKFQDDSSKNQRNHQESQQITTLGKKRGARSPDLKGAAASR
                     KLATRGRLSPKPKTMKTAREISYDSRKGPRHEVYPSAIKSRKPVSTLGSMVSQKPSSS
                     KI"
     gene            complement(<2029073..>2037837)
                     /locus_tag="BRARA_H00224"
                     /db_xref="Phytozome:Brara.H00224"
     mRNA            complement(join(<2029073..2029156,2029313..2029358,
                     2029485..2029541,2029669..2029727,2029951..2030048,
                     2030134..2030255,2030387..2030438,2037306..2037389,
                     2037464..2037659,2037733..>2037837))
                     /locus_tag="BRARA_H00224"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00224"
     CDS             complement(join(2029073..2029156,2029313..2029358,
                     2029485..2029541,2029669..2029727,2029951..2030048,
                     2030134..2030255,2030387..2030438,2037306..2037389,
                     2037464..2037659,2037733..2037837))
                     /locus_tag="BRARA_H00224"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49423.1"
                     /db_xref="Phytozome:Brara.H00224"
                     /translation="METKTQVEDSIIQESLLTCIDLANSDHQSVLSLKQACLDSGFFY
                     VINHGISEEVMDKAFEQSKNFFALPLVEKMKVLKNEKHRGYTPFYDQIPDPENQVQGD
                     HKEGYYIGSEVPRDDPQWDYPFYGPNYVLPGWRETMEKYHQEALRVCKAIAKLLALAL
                     DMDADYFDSPEMLGKPISTLRLLHYEGKTDPSKGIYGTGAHSDYGMMTLIATDGVFGL
                     QICKDRNAKPQKWEYVRSIEGALVVNLGDMMQCWSNGLFRSTMHRVILNDQNRYSIPF
                     FLEPNHDCIIECLPTCQSESNLPK"
     gene            2038679..2039171
                     /locus_tag="BRARA_H00225"
                     /db_xref="Phytozome:Brara.H00225"
     mRNA            2038679..2039171
                     /locus_tag="BRARA_H00225"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00225"
     CDS             2038876..2039085
                     /locus_tag="BRARA_H00225"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49424.1"
                     /db_xref="Phytozome:Brara.H00225"
                     /translation="MLEIVVVAAGIVIASAADPRESLIGATMVNFLLFTTYGPPTLGY
                     SPIYLKLLICSSFFTIIPNIFNCTI"
     gene            complement(<2048268..>2049954)
                     /locus_tag="BRARA_H00226"
                     /db_xref="Phytozome:Brara.H00226"
     mRNA            complement(join(<2048268..2048366,2048464..2048589,
                     2048641..2048832,2048925..2049002,2049086..2049145,
                     2049248..2049321,2049399..2049438,2049730..>2049954))
                     /locus_tag="BRARA_H00226"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00226"
     CDS             complement(join(2048268..2048366,2048464..2048589,
                     2048641..2048832,2048925..2049002,2049086..2049145,
                     2049248..2049321,2049399..2049438,2049730..2049954))
                     /locus_tag="BRARA_H00226"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49425.1"
                     /db_xref="Phytozome:Brara.H00226"
                     /translation="MCLATKTEYFLYELSKRCSNNLTITSRKDYESLPSSSCLFSVYS
                     LFQSWQLLRLFFIFAYGLLFLVSGLIVNLIQINLYADAETLELLGKEHALVLSNHRGD
                     IDWLVGWVMAQRSGCLGSTLAIMRKEAKYFPIIGWSMWFSEYIFLEKNWAKDEKILKA
                     GFNQLKDFPTTFWLGLFVEGTRFNQKNLEAAKAYASLKGLPTPRNVLIPRTKVSLTVT
                     FSSLQGFVSAVTHMRSFVPAIYDCTYTVDKKQTTPTLLRMFSGQSSEVNLQMRRYKMS
                     QLPETADGIAQWCQDLFVAKV"
     gene            complement(2050187..2053026)
                     /locus_tag="BRARA_H00227"
                     /db_xref="Phytozome:Brara.H00227"
     mRNA            complement(join(2050187..2051056,2051130..2051432,
                     2051515..2051598,2051700..2051783,2051912..2052027,
                     2052103..2052181,2052262..2052315,2052445..2052519,
                     2052594..2053026))
                     /locus_tag="BRARA_H00227"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00227"
     CDS             complement(join(2050724..2051056,2051130..2051432,
                     2051515..2051598,2051700..2051783,2051912..2052027,
                     2052103..2052181,2052262..2052315,2052445..2052519,
                     2052594..2052938))
                     /locus_tag="BRARA_H00227"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49426.1"
                     /db_xref="Phytozome:Brara.H00227"
                     /translation="MFSTVMKPLLSPSPSLFRLPPLSSSLSVLFHVFPFSSSSSPFHS
                     PHPITPLRSSRRNYIPHHASLSDHYLSCSVPEKPLRVAVLLSGGVDSSVALRLLHAAG
                     HSCTAFYLKIWFQEGFENFWNQCPWEDDLKYAKHVCEQVGVPLEVVHLTDEYWERVVS
                     YIIEEYKCGRTPNPDVLCNTRIKFGAFMDAISDMEYDYVASGHYAKVAHPPAGPSVLQ
                     LSQDMVKDQTYFLSHLSQTQLKRLLFPLGCVKKEEVRKLATEFDLPNKDRKDSQGICF
                     LGKIKFSDFVGRHIGEKEGIILEAETGDFLGNHRGFWFYTIGQRQGLRLPGGPWYVVE
                     KDTKNNVVFVSRDYYSIDKRRRVFRVGSLRWLSGKPSGNVSQLRCKVRHGPGFYSCSF
                     EMEAEGDVAVVHLDEDDQGLAAGQFAAFYEGTACIGSGVILESWDDQCFPVCEKALQL
                     AAVEDKTKLGKPVKIMTMPVTTSVEAEPGETSREEKLLNA"
     gene            2055351..>2055941
                     /locus_tag="BRARA_H00228"
                     /db_xref="Phytozome:Brara.H00228"
     mRNA            2055351..>2055941
                     /locus_tag="BRARA_H00228"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00228"
     CDS             2055717..2055941
                     /locus_tag="BRARA_H00228"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49427.1"
                     /db_xref="Phytozome:Brara.H00228"
                     /translation="MPWRGGSLVAAIEQSMTTNSTRRSRHRAEHSGEELKKTIRGRDE
                     PYLFRGFLFFSLLFLLFFSFLIKYKSITKY"
     gene            2058482..2061388
                     /locus_tag="BRARA_H00229"
                     /db_xref="Phytozome:Brara.H00229"
     mRNA            join(2058482..2058642,2058732..2058853,2058938..2059159,
                     2059249..2059421,2059511..2059646,2059744..2059840,
                     2059926..2060026,2060260..2060423,2060505..2060576,
                     2060642..2060758,2060837..2061054,2061138..2061388)
                     /locus_tag="BRARA_H00229"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00229"
     CDS             join(2058560..2058642,2058732..2058853,2058938..2059159,
                     2059249..2059421,2059511..2059646,2059744..2059840,
                     2059926..2060026,2060260..2060423,2060505..2060576,
                     2060642..2060758,2060837..2061054,2061138..2061180)
                     /locus_tag="BRARA_H00229"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49428.1"
                     /db_xref="Phytozome:Brara.H00229"
                     /translation="MSEDVGFNKETPCDYPRNPLCIFLSDFRSVLKFDELGLEIARIA
                     LPAALALTADPIASLVDTAFIGQIGPVELAAVGVSIALFNQVSRIAIFPLVSITTSFV
                     AEEDAYSSQENTVQDHKECIETGINNTKEETQELIPEINKDESKISSSIFSVSKSPVK
                     KRNIPSASSALIIGAILGLLQAAFLISTARPLLSFMGVKHDSPMLGPAQRYLSLRSLG
                     APAVLLSLATQGVFRGFKDTTTPLYATVIGDATNIILDPIFIFVFRLGVTGAATAHVL
                     SQYLMCGILLWKLMGQVDIFNLSTKHLQFSRFMKNGFLLLMRVIAVTFCVTLSASLAA
                     REGSISMAAFQVCLQVWLATSLLADGFAVAGQAILASAFAKKDYKRAAATASRVLQLG
                     LVLGFLLAIILGAGLHFGARLFTKDDKVLHLISIGLPFVAGTQPINALAFVFDGVNFG
                     ASDFGYAAASLVMVAIVSILCLVLLSSTHGFIGLWFGLTIYMSLRAAVGFWRIGTATG
                     PWSFLRR"
     gene            <2065599..>2075360
                     /locus_tag="BRARA_H00230"
                     /db_xref="Phytozome:Brara.H00230"
     mRNA            join(<2065599..2065854,2065974..2066199,2075306..>2075360)
                     /locus_tag="BRARA_H00230"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00230"
     CDS             join(2065599..2065854,2065974..2066199,2075306..2075360)
                     /locus_tag="BRARA_H00230"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49429.1"
                     /db_xref="Phytozome:Brara.H00230"
                     /translation="MNDTLALQILQTAVSDHIFSRIAATSTSKEAWDALKEEYEGSPQ
                     VRLIKFQTLRREYENLKMYENEDIKVFTDKIVELANQLTYHELIGILKAHEARLAARE
                     KSTSEGAFDSRVRHKNYGVTQDNSKHQGGKKWCGYCKKNNHTETECLKKQKKDDRGSH
                     NASEAATTVMEDVWLVDS"
     gene            2089703..2090562
                     /locus_tag="BRARA_H00231"
                     /db_xref="Phytozome:Brara.H00231"
     mRNA            2089703..2090562
                     /locus_tag="BRARA_H00231"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00231"
     CDS             2089867..2090181
                     /locus_tag="BRARA_H00231"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49430.1"
                     /db_xref="Phytozome:Brara.H00231"
                     /translation="MASKGKKPIRRTTTRSRKGIKNPSPPCSISSDVTSTSTIPASGC
                     CTPISKKSRIPEMLTCPPAPKKQKVAQNFALSRRQISFFAPPDVELFLLFAHGQQIKK
                     IS"
     gene            2094198..2095024
                     /locus_tag="BRARA_H00232"
                     /db_xref="Phytozome:Brara.H00232"
     mRNA            2094198..2095024
                     /locus_tag="BRARA_H00232"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00232"
     CDS             2094328..2094933
                     /locus_tag="BRARA_H00232"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49431.1"
                     /db_xref="Phytozome:Brara.H00232"
                     /translation="MSQIIEHIVLFKVKDDADSDKIDAMVNGLNSLATIDQVLYLSAA
                     PIHRLSSTSAFTHVLHSRYRSKEDLSAYVAHPDHLRVVEATMPIWEDIMSVDWIANQV
                     PRVLKPPGGSVVKVTLLKLKENVTDETKKEIMEVVKEESREISVGENFSPARAKGFSI
                     GSVAYFKDLGEVEAHEELVKEKVGSYVEDTIVVEFLVPPPS"
     gene            2114092..2116657
                     /locus_tag="BRARA_H00233"
                     /db_xref="Phytozome:Brara.H00233"
     mRNA            join(2114092..2114522,2115104..2115533,2115602..2115721,
                     2115815..2115982,2116073..2116657)
                     /locus_tag="BRARA_H00233"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00233"
     CDS             join(2114218..2114522,2115104..2115533,2115602..2115721,
                     2115815..2115982,2116073..2116264)
                     /locus_tag="BRARA_H00233"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49432.1"
                     /db_xref="Phytozome:Brara.H00233"
                     /translation="MAAAKGNSDWRSVGGALDDENLVFETTKGIKPIASFDEMGMNDK
                     VLRGVYDYGFKKPSEIQQRAVMPILKGRDVIAQAQSGTGKTSMIAISVCQIVNTSSRK
                     IQVLVLSPSRELASQTEKTIQAIGVHTSIQAHACIGGKSIGEDIKKLERGVHAVSGTP
                     GRVYDMIKRGSLQTKSVKLLILDESDEMLSKGLKDQIYDVYRSLPHDIQVCLISATLP
                     QEILEMTNKFMTDPVRILVKRDELTLEGIKQYYVDVGEEEWKFDTLCDLYGRLVINQA
                     IIFCNTRQKVDWLTEKMRSSNFIVSSMHGDKRQKERDEIMNQFRSFKSRVLIASDVWA
                     RGIDVQTVSHVINYDVPNNPELYIHRIGRAGRFGREGVAINFVKNSDMKTLRDIERYY
                     GTKIREMPADLA"
     gene            2117855..2120242
                     /locus_tag="BRARA_H00234"
                     /db_xref="Phytozome:Brara.H00234"
     mRNA            join(2117855..2119381,2119474..2119603,2119685..2119949,
                     2120132..2120242)
                     /locus_tag="BRARA_H00234"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00234"
     CDS             2118026..2119351
                     /locus_tag="BRARA_H00234"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49433.1"
                     /db_xref="Phytozome:Brara.H00234"
                     /translation="MDSRDDVTNPTPSPSCNLCGRLIPQSSTTVPDDLEIFSLCGDCK
                     FLLLQDFGTTPPPPPLTRRQTSRRRRMRMRRRRSSSSRQGSSSESVADQPQQFTHLLS
                     IARQSETSSHTTPNGSARWRVLSESESEDLDNLSNASFSLYRFSSLGGESDAASTDIE
                     FDTDIDPMHAGLNQWNSDDEDREWEEEEGARHSRTPSESNSSVTRFDSLDLERTFRQR
                     IIERRQALSRNIFTGLEDLEFSRYPGNVADYLDERGFEELLEQLADSDNSRRGAPPAS
                     MSCVRSLPRVIIREEGLDCAVCKEVFSLGNETTQLPCLHLYHPHCIVPWLGARNSCPL
                     CRYELPTDDKDYEDRKQNVVDVVSEDSSSDDDGTEGGEEEDHDVVRGESEAGVRSVSR
                     GRWLFLAAAPVVSLVGVVLAMWLSNPQRRNIVFSHSQRGNRSRRWLPFF"
     gene            complement(2120264..2122638)
                     /locus_tag="BRARA_H00235"
                     /db_xref="Phytozome:Brara.H00235"
     mRNA            complement(join(2120264..2120810,2120876..2120928,
                     2121008..2121108,2121193..2121267,2121348..2121584,
                     2121696..2121817,2121907..2122031,2122121..2122200,
                     2122274..2122638))
                     /locus_tag="BRARA_H00235"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00235"
     CDS             complement(join(2120500..2120810,2120876..2120928,
                     2121008..2121108,2121193..2121267,2121348..2121584,
                     2121696..2121817,2121907..2122031,2122121..2122200,
                     2122274..2122465))
                     /locus_tag="BRARA_H00235"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49434.1"
                     /db_xref="Phytozome:Brara.H00235"
                     /translation="MIARILAGFMESPAVAAAGDSVLGTIKIAVMPIAKVFTMCFLGL
                     LMASKYVNILPPSGRKLLNGLVFSLLLPCLIFSQLGQAVTLQKMLQWWFIPVNVVLGT
                     ISGSLIGLLVATIVRPPYPYFKFTIIQIGVGNIGNVPLVLLAALCRDTSNPFGDSEKC
                     SIDGTAYISFGQWVGAIILYTYVYQMLAPPPEGFDGEHDNLPLKNLPLDSSAPEQVPL
                     LTQNHTKDVSSIQVHLPVQTAEPRARVVDSRKSKITLFFVYLYEKLKLKQIIQPAIIA
                     SILAMILGAIPFTKKLLFTNGAPLFFFTDSCMILGDAMIPCILLALGGNLINGPGSSR
                     LGFKTTAAIIFGRLVLVPPVGLGIVTLADRLGFLPAGDKMFKFVLLLQHTMPTSVLSG
                     AVANLRGCGRESAAVLFWVHIFAIFSMAGWMVLYINILF"
     gene            2135901..2137925
                     /locus_tag="BRARA_H00236"
                     /db_xref="Phytozome:Brara.H00236"
     mRNA            join(2135901..2136719,2136803..2137066,2137143..2137433,
                     2137574..2137925)
                     /locus_tag="BRARA_H00236"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00236"
     CDS             join(2136240..2136719,2136803..2137066,2137143..2137433,
                     2137574..2137897)
                     /locus_tag="BRARA_H00236"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49435.1"
                     /db_xref="Phytozome:Brara.H00236"
                     /translation="MERRNEQTMIKRSKWQYPQVGLPTPRILQLPRRQSVRRSAAKGK
                     TTTPSSSSSSSYSSSTQKDQRVKLEVLFHQERSFDRGGGPVVMDEGRRREKVAEGREI
                     GGASSNEVDEAKWRFQTEMLRSECNLLRIEKEIALKKMERRKKRMEKTLRSAVNTLLS
                     GKQRISEGKKESNVLEDEISYLIEKLNELKSPKVNKDMEEARNFRHNFDKKASVLKRE
                     LEKLDEGEVCVQGIQKMAEASFLVNSNNGNIDTLSSKMEALSILSKTIDLQDVSVQDK
                     YTKKDCSRHCKAVMRKIADQVRAEAEQWSQMQEMLGQVRNEMEELQSCRDFWQNRALE
                     SDSQIQNLHSSVEGWRKKALSSEAKLKNIQAEVCGLQEEIKRLRKEGNKLEPEKNKLP
                     TESEKRVLICRLKENRHSNNGDWSKYSEGRTAKPSCSRQPLREIKNGSVAVTRQRNTT
                     MS"
     gene            2139415..>2140944
                     /locus_tag="BRARA_H00237"
                     /db_xref="Phytozome:Brara.H00237"
     mRNA            join(2139415..2139653,2139840..2140201,2140305..2140467,
                     2140539..2140725,2140800..>2140944)
                     /locus_tag="BRARA_H00237"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00237"
     CDS             join(2139533..2139653,2139840..2140201,2140305..2140467,
                     2140539..2140725,2140800..2140944)
                     /locus_tag="BRARA_H00237"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49436.1"
                     /db_xref="Phytozome:Brara.H00237"
                     /translation="MSSEEEKTVCVTGASGYIASWIVKLLLLRGYTVKASVRDPNDPR
                     KTEHLLALEGAEERLQLFKANLLEEGSFDSAIDGCQGVFHTASPFYHDVKDPQAELLD
                     PAVKGTINVLSTCLKTPSVKRVVLTSSIAAVAFNGMPRTPDTIVDETWFADPDYCRAA
                     KLWYVLSKTLAENAAWKFAKENDMQLVSINAAMVIGPLLQPTLNTSAAAVLSLIKGAQ
                     TFPNATFGWVNVKDVANAHIQAFENPEANGRYCLVERVAHYSEVVNILHDLYPDFQLP
                     EKCADEKIFIPTYKVSKEKAESLGVEFVPLEVSIKETVESLQDKGFIRF"
     gene            complement(2142514..2145001)
                     /locus_tag="BRARA_H00238"
                     /db_xref="Phytozome:Brara.H00238"
     mRNA            complement(join(2142514..2142851,2142952..2142998,
                     2143094..2143280,2143376..2143666,2143738..2143932,
                     2144007..2144108,2144191..2144493,2144636..2145001))
                     /locus_tag="BRARA_H00238"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00238"
     mRNA            complement(join(2142593..2142851,2142952..2142998,
                     2143094..2143280,2143376..2143666,2143738..2143932,
                     2144007..2144108,2144191..2144493,2144636..2144746,
                     2144852..2145001))
                     /locus_tag="BRARA_H00238"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00238"
     CDS             complement(join(2142765..2142851,2142952..2142998,
                     2143094..2143280,2143376..2143666,2143738..2143932,
                     2144007..2144108,2144191..2144493,2144636..2144695))
                     /locus_tag="BRARA_H00238"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49437.1"
                     /db_xref="Phytozome:Brara.H00238"
                     /translation="MERLTSPPRLMIVSDLDDTMVDHHNDPENLSLLRFSSLWEEAFR
                     HDSLLVFSTGRTLPMYKKLRKERPMLTPDVIITSVGTEIAYGKSMVTDDSWVEIMNHK
                     WDRGIVEEETSKFPELTLQRDCDQRPNKVSFFIDKSKAQEVTKELYQRLEKRGLEIKI
                     IFSGGKALDVLPKGGGKGQALAYLLNKLKAEGRLPVNTLVCGDSGNDTELFTIPNVYG
                     VMVRNSQEELLEWYAENAKDNAKIIHASERCVGGILEAIGHFELGPNLSPRDVSDLFE
                     CKEDNVNPGHEVVMFFLFYERWRRGEVENCDAYIASLKASCHPAAVFVHPSGAEKSLI
                     DTIDELGKYHGDKKDKKFRVWTDQVLATETTHGTWMVKLDKWEQTGNERKCCTTTVRF
                     ISKENEGLVWENVQQTWSEESEMKNDSNWII"
     CDS             complement(join(2142765..2142851,2142952..2142998,
                     2143094..2143280,2143376..2143666,2143738..2143932,
                     2144007..2144108,2144191..2144493,2144636..2144695))
                     /locus_tag="BRARA_H00238"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49438.1"
                     /db_xref="Phytozome:Brara.H00238"
                     /translation="MERLTSPPRLMIVSDLDDTMVDHHNDPENLSLLRFSSLWEEAFR
                     HDSLLVFSTGRTLPMYKKLRKERPMLTPDVIITSVGTEIAYGKSMVTDDSWVEIMNHK
                     WDRGIVEEETSKFPELTLQRDCDQRPNKVSFFIDKSKAQEVTKELYQRLEKRGLEIKI
                     IFSGGKALDVLPKGGGKGQALAYLLNKLKAEGRLPVNTLVCGDSGNDTELFTIPNVYG
                     VMVRNSQEELLEWYAENAKDNAKIIHASERCVGGILEAIGHFELGPNLSPRDVSDLFE
                     CKEDNVNPGHEVVMFFLFYERWRRGEVENCDAYIASLKASCHPAAVFVHPSGAEKSLI
                     DTIDELGKYHGDKKDKKFRVWTDQVLATETTHGTWMVKLDKWEQTGNERKCCTTTVRF
                     ISKENEGLVWENVQQTWSEESEMKNDSNWII"
     gene            2150924..2151999
                     /locus_tag="BRARA_H00239"
                     /db_xref="Phytozome:Brara.H00239"
     mRNA            join(2150924..2151294,2151381..2151518,2151598..2151999)
                     /locus_tag="BRARA_H00239"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00239"
     CDS             join(2151178..2151294,2151381..2151518,2151598..2151843)
                     /locus_tag="BRARA_H00239"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49439.1"
                     /db_xref="Phytozome:Brara.H00239"
                     /translation="MPKLVKASVSVVCESQPEMFLGCLASTQSLSLCSLTSSQTPYPS
                     DATSFLSLEHLEICSCSSDWWNLLTFILNDAPRLRVLKLNLRDGMVSWNQPSSVPECL
                     SSHLEILEWRQYKGTETEIEAAKYILANGSRLKKATFYSESAEKRGMLKELECVARDS
                     CTFVFE"
     gene            2152958..2155018
                     /locus_tag="BRARA_H00240"
                     /db_xref="Phytozome:Brara.H00240"
     mRNA            join(2152958..2153139,2153333..2153515,2153584..2153795,
                     2153903..2154057,2154150..2154308,2154384..2154436,
                     2154521..2154661,2154742..2155018)
                     /locus_tag="BRARA_H00240"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00240"
     CDS             join(2153056..2153139,2153333..2153515,2153584..2153795,
                     2153903..2154057,2154150..2154308,2154384..2154436,
                     2154521..2154661,2154742..2154819)
                     /locus_tag="BRARA_H00240"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49440.1"
                     /db_xref="Phytozome:Brara.H00240"
                     /translation="MMRAILTKKKLVLSNAHRFISITNLSRCISTLILAEHESGSIKP
                     QTVSTVVAANHLGESSSVSLLLAGSGSSLQEAASQAASCHPSVSEVLVADSDRFEYPL
                     AEPWAKLVDFVRQQRDYSHILASSSSFGKNILPRVAALLDVSPVTDVVKILGSNEFIR
                     PIYAGNALCRVRYTGAGPCVLTIRTTSFPVTPITESKKATISQIDLSKFKEDAVSRSR
                     YVGQSTQDTERPDLGSARVVITGGRALKSVENFKMIEKLAEKLGGAVGATRAAVDAGY
                     VPNDLQVGQTGKIVAPELYMAFGVSGAIQHLAGIKDSKVIVAVNKDADAPIFQVADYG
                     LVGDLFEVIPELLEKLPEKK"
     gene            complement(2155113..2158402)
                     /locus_tag="BRARA_H00241"
                     /db_xref="Phytozome:Brara.H00241"
     mRNA            complement(join(2155113..2156823,2156938..2157579,
                     2157680..2158402))
                     /locus_tag="BRARA_H00241"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00241"
     CDS             complement(join(2156189..2156823,2156938..2157579,
                     2157680..2158388))
                     /locus_tag="BRARA_H00241"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49441.1"
                     /db_xref="Phytozome:Brara.H00241"
                     /translation="MRTWENPVTLACNTAFKKTLPSCTLLIIFIAVLCPVVMSQMVVP
                     DSDADCLLRFKDTLANGSGFNSWDPFTSPCRGNDANWFGVLCTNFVYGLQLEGMSLSG
                     KLDLEPLVPMKNLRTISFMNNDFIGPMPQVNRLTSMRSLYLSNNRFSGEIPADAFQDM
                     PHLKKIFLANNAFRGTIPASITSLPRLIEVRLNGNQFQGHIPYFKQEDLKLASFENND
                     LDGPIPESLQNMDPGSFAGNKDLCGPPLNPCSIDPRSHPSPPQGKKSESFNTIAIVLI
                     SIGIILVIIALVICFIQSRRRNCLSDYPSAGKERVESYTYHEPEIDKINKPAESVVNH
                     ARRGSMPDPAGRLLFVRDDVKRFGLQDLLRASAEVLGCGTFGASYKAAISSGQTLVVK
                     RYKHMNNVGRDEFHEHMRRLGRLNHPNLLPLVAYYYRREEKLLVTQLMANSSLASHLH
                     ANHSPDQPGLDWLTRLKIIKGLANGLSYLFKELPTLTIPHGHIKSSNVVLDESLEPLL
                     TDYALRPVMSSDHAHNFMTAYKSPEYRPEKGQAITKKTDVWCLGVLILELLTGRFPEN
                     YLTQGYDPDMSLVTWVNDMVKEKKTGDVFDKEMKGKKNCKAEMISLLKIGLRCCEEEE
                     ERRMEMREAVEMIEMLREGEPHDEFGSMDHRKSGYEV"
     gene            complement(2175963..2179397)
                     /locus_tag="BRARA_H00242"
                     /db_xref="Phytozome:Brara.H00242"
     mRNA            complement(join(2175963..2176476,2176552..2176630,
                     2176724..2176851,2176931..2177029,2177117..2177272,
                     2177373..2177447,2177656..2177835,2177950..2178100,
                     2178854..2179397))
                     /locus_tag="BRARA_H00242"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00242"
     CDS             complement(join(2176117..2176476,2176552..2176630,
                     2176724..2176851,2176931..2177029,2177117..2177272,
                     2177373..2177447,2177656..2177835,2177950..2178100,
                     2178854..2179125))
                     /locus_tag="BRARA_H00242"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49442.1"
                     /db_xref="Phytozome:Brara.H00242"
                     /translation="MGKVAVAFASAAVVAACSVAAVMVRRRVKSRRKWRTVVEILKEF
                     EEGCDAPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVHDLPNGTEKGTYYALHL
                     GGTYFRILRVHLGGERSYLDVQDVERHPIPSHLMNSTSEVLFNFLAFSLERFIQKEGN
                     ESNSQGVKRELAFTFSFPVKHTCISSGVLIKWTKGFEISEMVGKDIAGCLQGALNRRG
                     LDIHVAALVNDTVGALSLGYYHDPDTVVAVVFGTGSNACYLERTDAIIKCQGLLTTSG
                     SMVVNMEWGNFWSSHLPRTAYDIDLDAESSNPNDMGFEKMIAGLYLGDIVRRVILRMS
                     QESDIFGPSSSVFSQPYVLRTNSVSAMHEDDTPELQEVARILKDLGVSDVPLKVRKLM
                     VKICDVVTRRAGRLAAAGIAGILKKIGRDGGGGITSGRSRGEMQMQRRTVVGVEGGLY
                     MKYTMFREYMEEALVEILGEEVSQYVVVKAMEDGSSIGSALLVASSLQS"
     assembly_gap    2182259..2192258
                     /estimated_length=unknown
                     /gap_type="between scaffolds"
     gene            2198554..2202344
                     /locus_tag="BRARA_H00243"
                     /db_xref="Phytozome:Brara.H00243"
     mRNA            join(2198554..2198771,2199348..2199570,2199657..2199712,
                     2199808..2199910,2200000..2200065,2200448..2200561,
                     2200674..2200800,2200915..2201015,2201349..2201474,
                     2201576..2201640,2201729..2201810,2201901..2201983,
                     2202070..2202344)
                     /locus_tag="BRARA_H00243"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00243"
     CDS             join(2198686..2198771,2199348..2199570,2199657..2199712,
                     2199808..2199910,2200000..2200065,2200448..2200561,
                     2200674..2200800,2200915..2201015,2201349..2201474,
                     2201576..2201640,2201729..2201810,2201901..2201983,
                     2202070..2202136)
                     /locus_tag="BRARA_H00243"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49443.1"
                     /db_xref="Phytozome:Brara.H00243"
                     /translation="MAATVHSPIVTYASMLSLLAFCPPFVILLWYTMVHQEGSVVQTG
                     SFLWENGVQGLINIWPRPTAIAWKIIFCYGAFEAALQLLLPGKRVEGPISPTGNRPVY
                     KANGMAAYFVTLATYLGLWWFGIFNPAIVYDHLGEIFSALIFGSLVFCVLLYIKGHVA
                     PSSSDSGSCGNLIIDFYWGMELYPRIGKNFDIKVFTNCRFGMMSWAVLAVTYCIKQYE
                     INGKVSDSMLVNTILMLVYVTKFFWWEAGYWNTMDIAHDRAGFYICWGCLVWVPSIYT
                     SPGMYLVNHPVQLGTQLAIYILVAGCLCIYINYDCDRQRQEFRRTNGKCSVWGKAPSK
                     IVATYTTTAGETKTSLLLTSGWWGLARHFHYVPEISSAFFWTVPALFNNFLPYFYVIF
                     LTILLFDRAKRDDDRCRSKYGKYWKLYCEKVKYRIIPGIY"
     gene            2205537..2207615
                     /locus_tag="BRARA_H00244"
                     /db_xref="Phytozome:Brara.H00244"
     mRNA            join(2205537..2205669,2205941..2207615)
                     /locus_tag="BRARA_H00244"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00244"
     CDS             2206004..2207341
                     /locus_tag="BRARA_H00244"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49444.1"
                     /db_xref="Phytozome:Brara.H00244"
                     /translation="MVAMFQEDNGTSSVASSPLQVFSTMSLTRPTLLPSPSSSPFHSL
                     KDLKPEERGLYLIHLLLTCANHVASGSLQNANAALEQLSLLSSPDGDTMQRVAAYFTE
                     ALANRILKSWPGLYKALNATQTRTSNVSEEVHVRRLFFDMFPILKVSYLLTNRAILEA
                     MEGEKMVHVIDLDASEPAQWLALIQAFNSRPEGPPHLRITGVHHQKEVLDQMAHRLIE
                     EAEKLDIPFQFNPVVSSLQCLNVEQLRVKTGEALAVSSVLQLHNLLASDVTSNNGHSL
                     SGDSASSLPLSNSGKIDSFLNAIWGLSPKIMVVTEQDSDHNGSTVMERLLESLYTYAA
                     LFDCLETKVPRTSQDRMKVEKMLFGEEIKNIIACEGSERRERHEKLEKWSQRIDLAGF
                     GNVPLSYYAMLQARRLLQGYGFDGYRIKEESGCAVICWQDRPLYSVSAWRCRK"
     gene            complement(<2208032..>2210287)
                     /locus_tag="BRARA_H00245"
                     /db_xref="Phytozome:Brara.H00245"
     mRNA            complement(join(<2208032..2208556,2208627..2208689,
                     2208748..2209026,2209109..2209218,2209448..2209546,
                     2209621..2209670,2209779..2209831,2209907..>2210287))
                     /locus_tag="BRARA_H00245"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00245"
     CDS             complement(join(2208032..2208556,2208627..2208689,
                     2208748..2209026,2209109..2209218,2209448..2209546,
                     2209621..2209670,2209779..2209831,2209907..>2210287))
                     /locus_tag="BRARA_H00245"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49445.1"
                     /db_xref="Phytozome:Brara.H00245"
                     /translation="LRERIHVTENEREVFDLLLRAVGSFSPETKLRVAGGWVRDKLLG
                     KESNDIDLAIEKMLARKFFYKLNYYLRSQGEDKVQGHVIKSKPTNDNRRPVETVKMHI
                     YNHSIDLVHLRSETHEGNSRNPVKVGFATPEKDAYRRDLTINSLFYNLHTGLVEDYTG
                     RGIVDLKSRRIATPLPARVSLLDDPLRVLRAIRFGARFGFTLDEELKEAASSEELQVA
                     LAVKISKERIGNEIDLMISGNDPVQAVTYLSDLKLFELVFALPSSSEPAPSENCSSLC
                     LAYLEAMWNLIRTPGLGNFSGEQRRHALYAALFLPFRKMVYKDTKGKLVPVVNYIFKV
                     SMKRKSKDAETVVNIHRATGRFLSLILHLQLKKNDVSQVDKREWGTDVFEHLELISRN
                     DPELPATSKTRVLAGFLLRDIKDLWRLALLVSLLLCTDDDMNLGFQVDKKREVYLTIQ
                     GTIIREMGLDTIWDLKPLVGGSDIVKALQLRDNRGPIIREWQHILLTWQLAYPKGMPL
                     RQEWVKRRKVA"
     gene            complement(<2224279..>2227890)
                     /locus_tag="BRARA_H00246"
                     /db_xref="Phytozome:Brara.H00246"
     mRNA            complement(join(<2224279..2224369,2225406..2225524,
                     2225644..2225935,2226162..2226508,2226634..2226828,
                     2226910..2227193,2227719..>2227890))
                     /locus_tag="BRARA_H00246"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00246"
     CDS             complement(join(2224279..2224369,2225406..2225524,
                     2225644..2225935,2226162..2226508,2226634..2226828,
                     2226910..2227193,2227719..2227890))
                     /locus_tag="BRARA_H00246"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49446.1"
                     /db_xref="Phytozome:Brara.H00246"
                     /translation="MAGTRSPPVAKKVEHAMHMFSDVRVDNYYWLRDDSRCDPDMLSY
                     LRAENEYADSVMSGTKPFENQLFAEIRGRIKEDDITAPLRKGPYYYYKRNLLGKEYVQ
                     HCRRLIADNKAEPSVHDTMPTGPDAPPEHIILDENIKAQEHGYYRIGTFKVSPDHKLV
                     AYAEDIKGDEIYAVHVIDSESLKPVGQPLKGVTCYLQWAGNDALVYVTMDEILRPDKA
                     WLHKLGTEQSSDVCLYHEKDDMFSLDLHASESHKYIFVASESKTTRFVFSLDVSKPQD
                     GLRVLTPRVDGIDSSVSHRGNHFFIQRRSSEFYNSEVVACLVDDPSKTTVLIPHRESV
                     KIQEIQLFRDHLAVFEREQGLQKITVHRLPSEGQPLNSLQAGRSVSFVDPVYKVDTTE
                     SEFSSSVLRFCYSSLKTPPSVYDYDMDSGTSVIKKIDTVLGGFDASNYVTERKWVSAA
                     DGTQIPMSIVYNKNLAKLDGFEKLQEDAFKFAFMMKVLDMIPEYSQERL"
     gene            2232331..2236434
                     /locus_tag="BRARA_H00247"
                     /db_xref="Phytozome:Brara.H00247"
     mRNA            join(2232331..2232462,2232550..2232675,2232769..2232863,
                     2232951..2233023,2233338..2233506,2235670..2235755,
                     2235852..2236434)
                     /locus_tag="BRARA_H00247"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00247"
     CDS             join(2232361..2232462,2232550..2232675,2232769..2232863,
                     2232951..2233023,2233338..2233506,2235670..2235755,
                     2235852..2236181)
                     /locus_tag="BRARA_H00247"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49447.1"
                     /db_xref="Phytozome:Brara.H00247"
                     /translation="MGQQQLKDEMLFQKVNHNDVESIKSHCHEGAGLEWADKEGRTPL
                     ILACAETELYDVAETLKVARAKGYSDTVRAIESRICLFSGWMRELYGPSFLELCSPDQ
                     LLSRKVWVVIVPTDSRNPLKLELVVYASLQDAQPRMVMPLWKANLKEPKSDQSDASVM
                     IVCNSSRLKKQRKRGYISHARSWAQVDRQMRLKLAAATKGDIKQLNSFCEACKGTPQP
                     MNPPIFLKTTENIISNELTPSVPLPRAVTVETEDGSVHYPSFSSADYESKGSGEGSGV
                     CVICEDASSEAACVPCGHVAGCVSCLKEIKNKKCPICRASIDQVIKLYHV"
     gene            complement(2237299..2240376)
                     /locus_tag="BRARA_H00248"
                     /db_xref="Phytozome:Brara.H00248"
     mRNA            complement(join(2237299..2237712,2238068..2238139,
                     2238234..2238329,2238409..2238552,2238645..2238695,
                     2238809..2238919,2239516..2239573,2239702..2239769,
                     2239869..2240015,2240109..2240376))
                     /locus_tag="BRARA_H00248"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00248"
     CDS             complement(join(2237629..2237712,2238068..2238139,
                     2238234..2238329,2238409..2238552,2238645..2238695,
                     2238809..2238919,2239516..2239573,2239702..2239769,
                     2239869..2240015,2240109..2240189))
                     /locus_tag="BRARA_H00248"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49448.1"
                     /db_xref="Phytozome:Brara.H00248"
                     /translation="MDLDQWISKVKDGQHLSEDELHLLCEYVKEILIEESNVQPVNSP
                     VTVCGDIHGQFHDLMKLFQTGGHVPDTNYIFMGDFVDRGYNSLEVFTILLLLKSRYPA
                     HITLLRGNHESRQLTQVYGFYDECQRKYGNANAWRYCTDVFDYLTLSAIIDGTVLCVH
                     GGLSPDVRTIDQIRLIDRNCEIPHEGPFCDLMWSDPEDIETWAVSPRGAGWLFGSRVT
                     TEFNHINNLELVCRAHQLVQEGLKYMFQDKGLVTVWSAPNYCYRCGNVASMLSFNDNM
                     ERDVKFFTETEENNQMRGPRTGVPYFL"
     gene            2261281..2264487
                     /locus_tag="BRARA_H00249"
                     /db_xref="Phytozome:Brara.H00249"
     mRNA            join(2261281..2261412,2262116..2262414,2262495..2262802,
                     2262896..2263294,2263386..2263521,2263620..2263792,
                     2263891..2264487)
                     /locus_tag="BRARA_H00249"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00249"
     mRNA            join(2261719..2261810,2262116..2262414,2262495..2262802,
                     2262896..2263294,2263386..2263521,2263620..2263792,
                     2263891..2264487)
                     /locus_tag="BRARA_H00249"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00249"
     CDS             join(2262123..2262414,2262495..2262802,2262896..2263294,
                     2263386..2263521,2263620..2263792,2263891..2264286)
                     /locus_tag="BRARA_H00249"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49449.1"
                     /db_xref="Phytozome:Brara.H00249"
                     /translation="MIRELEMQEMDWTALANPSEEMQRSWLLQSTTLKMKTYVQKKKT
                     YAWTLAFIGVLVVIAFTMMTIRALTHLDHYQQQPPETYSIALHTGLKFFNSQRSGRLP
                     EENNVTWRGDSCIQDGKYPGSSYPHLSGGYYDGGNAIKSNFKMSFAMTMLSWSVIEYH
                     SKYQQLGELIHVEGIIKWGTDYFLNTFDSSADTIHDMVFQVGHEGTERYCWIRPEDID
                     YQRHADICFSECPDLAAEMAAALASASIVFSKNVAYSQKLIHGAKILYKYAESSMNTH
                     TSSSWDELLWGGVWLYYATGDVSFLDRVTTLALADPSGVFSRDSGVFSWNTKLAGAQL
                     LLTRLRLFLSPGYPSEEVLRKFYNQIGNVMCSYLPSFNKFNRTKGGLIQLNHGDPQPL
                     QYAANAAFLAALYSDYLDASDTPGWSCGPNFYLTYVLRDFSRSQIDYILGKNPQNMSY
                     VVGFGERYPKRVHHRGASIPKNRKESCKGGWKWRESSKENPNVIEGAMVAGPDGYDGF
                     HVVRTNSNYTEPTLTGNAGLIAALVVLSGQKDNLDKNGIFSAIPPLFPVAPPPPAPWT
                     P"
     CDS             join(2262123..2262414,2262495..2262802,2262896..2263294,
                     2263386..2263521,2263620..2263792,2263891..2264286)
                     /locus_tag="BRARA_H00249"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49450.1"
                     /db_xref="Phytozome:Brara.H00249"
                     /translation="MIRELEMQEMDWTALANPSEEMQRSWLLQSTTLKMKTYVQKKKT
                     YAWTLAFIGVLVVIAFTMMTIRALTHLDHYQQQPPETYSIALHTGLKFFNSQRSGRLP
                     EENNVTWRGDSCIQDGKYPGSSYPHLSGGYYDGGNAIKSNFKMSFAMTMLSWSVIEYH
                     SKYQQLGELIHVEGIIKWGTDYFLNTFDSSADTIHDMVFQVGHEGTERYCWIRPEDID
                     YQRHADICFSECPDLAAEMAAALASASIVFSKNVAYSQKLIHGAKILYKYAESSMNTH
                     TSSSWDELLWGGVWLYYATGDVSFLDRVTTLALADPSGVFSRDSGVFSWNTKLAGAQL
                     LLTRLRLFLSPGYPSEEVLRKFYNQIGNVMCSYLPSFNKFNRTKGGLIQLNHGDPQPL
                     QYAANAAFLAALYSDYLDASDTPGWSCGPNFYLTYVLRDFSRSQIDYILGKNPQNMSY
                     VVGFGERYPKRVHHRGASIPKNRKESCKGGWKWRESSKENPNVIEGAMVAGPDGYDGF
                     HVVRTNSNYTEPTLTGNAGLIAALVVLSGQKDNLDKNGIFSAIPPLFPVAPPPPAPWT
                     P"
     gene            2295133..2298662
                     /locus_tag="BRARA_H00250"
                     /db_xref="Phytozome:Brara.H00250"
     mRNA            join(2295133..2295270,2295919..2296070,2296184..2296524,
                     2296633..2296824,2297349..2297432,2297839..2297920,
                     2298044..2298167,2298251..2298662)
                     /locus_tag="BRARA_H00250"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00250"
     CDS             join(2295948..2296070,2296184..2296524,2296633..2296824,
                     2297349..2297432,2297839..2297920,2298044..2298167,
                     2298251..2298447)
                     /locus_tag="BRARA_H00250"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49451.1"
                     /db_xref="Phytozome:Brara.H00250"
                     /translation="MAGYSTKGAAPTNGSLYVSNLPPGTDENMLAEYFGTIGLLKRDK
                     RTGTPKVWLYRDKETDEPKGDATVTYEDPHAALAAVEWFNNKDFHGSIIGVFMAESKN
                     NKSGGDHPSESFGFDGGAANKEIDGGAGRGRGQGDSSAKPWQQDGDWMCPNTSCTNVN
                     FAFRGVCNRCGTARPAGASGGSMGGGGRGRGRGGGADGGPPGKGASTGLFGPNDWSCP
                     MCGNVNWAKRLKCNVCNTNKPGQNEGGVRGGRGGGYKELDEQELEETKRRRREAEQDD
                     GEMYDEFGNLKKKYRVKTHQADARPAVAAGRAGWDVEELGVDRDGRERSRDRQRDRGD
                     KHRDHHHYDKHRRRSRSRSRERERGKERDYDRDRDRDYGRGSRYRN"
     gene            2300730..2304198
                     /locus_tag="BRARA_H00251"
                     /db_xref="Phytozome:Brara.H00251"
     mRNA            join(2300730..2300881,2300966..2302138,2303733..2304198)
                     /locus_tag="BRARA_H00251"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00251"
     CDS             join(2300819..2300881,2300966..2302138,2303733..2304077)
                     /locus_tag="BRARA_H00251"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49452.1"
                     /db_xref="Phytozome:Brara.H00251"
                     /translation="MSLFYDLQININGEYTFFLNQDVISKYSGSLRKMIKQSKKKRNK
                     KNKDPEVITIEIDEFPGGPDGFELVSRFCYNNGGISIDVSNVSTLYCCSVFLGMTEKL
                     CFSNLLTQTETFLEEVFYGSWNDIVLSLKNCEQEQVFLHADSYGLVDKLIFSALTKIS
                     RSSEAFSSSSPSSSSPSSAKNTPESDKRLTSWTVSCGRSNEWWFDDMSSLSPMIILKL
                     IRITGAYKTNVKSLVLTKFLLHYLKTRLQTKSNKTELMRNKLEYSELADTAVRGVVSA
                     GKTAFSCRKLFWVLRVLSSFTLSRESKTGLETLIGEMLDQATLDDLLIPAAGGSIESS
                     GFYNVDLVIRLLKVFVRNIEEEESKMKEVGRLIDKYLREISPDQNLKVSKFLGVAESL
                     PDSARDCFDGVYRAIDIYLQSHSNLTPQDRTKICRCLNYKKLTRETCKLLARNPKIPP
                     DVAVQALKSSCENQEHRTQEVKLVNKSTCRSRRHSQDKKHVMLHLKGFEISEKLAEEL
                     KTKGGYNWKVMDSFREGL"
     gene            complement(2308674..2316119)
                     /locus_tag="BRARA_H00252"
                     /db_xref="Phytozome:Brara.H00252"
     mRNA            complement(join(2308674..2309064,2309259..2309447,
                     2309532..2309612,2309697..2309840,2309964..2310197,
                     2310470..2311618,2311731..2312228,2312305..2312406,
                     2312510..2312681,2312770..2312908,2313160..2313312,
                     2313396..2313465,2313590..2313670,2313772..2313840,
                     2313915..2313987,2314171..2314255,2314350..2314413,
                     2314858..2314950,2315047..2315121,2315208..2315300,
                     2315363..2315437,2315511..2315624,2315845..2316119))
                     /locus_tag="BRARA_H00252"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00252"
     CDS             complement(join(2308813..2309064,2309259..2309447,
                     2309532..2309612,2309697..2309840,2309964..2310197,
                     2310470..2311618,2311731..2312228,2312305..2312406,
                     2312510..2312681,2312770..2312908,2313160..2313312,
                     2313396..2313465,2313590..2313670,2313772..2313840,
                     2313915..2313987,2314171..2314255,2314350..2314413,
                     2314858..2314950,2315047..2315121,2315208..2315300,
                     2315363..2315437,2315511..2315600))
                     /locus_tag="BRARA_H00252"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49453.1"
                     /db_xref="Phytozome:Brara.H00252"
                     /translation="MGVEDYHVIELVGEGSFGRVYKGRRKYTGQTVAMKFIMKQGKSD
                     KDIHSLRQEIEILRKLKHENIIEMLDSFENAREFCVVTEFAQGELFEVLEDDKCLPEE
                     QVQAIAKQLVKALHYLHSNRIIHRDMKPQNILIGPGSVVKLCDFGFARAMSANTVVLR
                     SIKGTPLYMAPELVREQPYNHTADLWSLGVILYELYVGQPPFYTNSVYALIRHIVKDP
                     VKYPDEMSHNFKSFLKGLLNKVPQSRLTWPALLQHPFVKESLEEVEAREMHTAVVDHK
                     ATWRQGNGGQQRNEKCDSATPVKDASAPGTLADVQEDMKRAVEVISPSPEDFLGFPTQ
                     EDIKSAGDATLDKLENTSRTAKGAKVICEDDKAMDVVLLSLERCSKSTQQSKGDKDVA
                     CSVQSLRIISNLVAARAIVSVGLIDKITCALLDFTDALVGKKSSEFNNIIPKSLSVTK
                     NLVGHIDGSSIHSSYIRHWTKLVEIFVQVVGWEEEGTGRILYEACSCITTMLSRVAEN
                     LKTSTPDSTSQQILEHANMSRIVDHLCLCLASSGSSLASGSSHMLAAACEACRAIWIL
                     IDTSETLFKNDNAYIFPLDALQSHRLSQLDQRNCEWGPLSEKLVDTVTRTFLRSKHLQ
                     IAVSHCLHQRVEAPLISAIQLLSRCCLHNGLMPSVLCGLPSSLPITTAVSGGEDGTVI
                     SEIFSILSYAASTIKDQQTGETNNIKGRLNNLVFHSCLLLATVAQCLNLSGRSSALLM
                     LTTSPKKHLHRLSAIANHIASEDKIEASLQNHSASAMLALASILSLEKGSSAESSVSE
                     MAVPLIPRATKLCYHLRPMPSNEGEVISPSAKSNLTKWHGLLDGCIGLLESRLKWGGP
                     LTVQQLIASGTPSLLMNLLAGRLSNASPDDIKNTPNRTGLSPMGVIWAVSSLCHCLSG
                     GTLTFRQVLVKTENMKLVSYLMSDAHLKLVKSWGGPGGGKDGARETINVIIDLLAFPF
                     VALQSQPGPLSATASVNSGFILNVGSPGVRVCIEDRDLLKAIEEDMDKYIKVLVEVGV
                     PSLILRCLEHLDLKDLVRPVAFLAKMVGRPRLAVELVSKGLLDPNRMKKLLNQSSPRE
                     VILDVLMIISDLSRMDKAFYKYIGEASVLQPLKEFLTHPDPNIRAKACSALGNMCRHN
                     EYFYSSLAEHQIIGLLIDRCADPDKRTQKFACFAIGNAAYHSDKLYEELRRSIAQLAN
                     VLTSAEEDKTKANAAGALSNLVRNSNKLCEDIVSKGALQTLLKLVADCSATALNPSKK
                     ETGSESPLKIALFSLAKMCSNHQICRQFVKSSELFPVIARLKHSPETNIAHYASVIVA
                     KVGGDS"
     gene            2324100..2331295
                     /locus_tag="BRARA_H00253"
                     /db_xref="Phytozome:Brara.H00253"
     mRNA            join(2324100..2324385,2324860..2325098,2325378..2325518,
                     2326005..2326151,2326293..2326445,2326865..2326994,
                     2327204..2327300,2327470..2327590,2327818..2327877,
                     2327963..2328013,2328087..2328182,2328306..2328407,
                     2328539..2328661,2328947..2329090,2329179..2329250,
                     2329336..2329411,2329492..2329634,2329719..2329827,
                     2329916..2330103,2330201..2330290,2330388..2330570,
                     2330660..2330839,2330947..2331295)
                     /locus_tag="BRARA_H00253"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00253"
     CDS             join(2324106..2324385,2324860..2325098,2325378..2325518,
                     2326005..2326151,2326293..2326445,2326865..2326994,
                     2327204..2327300,2327470..2327590,2327818..2327877,
                     2327963..2328013,2328087..2328182,2328306..2328407,
                     2328539..2328661,2328947..2329090,2329179..2329250,
                     2329336..2329411,2329492..2329634,2329719..2329827,
                     2329916..2330103,2330201..2330290,2330388..2330570,
                     2330660..2330839,2330947..2331018)
                     /locus_tag="BRARA_H00253"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49454.1"
                     /db_xref="Phytozome:Brara.H00253"
                     /translation="MRLGNVVYLLISSSTKPPSRVYSSNLRRHFLSHFRFSSSSVAVM
                     PGSEPSEIQWPARRVRDTYFDFFKGKGHKFWPSSPVVPHNDPTLLFANAGMNQYKPIF
                     LGTADPNTELSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK
                     KEAIEWAWELLTKVYGLPTDRIYATYFGGDEKAGLQPDNEARDIWLKFLPPGRVLPFG
                     CTDNFWEMGDTGPCGPCTEIHYDRVGNRDAASLVNNDDPTCLEIWNLVFIQFNRESDG
                     SLKPLPAKHVDTGMGFERLTSVLQNKMSNYDTDVFMPIFDDIQKATGARPYSGKVGLE
                     DVDRVDMAYRVVADHIRTLSFAIADGSRPGNEGREYVLRRILRRAVRYGKEILKAEEG
                     FFNGLVSSVIRVMGDTFTELKEHEKKITEIIKEEEASFCKTLAKGIEKFRKAGQAVQG
                     NTLSGEDAFVLWDTFGFPLDLTQLMAEERGLLVDVDGFNKAMEEARERSRSAQNKQAG
                     GAIVMDADATSTLHKTGVLATDDSSKYIWFQDHESEVKAIYTGSAFLESSAAGDNVGI
                     VLASTSFYAEQGGQIFDTGLIEGSFGTFNVCNVQIFGGFVLHIGYLSKETGEVSVGDK
                     VTCKVDYERRKLIAPNHTCTHMLNFALKEVLGDHIDQKGSIVLPEKLRFDFSHGKPVD
                     PEDLRKIESIVNKQIKDELDVFSKEAVLSEAKRIKGLRAVFGEVYPDPVRVVSIGRQV
                     EDLLADPENDEWSSLSSEFCGGTHITNTREAKAFALLSEEGIAKGIRRVTAVTTECAF
                     DALNEASSLEKEVEDASKAEGNALEKKAAALKSRVDSAIIPAAKKADIRAKIALLQNE
                     VRKAQKKIAEQNLKKSVKVATEAAESAASDGKTFCIIQLDVGLDAAAVREAVSKVMEK
                     KGMSIMVFSTDETTNKAVVCAGVPDKSDKFKQLDVTEWLTTALGPLKGRCGKGKSGLA
                     SGQGTDASQVKAALDLAASFASMKLN"
     gene            complement(2332584..2336978)
                     /locus_tag="BRARA_H00254"
                     /db_xref="Phytozome:Brara.H00254"
     mRNA            complement(join(2332584..2334469,2335766..2335912,
                     2335989..2336978))
                     /locus_tag="BRARA_H00254"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00254"
     CDS             complement(join(2332722..2334469,2335766..2335912,
                     2335989..2336871))
                     /locus_tag="BRARA_H00254"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49455.1"
                     /db_xref="Phytozome:Brara.H00254"
                     /translation="MAEAIVSVTVQKLGEFLLEEPLFLFGIGDQVKQLQDELKRLRCF
                     LKDADEKQRKSERVRNWIAEIREAAYDAEDLLEAFFLKAESKKGKGIKKVFRRLSCIM
                     SEAVSLHSVGSEIREITTRLTKIAASMKDYGIKEAMDGESLSLFDSLREQRQSFPYAV
                     EHNLVGLEQSLEKLVNDLVSGGEKLRVMSIYGMGGLGKTTLARQVFHHSIVRRHFDRF
                     AWVYVSQEFRRRHVWQEILLSLSYKDENQRILSLRDEQLGEELHRFLKRTKCLVVLDD
                     IWGTDAWDGLKHVFPHETGSNIVLTTRNKEVALYADPRGVLHEPRLLTHEESWELLEK
                     ISLQGRDNLEPMLVKKLEEIGKQMAIKCGGLPLAITVLGGLLAMKNTLNQWQRVQENI
                     TPYVSNGGSSNGSKSMMVADVLSLSYEDLPAHLKQCFLYFAHYPEDFEVHVGTLVSYW
                     IAEGMVMPVKHTEESGMTVEDIGQDYLEELVKRSIVMVGKRDIVTSEVMTCRMHDLMR
                     EVCLQKAEQESFVQVVDSRQQEEDEALRSLLTNTSRRISVQIHGGAEEHRIERLYMSS
                     QCRSLVYLMKNQGSQWTLLGKVSFRKMKLLRVLDLEGAQIKGGKLPDDVGDLIHLRNF
                     SLRLTNVKEVTSSIGNLTLMITLDLFVKGKLYIPDVIWKLKRLRHLCMPSELDPRTKL
                     DLSTLRNLQQLWDFPVGQCNPRDLLAMMSLRRLSINLSSQNTDFEVVSSLSRVLKRLR
                     GLTINVPCEPMPPPVDITQLVSAFANLSELELFLKLEKLPGEQSFSSDLGALRLWQCG
                     LVDDPFLVLEKLPNLKILQLFEGSFVGSELHCSVNGFPQLHSLTLSQLENLEEWTVED
                     GAMIRLVSLELKCCKKLKSVPEGTRFLKNLQEVEIGNMTKAFKDKLASGGEDFYKIQH
                     VPCVVFEYCDL"
     gene            complement(2337420..2339211)
                     /locus_tag="BRARA_H00255"
                     /db_xref="Phytozome:Brara.H00255"
     mRNA            complement(join(2337420..2337688,2337820..2337912,
                     2338011..2338121,2338562..2338623,2338711..2338958,
                     2339042..2339211))
                     /locus_tag="BRARA_H00255"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00255"
     CDS             complement(join(2337578..2337688,2337820..2337912,
                     2338011..2338121,2338562..2338623,2338711..2338958,
                     2339042..2339142))
                     /locus_tag="BRARA_H00255"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49456.1"
                     /db_xref="Phytozome:Brara.H00255"
                     /translation="MESVPTTSLPESSMAATQSHFLMNNLSHRISSQRNLRADARVSS
                     SSCEMITRTNRPWALPCSLKVDNFQFQRTTRRGSPCLARFENGELLRSGIGDADGIII
                     VDHGSRRRESNIMLEEFVKMFKDNTGYPIVEPAHMELAEPSIKSAFSLCVQQGAKRVV
                     VSPFFLFPGRHWHQDIPALTADAAKEFPSISYLITAPLGLHNLLIDVVNDRIQHCLSH
                     VEGDADECLVCAGTNKCKLYNSS"
     gene            2340014..2340860
                     /locus_tag="BRARA_H00256"
                     /db_xref="Phytozome:Brara.H00256"
     mRNA            join(2340014..2340242,2340431..2340860)
                     /locus_tag="BRARA_H00256"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00256"
     CDS             2340543..2340758
                     /locus_tag="BRARA_H00256"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49457.1"
                     /db_xref="Phytozome:Brara.H00256"
                     /translation="MLLSQQKSNGAIVAEISYLCVFGFIKDYALLLSFLNSVFAGLEP
                     FRYYYLLVHLSFFRKKNLHCFGSIYVF"
     gene            complement(<2345307..>2347427)
                     /locus_tag="BRARA_H00257"
                     /db_xref="Phytozome:Brara.H00257"
     mRNA            complement(join(<2345307..2346834,2346889..>2347427))
                     /locus_tag="BRARA_H00257"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00257"
     CDS             complement(join(2345307..2346834,2346889..2347427))
                     /locus_tag="BRARA_H00257"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49458.1"
                     /db_xref="Phytozome:Brara.H00257"
                     /translation="MSQSSLVIRNGGSSSGAHRTKRSDEDIIRIPDCDINAAKERFKL
                     TLIGRVFHLRGRSIDALINLLPRSRIWNVEGRVRGINLGNGRFQFDFNNEADLMMVLN
                     KRPCHFNQWSFALERWEPFTSENFPNTIPFWINVTGVPVHFWNDKTFTEIANAVGKKL
                     LVDETKARIQVSINADQPLHYEGLHRYCFTCNLISHDENTCPQLTPTERDYKKKQRAE
                     SQANNDRARLPPQSSQTFNTRNPLKRPRSPAYGRNTSPVAASRSNELFREDKRQRSTP
                     SSHPGRDGHYSDYHNRDHRSSSRQDIGTLQGRAVWSRLEAPSTRETSRGRNNDRHQPR
                     NTPRYKAPWQRPSSPPREWRQRTSKQDPKNKVPENRVHGNRERLPERSRGTFDSQRTV
                     SDNRASLESGEIFANRNHNPETRIAETEEERIRRIKGKAIDTGSPSSLGNPKRPSFSL
                     VQRNTTLTINEQHASSPQRALLAEQRYHLSTQEPNDLSFVPMEGLELGIDTPLTELEN
                     AEVDNLVLETERLEMEENMLDIDNMIDVDNDDLLGDSPDHDAEKIEAISQLSPATAAI
                     SRDALPPPQQDTAMADATLQQVPVNKTQRKHRDQMLGYAPKGLLKKKVPRSPAKGSTA
                     SKKLQVIQSLNSKASPKKKTISGKRHSSSSSMVPRNEVFPSALSKKSVFLSGSVVSQK
                     PSSKKI"
     gene            2348952..2357166
                     /locus_tag="BRARA_H00258"
                     /db_xref="Phytozome:Brara.H00258"
     mRNA            join(2348952..2349105,2349292..2349822,2349904..2350028,
                     2350101..2350195,2350281..2350505,2350584..2350674,
                     2350919..2350970,2351920..2351985,2352942..2353093,
                     2353210..2353280,2353653..2353847,2353947..2353985,
                     2354310..2354417,2354684..2354773,2354868..2354943,
                     2355027..2355123,2355210..2355279,2355354..2355530,
                     2355621..2355743,2355857..2355940,2356022..2356206,
                     2356299..2356437,2356527..2356586,2356657..2356728,
                     2356841..2357166)
                     /locus_tag="BRARA_H00258"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00258"
     CDS             join(2349323..2349822,2349904..2350028,2350101..2350195,
                     2350281..2350505,2350584..2350674,2350919..2350970,
                     2351920..2351985,2352942..2353093,2353210..2353280,
                     2353653..2353847,2353947..2353985,2354310..2354417,
                     2354684..2354773,2354868..2354943,2355027..2355123,
                     2355210..2355279,2355354..2355530,2355621..2355743,
                     2355857..2355940,2356022..2356206,2356299..2356437,
                     2356527..2356586,2356657..2356728,2356841..2356948)
                     /locus_tag="BRARA_H00258"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49459.1"
                     /db_xref="Phytozome:Brara.H00258"
                     /translation="MYSRLIRKNQRLSCFVLKQDKCLAKPPTRDFTGSPSYRLTNPLT
                     NHFTRKHPSYFLIASGNSLSLSQNSQFRRFSSEGDGAGEDNLSKEKTGKEKSVLGGVN
                     RFDSHAQLGKQDQIDWLNNEKLASESKKESPFLNKRERLKNEFSRRIQPWETIQLSFE
                     SFPYYLHEHTKDTLVECVSSHIKQRNVASTYGSRLGSSSGRILLQSVPGTELYRERLV
                     RALARDSQVPLLILDSSVLAPYDFADDYNEESESDDEAAESDDETAESEAEEETDANN
                     DEEGSSEAKVEGSDDEERYLEISKEVLKKLGADIEDIEKRMSGQLLGSSEVPKAIAVD
                     HSDKAKRPLKKGDQVRYVGSAKKDEGKRRVVLGKISTSDGQKSAFTVIPGRPLSKGQR
                     GEVYEVSGNRVAVIFDSGDNKTSEGSEEKPAEQPQTLPIHWVDAKELKLDMDMQAVDG
                     YIAMEALNEVLASNQPLIVYFPDFSQWLSRAVPKARRKEFVDKVQEMFDKLSGPIVMI
                     CGQNKIETGSKEKEKFTMVLPNFSQFAKLPLPLKRLTEGLAGSKRSEENEIYKLFTNV
                     MRLHPPKEEDALGLFKKQLGEDRRIVISRSNINELLKVLEEHELLCTDLFQVNTDGVI
                     LTKQKAEKVIGWARNHYLATCPEPLVKGGRLSLPRESLEISIARLRKLEDNSLQPSQN
                     LKDIAKDEYERNFVSAVVAPGEIGVKFEDIGALENVKKALNELVILPMRRPELFSRGN
                     LLRPCKGILLFGPPGTGKTLLAKALATEAGANFISITGSTLTSKWFGDAEKLTKALFS
                     YATKLAPVIIFVDEIDSLLGARGGSSEHEATRRMRNEFMAAWDGLRSKDSHRILILGA
                     TNRPFDLDDAVIRRLPRRIYVDLPDAENRLKILKIFLTPENLESGFEFDKLAKETEGY
                     SGSDLKNLCIAAAYRPVQEVLQEEQKGEGADASPCLRPLSLDDFIQSKAKVSPSVAYD
                     ATTMNELRKWNEQYGEGGSRTKSPFGF"
     gene            complement(2359327..2364043)
                     /locus_tag="BRARA_H00259"
                     /db_xref="Phytozome:Brara.H00259"
     mRNA            complement(join(2359327..2359618,2359696..2359859,
                     2359957..2360040,2360124..2360174,2360257..2360363,
                     2360472..2360588,2360842..2361088,2361224..2361291,
                     2361451..2361526,2362294..2362451,2362582..2362659,
                     2363181..2363550,2363624..2364043))
                     /locus_tag="BRARA_H00259"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00259"
     CDS             complement(join(2359468..2359618,2359696..2359859,
                     2359957..2360040,2360124..2360174,2360257..2360363,
                     2360472..2360588,2360842..2361088,2361224..2361291,
                     2361451..2361526,2362294..2362451,2362582..2362659,
                     2363181..2363490))
                     /locus_tag="BRARA_H00259"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49460.1"
                     /db_xref="Phytozome:Brara.H00259"
                     /translation="MLSSRFSFLGIGSSSSEVNDSLGDSGTKIKPSLSVQTDKDVYRP
                     GDFVFVTLEVGYSAVRDHENGASPSVLVDKLSFEVKGVEKLDVQWFSAQKPSPGSKGR
                     RGEHIFLDSSTPSLISNQLLSPGAKMTLMVRAALPQIIPPSYKGATLRYHYYIKSTLS
                     GRLMALENSQFCKDSTKDFIEVETRVPIQVWAIQKNNGLLLEESQTDGIVPASTIQTE
                     IYWKGMDGDSEWTRANDAYDNGEDGYDSSRDEISSVSSYPNKGNLNRAFGSSVSLNSG
                     PRLSMNATSYIEGVGSSPKELVSQLSAAVVSYDSGPDGFSPGKSSDSVIPSQQPKQTN
                     GAGASNSPEAGAGEPVPSERFTRGRSYNIRMDDQVLLRFSPKNADSTYYFSDNIGGTL
                     TFFHEGARRCLEVSVTLETSETINRKFVHPSRRSSPTHTKVQSDHHEVVADLIQTSFL
                     FSIPTDGPMSFTTPRVSVQWILRFEFLITPKDVDLSRYEHPLLVPEREKSEWVLPITV
                     HAPPPRTSSPAQNRGDKLYGLEPSWIRS"
     gene            complement(<2369825..>2374267)
                     /locus_tag="BRARA_H00260"
                     /db_xref="Phytozome:Brara.H00260"
     mRNA            complement(join(<2369825..2370198,2370785..2372549,
                     2374259..>2374267))
                     /locus_tag="BRARA_H00260"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00260"
     CDS             complement(join(2369825..2370198,2370785..2372549,
                     2374259..2374267))
                     /locus_tag="BRARA_H00260"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49461.1"
                     /db_xref="Phytozome:Brara.H00260"
                     /translation="MGKRDALLEFKDEFPNLQYSPRASNTSLSSWNKSMDCCSWEGVT
                     CDGKSGEVNSLYFYSIFLNNSLKEDSGLFRLTHLQNLTLSNCCLHGNIPSSIGNLSQL
                     ITLELSSNKLVGQLPPSMGNLTQLRFLVVSQNNLSGNIPVSFSNLKELVNLDISSNQF
                     TGGNFPFILPNVTSLYRLPLGVSGLSKLENFDMHDNSLSGPLHTSLFMIPSLTWVDFS
                     GNYLEGPIEFGNISSSSRLEYLFLANNQFKGTIPTSISNLVNLIHLDLSNNNLEGQVP
                     GWLSQRQQVMLSQNSFNSFEKSWEVFDETNMEALDLRSNSFQGTFPYWICKLRSLRFL
                     DVSDNLFTGSIPQCLKNSTASLTYLVLRKNSFSGILPNIFFNATQLISLDVSHNQLEG
                     KVPKSLINCKAMQLLNMESNRFEDEFPSWLGSLPSLNIFILRSNQFYGPLYHNNRLSI
                     GFQALKVIDLSNNHFSGSLPSFYFSNWHEMTTLTGNYDDSYMEYYVYYAAVYYNSMEM
                     VNKGVNTEFERIRQDFRAIDFSRNNFCGSIPESIGLLKELHLLNVSGNTFTSNIPQSL
                     KYLTKLETLDLSWNQLSGQIPGGLAYKIELDTGFHNPNIASLSFLSSMDFSHNNLQGP
                     IPRSTQFQSQNCSSFMDNHKLYGLEEICRETDHAPNPTPQAYEDLFEREEERVINWIA
                     AAIAYGPGVFCGLVIGHIFVSQKHKWLTERHLL"
     gene            complement(<2380837..>2382420)
                     /locus_tag="BRARA_H00261"
                     /db_xref="Phytozome:Brara.H00261"
     mRNA            complement(join(<2380837..2380950,2381341..2381396,
                     2381479..2381656,2381728..2381825,2381844..2381952,
                     2382304..>2382420))
                     /locus_tag="BRARA_H00261"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00261"
     CDS             complement(join(2380837..2380950,2381341..2381396,
                     2381479..2381656,2381728..2381825,2381844..2381952,
                     2382304..2382420))
                     /locus_tag="BRARA_H00261"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49462.1"
                     /db_xref="Phytozome:Brara.H00261"
                     /translation="MIARSTSPENSSTETPAKSHIVLESFKSRPFCILCLLTLAFPGH
                     MNTVSCLCFRHGISEVYSGSFDRSVKAWNVQDSFGHQDEILAIDALRKERALTLGRDR
                     TMLLHKMSETSCTIYRAPASSLESCCFINDTEYLSGSDKNGLLKKIPVFLLKNAHSVV
                     AGGITTNENGDHDCVEYSNSSTTSSWNCYGFCDINMLQETRFGRWRCIKSVQNGVAIH
                     PLRLS"
     gene            <2393712..>2394690
                     /locus_tag="BRARA_H00262"
                     /db_xref="Phytozome:Brara.H00262"
     mRNA            join(<2393712..2393807,2393913..2394044,2394131..2394226,
                     2394303..2394414,2394479..2394528,2394610..>2394690)
                     /locus_tag="BRARA_H00262"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00262"
     CDS             join(2393712..2393807,2393913..2394044,2394131..2394226,
                     2394303..2394414,2394479..2394528,2394610..2394690)
                     /locus_tag="BRARA_H00262"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49463.1"
                     /db_xref="Phytozome:Brara.H00262"
                     /translation="MQNGSERLCMTPASLEQFVEAVKKTVLANNKRVPPPGKGALYIR
                     PLLLGSGAILGVAPAPEYTFLIYVSPVGDYHKVSSGLNMKVDHNYHLAHSGGAGGVKS
                     CTNCSPIVKSLVEARSSGFSDVLFLDAVTGRNIEEASTFNIFIRVTRKSISELARDIG
                     YQVQERDVTVDELLEAEEVLCTGTAVVV"
     assembly_gap    2397202..2407201
                     /estimated_length=unknown
                     /gap_type="between scaffolds"
     gene            2408061..2412158
                     /locus_tag="BRARA_H00263"
                     /db_xref="Phytozome:Brara.H00263"
     mRNA            join(2408061..2408162,2408325..2408502,2408716..2408892,
                     2408980..2409111,2410931..2411026,2411134..2411250,
                     2411393..2411488,2411576..2411688,2411802..2412158)
                     /locus_tag="BRARA_H00263"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00263"
     CDS             join(2408116..2408162,2408325..2408502,2408716..2408892,
                     2408980..2409111,2410931..2411026,2411134..2411250,
                     2411393..2411488,2411576..2411688,2411802..2411928)
                     /locus_tag="BRARA_H00263"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49464.1"
                     /db_xref="Phytozome:Brara.H00263"
                     /translation="MAPSVPHSSSVPLLTSEANEKYANVNWEELGFSLIPTDYMYMSK
                     CKQGESFSEGEIVPYGDIPISPCAGILNYGQGLFEGLKAYRTEDGRITLFRPDQNAFR
                     MQTGADRLCMTSPSSDQFVQAVKKTVLANKKWVPPPGKGSLYIRPLLIGTGAVLGIAS
                     APEYTFLIYVSPVGNYHTASSGLNLIVDHTYRRAHTGGTGGVKSCTNYSPVVKPLFEA
                     KSSGFSDILFLDAATGRNIEEVSTCNIFITKGNIVSTPPTSGTILPGITRKSISELAS
                     DIGYQVQERDVSVEELLEAEEVFCTGTAMVVKAVETVTFHDKKIKYRTGEEALSTKLH
                     LMLTNIQMGIVEDKKSWMVEINGCDE"
     gene            2414052..2415595
                     /locus_tag="BRARA_H00264"
                     /db_xref="Phytozome:Brara.H00264"
     mRNA            join(2414052..2414501,2414646..2414872,2414966..2415073,
                     2415297..2415595)
                     /locus_tag="BRARA_H00264"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00264"
     CDS             join(2414312..2414501,2414646..2414872,2414966..2415073,
                     2415297..2415419)
                     /locus_tag="BRARA_H00264"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49465.1"
                     /db_xref="Phytozome:Brara.H00264"
                     /translation="MASSLEIVRLCASPVSISRHKSPVKLESRKRVFRLADSRSWGRL
                     GRCVRVHSSALNNGDNQSKGEEPPESLFMKELKRRGMTPTSLLQDYEVDVDEIKTGGK
                     DTRNSSSKTTATTTPPFDQSLLNQRERSLALNSEGLEGLIPRARILLTIGGTFFLGFW
                     PLIVLTLGAFSALYLYFGADFIHDGSRTPVSPPPYIDPYTLLEDERISGINPRLN"
     gene            complement(2415810..2418022)
                     /locus_tag="BRARA_H00265"
                     /db_xref="Phytozome:Brara.H00265"
     mRNA            complement(join(2415810..2416615,2416690..2417060,
                     2417153..2417387,2417809..2418022))
                     /locus_tag="BRARA_H00265"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00265"
     CDS             complement(join(2415962..2416615,2416690..2417060,
                     2417153..2417387,2417809..2417901))
                     /locus_tag="BRARA_H00265"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49466.1"
                     /db_xref="Phytozome:Brara.H00265"
                     /translation="MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGG
                     GDDAFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANN
                     FARGHYTIGKEIVDLCLDRIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVD
                     YGKKSKLGFTVYPSPQVSTSVVEPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRSLS
                     IERPTYTNLNRLVSQVISSLTASLRFDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVI
                     SAEKAFHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGT
                     IKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRID
                     HKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGAEGGDDEDDEGEEY
                     "
     gene            2418911..2420081
                     /locus_tag="BRARA_H00266"
                     /db_xref="Phytozome:Brara.H00266"
     mRNA            join(2418911..2419261,2419411..2420081)
                     /locus_tag="BRARA_H00266"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00266"
     CDS             2419579..2419767
                     /locus_tag="BRARA_H00266"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49467.1"
                     /db_xref="Phytozome:Brara.H00266"
                     /translation="MRLGQRFPFFFFFFFGQQFPWFKKFLVNVSNMHKNKPPFSKKDQ
                     NLPKRNMHIHIKRKPTVP"
     gene            complement(<2426771..>2435471)
                     /locus_tag="BRARA_H00267"
                     /db_xref="Phytozome:Brara.H00267"
     mRNA            complement(join(<2426771..2427079,2427148..2427588,
                     2427690..2427739,2428110..2428239,2428323..2428766,
                     2433613..2433662,2433968..2434100,2434187..2434660,
                     2434774..2435229,2435331..>2435471))
                     /locus_tag="BRARA_H00267"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00267"
     CDS             complement(join(2426771..2427079,2427148..2427588,
                     2427690..2427739,2428110..2428239,2428323..2428766,
                     2433613..2433662,2433968..2434100,2434187..2434660,
                     2434774..2435229,2435331..2435471))
                     /locus_tag="BRARA_H00267"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49468.1"
                     /db_xref="Phytozome:Brara.H00267"
                     /translation="MSWDDGTARKVKKVHITYDDVIYSVQVTYGTALQAPRRGSVGPM
                     SVEFTLESDEYITALSGYALSTQDVVTSLTFTTNKKTYGPYGNKFGYQISAPEKTGKQ
                     IAGFHGTKDNILNSIDVHYAPIPTGTGGSETGSGVQKLPGEGLVGGTAWDDGSDHDGV
                     TNIYVASTLLGIKNVMFGYMKDGQSKQGGHHGGDPTKQEIVINHPDEHLVSVEGWYES
                     SSKFIMGIQFKTNYKICASMGYRYEGGNDYKFTHQVQDKKIIGFHGFASNHLNSIGAY
                     FAPLSSTTTLPIGTGGSGAQKLGAQGVTGGSAWDDGSYHDGVTKIVVRTCTLGVQFVN
                     FFYDNDIGAVHGAPGDPTGSTQHIVINHPDEHLVSIEGWYISNYISGIRFKTNQKTSV
                     YIGYEYTGSVVNGVEHGTPTLLGFEEFTLELGLDEYITALSAYVETLSTRDVVTSLTF
                     TTSKKNYGPYGNKSGFQIFSPGETGKQIAGFHGTSGNVLNSISGYYAPIPTYKLVAVG
                     GTGGSAWDDGSDHDGVTKITVRTGGVGVQYVKFDYVKAGQPKQGTLHGVHGSRGSTRE
                     IVINHPDEHLVSVEGWYDSSNVILGIQFKTNLKTSDYLGYEFEVVNGVENGTPTLLGF
                     EEFTLGPYEYVTALSAYTKTLSTQDIVTSLTFTTNKKTYGPYGNKSGFLFPFPEETGK
                     QIAGFHGTGGNVLNSIQVHYAPIPTVQKLDAQGGTGGTKWDDGSDHDGVTNIYVRSNM
                     DGIQYVSFDYLKAGQPKQGAHHGGSGSRGSKGEIAINHPDEQVVSVEGWYDSANVICG
                     VRFRTNQKIYDYMGYKFDGTGTKFTLKVQDKKIIGFHGFATNQLISLGAYFAPLSSAT
                     APPIVTPKEVEAKGGDFNS"
     gene            2448508..2451634
                     /locus_tag="BRARA_H00268"
                     /db_xref="Phytozome:Brara.H00268"
     mRNA            join(2448508..2448799,2449485..2449600,2449710..2449919,
                     2450003..2450107,2450193..2450255,2450354..2450465,
                     2450717..2450778,2450861..2451043,2451139..2451634)
                     /locus_tag="BRARA_H00268"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00268"
     CDS             join(2448565..2448799,2449485..2449600,2449710..2449919,
                     2450003..2450107,2450193..2450255,2450354..2450465,
                     2450717..2450778,2450861..2451043,2451139..2451219)
                     /locus_tag="BRARA_H00268"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49470.1"
                     /db_xref="Phytozome:Brara.H00268"
                     /translation="MATSMVSPLTSQLNHESVCSKFVLPKSPFMSGSKLFSSNMPCSS
                     VPRRTRRSNCFASAKDMSFDHIPKQFRGDNLKAGVTQNFKNVPQYFYGLNPAQMDMFM
                     TEDSPVRRQAEKVTEESISSRSNYLDNGGTWSMSGMNAADPKRYSMSVQMYRGGGGGG
                     GSARPRTAPPDLPSLLLDARICYLGMPIVPAVTELLVAQFMWLDYDNPSKPIYLYINS
                     PGTQNEKMETVGSETEAYAIADTISYCKSDVYTINCGMAFGQAAMLLSLGKKGYRAVQ
                     PHSSTKLYLPKVNRSSGAAIDMWIKAKELDANTEYYIELLAKGTGKTKEQINEDIKRP
                     KYLQAQAAIDYGIADKIANSQDSSFEKRDYDGSLAQRAMGRPGGGNPTSPAGLR"
     gene            complement(2451140..2454348)
                     /locus_tag="BRARA_H00269"
                     /db_xref="Phytozome:Brara.H00269"
     mRNA            complement(join(2451140..2451867,2451956..2452033,
                     2452218..2452309,2452393..2452538,2452628..2452724,
                     2452808..2452992,2453093..2453152,2453249..2453324,
                     2453415..2453515,2453594..2453770,2453862..2453959,
                     2454205..2454348))
                     /locus_tag="BRARA_H00269"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00269"
     CDS             complement(join(2451416..2451867,2451956..2452033,
                     2452218..2452309,2452393..2452538,2452628..2452724,
                     2452808..2452992,2453093..2453152,2453249..2453324,
                     2453415..2453515,2453594..2453770,2453862..2453959,
                     2454205..2454292))
                     /locus_tag="BRARA_H00269"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49469.1"
                     /db_xref="Phytozome:Brara.H00269"
                     /translation="MAKIDDFAPFPVKDQLPGVEYCVSSSPNWPEGIVQGFQHYIVML
                     GTTVIIPSILVPLMGGGDVQKAEVINTVLFVSGINTLLQSLFGSRLPVVIGASYAYVI
                     PALYITFSYRFTYYLHPHVRFEETMRAIQGALIIASISHMVMGFFGLWRILVRFLTPL
                     SAAPLVILTGVGLVVLAFPQLARCVEIGLPALIILIILSQYLPHLFKCKRSICEQFAV
                     LFTVAIVWAYAEILTAAGAYNKRPDSTQLSCRTDRSGLISASPWVRIPYPLQWGRPSF
                     HASDAFAMIAASYVAIVETTGSLIAASRFGSATHIPPSVLSRGIGWQGIGVLLNGLFG
                     TATGATALVENTGLLGLTKVGSRRVVQISAGFMIFFSIFGKFGAVLASIPLPIFAALY
                     CVLFAYVASAGLGLLQFCNLNSFRTKFILGFSIFIGLSVAQYFTEYLFISGRGPVHTR
                     TSAVSVLHHHFMFVYFLSVMIRLPWTQFNVIMQVIFSSAATVGIMAAFLLDCTHSYGH
                     ASVRRDSGRHWWEKFRVYYTDTRTEEFYALPYNLNRFFPSF"
     gene            2456737..2458771
                     /locus_tag="BRARA_H00270"
                     /db_xref="Phytozome:Brara.H00270"
     mRNA            join(2456737..2456861,2457163..2457333,2457416..2457594,
                     2457749..2457833,2457913..2458002,2458094..2458415,
                     2458495..2458771)
                     /locus_tag="BRARA_H00270"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00270"
     CDS             join(2457184..2457333,2457416..2457594,2457749..2457833,
                     2457913..2458002,2458094..2458415,2458495..2458514)
                     /locus_tag="BRARA_H00270"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49471.1"
                     /db_xref="Phytozome:Brara.H00270"
                     /translation="MGAPKHKWSQEEESALRSAVAKHGPGRWRTILKDPDFSQVLFLR
                     SNVDLKDKWRNISVMGYGSGSRPKPVKRTLGSLPSDEEILEMVDAKNVSTTGSSALQV
                     SSPRTPNWLDSLITEAICTMKQLGGSSKTAIGNYIQERYEVPPNFKQLLSSRLKYLSA
                     FGCGKLIKVKRKYRIPNSTALSSHKKRHLGTSSDKDEVSVQRQSEVDAELAKVMIVNI
                     HEAAAVAAQAVAEAEAAMVEADEAAKQAEIAEAEAEAAQVFAEEVSKSLKGIKQLQCD
                     DPCLR"
     gene            complement(2458778..2461729)
                     /locus_tag="BRARA_H00271"
                     /db_xref="Phytozome:Brara.H00271"
     mRNA            complement(join(2458778..2459087,2459183..2459283,
                     2459375..2459453,2459778..2459858,2459947..2460022,
                     2460116..2460382,2460557..2460639,2461311..2461441,
                     2461505..2461729))
                     /locus_tag="BRARA_H00271"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00271"
     CDS             complement(join(2459000..2459087,2459183..2459283,
                     2459375..2459453,2459778..2459858,2459947..2460022,
                     2460116..2460382,2460557..2460639,2461311..2461441,
                     2461505..2461618))
                     /locus_tag="BRARA_H00271"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49472.1"
                     /db_xref="Phytozome:Brara.H00271"
                     /translation="MTLVPSIGRELSNPPSDGISNLRFSNSSDHLVVSSWDKSVRLYD
                     ANADSMRGEFKHGGAVLDCCFHDDSSGFSASADHKVRRIDFNAGKEDILGMHDEPVRC
                     VEYSYAAGQVITGSWDRTIKCWDPRAASGPERSQIGTYKQPERVNSLSLVGNHLVVAT
                     AGRHVNIYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVSMEFFDLSE
                     AAQAKKYAFKCHRKSEDGRDIVYPVNAIAFHPIYGTFATGGCDGFVNVWDGNNKKRLY
                     QYSKYPTSIAALSFSRDGGLLAIASSYTFEEGDKPHEPDAIFVRNVNEIEVKPKPKVY
                     PNPPA"
     gene            2463159..2464645
                     /locus_tag="BRARA_H00272"
                     /db_xref="Phytozome:Brara.H00272"
     mRNA            2463159..2464645
                     /locus_tag="BRARA_H00272"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00272"
     CDS             2463260..2464615
                     /locus_tag="BRARA_H00272"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49473.1"
                     /db_xref="Phytozome:Brara.H00272"
                     /translation="MGSKFHAFMYPCFAFGHMIPYLHLANKLAEKGHSITFLLPKKAQ
                     KQLESLNLHPESICFHPLTLPPVEGLPVGAETTADLPPNTTGKLISDAMDLLRDQIEA
                     KVRVLKPDLIFFDLVPWVPEMAKEFGVKSVSYQIVSAACVAVALAPGVELGFPQQPGY
                     PSSKVAFRGHDANLYSIFTNSHKRFFSRIITGLKNSDVASIRTCAEIEGKYCSFIERE
                     CQRKVLLTGPMFPEPQEKSVKPLEDQWNQWLNRFEPGSVVFCALGSQTILEKDQFQEL
                     CLGMELTGLPFLVAVKLPRGSSTVQEALPEGFEERVKGRGIVWGGWVEQPLILSHQSV
                     GCFVNHCGSGSMWESLVSDCQIVFIPQLGDQVLTTKLLSEELEVSVKVHREDSGWFSK
                     ESLRDAVKSVMDKDSEIGNLVKRNHMKLKETLVSPGLLSGYADKFVEALEAEVNNTKS
                     S"
     gene            complement(2471775..2475198)
                     /locus_tag="BRARA_H00273"
                     /db_xref="Phytozome:Brara.H00273"
     mRNA            complement(join(2471775..2472260,2472356..2472463,
                     2472617..2472706,2472786..2472902,2473360..2473479,
                     2473820..2475198))
                     /locus_tag="BRARA_H00273"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00273"
     CDS             complement(join(2472192..2472260,2472356..2472463,
                     2472617..2472706,2472786..2472902,2473360..2473479,
                     2473820..2474992))
                     /locus_tag="BRARA_H00273"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49474.1"
                     /db_xref="Phytozome:Brara.H00273"
                     /translation="MVAGVISSSTDPRNPPRDRPNNVGSGQRRPTRGKQVPSRYLSPS
                     PSHSLSSSTTTTSSSSSSSSSAFLKTTKRHPSPLLPRPTNSTSNPIKTPSLLPKRSQS
                     ADRRRPSAAPAEMSAATKMLITSTRSLSVSFQGEAFSLPVSKKKEPASPPVSHRRSTP
                     VRDQRENSKPVDQHRWPGASRRGKSEPFAPNPLFGESPRVSINGRLSLNMESGRRRRR
                     PNNGLLTSSDVTASDTDSVSSGSTNGETSKSRSLASSARFWQETNTRLRRLQDPGSPS
                     VSSPRGMASSPVRGGGGAAAIRSASPSKLWATTTTTTSSPARALSSPCRVSDQMNNRK
                     DTPSILSFSADIRRGKIGGDRVVDAHLLRLLYNRYLQWRFVNARADSALMVQRLNAEK
                     NLWNAWVSISELRHSVTLKRIKLLLLRQKLKLASLLRGQMGYLEEWSLLDKDHSSSLS
                     GATQALKASTLRLPIVGKTVVDIKDLKYAVSSAVDVMQAMSSSIFSLTLKVDEMNSVM
                     VETVNVTAKEKVLLERCQGFLSRVAAMQVTDCSVKTHIIQLRPITSSLTS"
     gene            complement(2501599..2503485)
                     /locus_tag="BRARA_H00274"
                     /db_xref="Phytozome:Brara.H00274"
     mRNA            complement(join(2501599..2501843,2501974..2502051,
                     2502135..2502199,2502393..2502440,2502751..2502828,
                     2503186..2503485))
                     /locus_tag="BRARA_H00274"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00274"
     CDS             complement(join(2501738..2501843,2501974..2502051,
                     2502135..2502199,2502393..2502440,2502751..2502828,
                     2503186..2503380))
                     /locus_tag="BRARA_H00274"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49475.1"
                     /db_xref="Phytozome:Brara.H00274"
                     /translation="MAENPWQPLLHTFEKLSNCVQTHLSNFIGIKSTPRSSPTIQNPI
                     SSDSSPTITINSSNLQKLPLKDKPIGPVTKEDLGRATWTFLHTLAAQYPEKPTRQQKK
                     DVKELMAILSRMYPCRECADHFKEILRSNPPRAGSQEEFSQWLCHVHNTVNRSLGKLV
                     FPCERVDARWGKLECEQKSCDLHGTSMDF"
     gene            complement(2508890..2512292)
                     /locus_tag="BRARA_H00275"
                     /db_xref="Phytozome:Brara.H00275"
     mRNA            complement(join(2508890..2509161,2509265..2511248,
                     2511331..2511506,2511587..2511727,2512023..2512292))
                     /locus_tag="BRARA_H00275"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00275"
     CDS             complement(join(2509114..2509161,2509265..2511248,
                     2511331..2511506,2511587..2511727,2512023..2512139))
                     /locus_tag="BRARA_H00275"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49476.1"
                     /db_xref="Phytozome:Brara.H00275"
                     /translation="MIKAAIDLGCLDLGCLSVSDKRSGADPLQFSSSPSKSGQKNSPR
                     ETSTLRKSHSKRSSQRKSSPLGWFPRRRGGDSYLNRKIKKLQEEVGGMNQTLDETLGD
                     SNPHYCRIVREQMAVREAAGKAMELRKAALVEASWSRILRAARIPSLEAETLMENAEK
                     AAVEAFEAASALGVIMHDKPNSSRKQYKIKSSGAHGGGSPTHTVTASFETAFDVDKEV
                     AAAVKAAFAKLANCPSLSKAEIRDLLRKISENPDLRDNQHEITEVSSECDTESDSEHK
                     VDEEVAECEETSSFKMRQLKVKRRQSFGKLNREKLVDMMLERLQGLQEDQLSSLASIV
                     ATCGLSEALAEVDHQKLQTTNIEPTVSDTSAETRSRRDSKFGSFTEGKTTSDGKETEI
                     PSLDKYLVKHMTKLEREVNEAKRASKDVFEKGRNVPQGVASETVPDLGSILVKHSSKL
                     EKEIEEAKKNPGVNPRTYQKNSRRRKAPLVPVPDLKSLLVKKHVSRLEKDVEETIRNC
                     GNMYENVKKPGKQDVPEDSSLESCMVKHVSKLEKEVQEAKKRNKEDLEARNLEKVEKS
                     SSLLTEEMEKENMDLNKKTKGQEESLDKILVKPVHRLEREKAGSEAVYGNLRIKQRKQ
                     ESEYESLDKVLVKHVPKLEKEKLRFKAEREATTTVVEEKENSKSNNEESMKTVKPVLT
                     RRQMRDKEIQETWGGLGLGESKRPESKKTEVNEHLGEETRPVLTRRQERDKEMLEAWG
                     GLGLGDSSLLTVNNKHKRKPESEKMETAAPVLTRRQARDREMQEAWGGLDLGNAIRPS
                     LSKLEREKAAWIKAEEEERTRGN"
     gene            <2519326..>2519814
                     /locus_tag="BRARA_H00276"
                     /db_xref="Phytozome:Brara.H00276"
     mRNA            join(<2519326..2519577,2519628..2519653,2519721..>2519814)
                     /locus_tag="BRARA_H00276"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00276"
     CDS             join(2519326..2519577,2519628..2519653,2519721..2519814)
                     /locus_tag="BRARA_H00276"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49477.1"
                     /db_xref="Phytozome:Brara.H00276"
                     /translation="MPSAIPKYHQYYSSAMSYSSHPPVYSTTPTGNEIASDVRATKFS
                     QFSRQITLGGINGGNEATRGADSSTHATRKSVKWTTEQNLKPEEQIVLRNHYNNMNQK
                     LEKWISAYDNAKRMQQSGCSE"
     gene            2539888..2540421
                     /locus_tag="BRARA_H00277"
                     /db_xref="Phytozome:Brara.H00277"
     mRNA            join(2539888..2540028,2540381..2540421)
                     /locus_tag="BRARA_H00277"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00277"
     CDS             join(2539957..2540028,2540381..2540404)
                     /locus_tag="BRARA_H00277"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49478.1"
                     /db_xref="Phytozome:Brara.H00277"
                     /translation="MFSFSFLKARRDLESIPKVYTLLKIDLSAFL"
     gene            complement(<2543041..>2544860)
                     /locus_tag="BRARA_H00278"
                     /db_xref="Phytozome:Brara.H00278"
     mRNA            complement(join(<2543041..2543513,2544599..>2544860))
                     /locus_tag="BRARA_H00278"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00278"
     CDS             complement(join(2543041..2543513,2544599..>2544860))
                     /locus_tag="BRARA_H00278"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49479.1"
                     /db_xref="Phytozome:Brara.H00278"
                     /translation="LFLPLLKWFITRFLLTNPKRLKRYGSWAMVTGATDGIGRAFAHE
                     LAKHGLNLILISRNPLKLASVSDDFRQEFPQIKIKIIPFDFSSEGGYGAIEEGIKGVE
                     VGILINNVGITYPRAMFFHEVDQLTWIKILRVNLEATTWVTRSLIGPMLHRRRRAIVN
                     ISSGAAVVVPSHPLYAIYAATKALRLSTLTSLLFSFSSGQCTFQNYSTHEQQNRAELL
                     GLKKNIWDTKFSFTRYVMSIKTEIYL"
     assembly_gap    2545426..2555425
                     /estimated_length=unknown
                     /gap_type="between scaffolds"
     gene            complement(<2555599..>2556423)
                     /locus_tag="BRARA_H00279"
                     /db_xref="Phytozome:Brara.H00279"
     mRNA            complement(<2555599..>2556423)
                     /locus_tag="BRARA_H00279"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00279"
     CDS             complement(2555599..2556423)
                     /locus_tag="BRARA_H00279"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49480.1"
                     /db_xref="Phytozome:Brara.H00279"
                     /translation="MVKRGGTKRKAEIKKITNKSSKAVTFTKRRDGLFSKAAQLCLLG
                     DAQIAILATPSSSHSNVSFFSFGHSSVDSMVSAYLSGQRPAPPPVLEDSKEMREDIAV
                     CMARKELGLGYWWEDEKLLASKSREEIMEAMESMQILWKAAERLREDEAIDFDQREGS
                     LEKMEDMSNDQTTLISTEDDQIISVCDSFFNYNNNNNAALSATPPDEDDDHQIEAVSE
                     NHCSNNMNALLSPPAAAAGGLNDQNLLDLDLANLDLDTIFEGLADLDAEFVASLLM"
     gene            complement(2557510..2560682)
                     /locus_tag="BRARA_H00280"
                     /db_xref="Phytozome:Brara.H00280"
     mRNA            complement(join(2557510..2557909,2558486..2558579,
                     2558662..2558792,2558870..2558937,2559099..2559582,
                     2560117..2560682))
                     /locus_tag="BRARA_H00280"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00280"
     CDS             complement(join(2557781..2557909,2558486..2558579,
                     2558662..2558792,2558870..2558937,2559099..2559582,
                     2560117..2560485))
                     /locus_tag="BRARA_H00280"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49481.1"
                     /db_xref="Phytozome:Brara.H00280"
                     /translation="MQTTNNGPDSSSAGTTPPPLQQPTPPPQQQHWQNQQQWMAAMQY
                     PMAMMQQQQHMMMYPHQYAPYTQGHYQHPPQFHYAPYHQQQHQQRGGSGGDDVKTLWV
                     GDLLHWMDETYLHTCFSHTNEVSSVKVIRNKQTNQSEGYGFVEFLSRSAAEEVLQSYS
                     GVTMPNADQPFRLNWASFSTGEKRASENGGPDLSIFVGDLAPDVTDALLLETFAGYQS
                     VKGAKVVIDSNTGRSKGYGFVRFGDESERSRALTEMNGAFCSSRQMRVGIATPKRASA
                     YGQQNGSQALTLAGGHGANGSVSDGDSNNSTIFVGGIDADVTEEDLMQPFSQFGEVVS
                     VKIPVGKGCGFVQFGNRKSAEEAIENLNGTVIGKNTVRLSWGRSPNRQWRGEAGHQWN
                     GGYSRGQGYSNGYANQDSNMYATAAAAVPGAS"
     gene            complement(<2567566..>2570213)
                     /locus_tag="BRARA_H00281"
                     /db_xref="Phytozome:Brara.H00281"
     mRNA            complement(join(<2567566..2567936,2568048..2568344,
                     2568414..2568821,2569750..2569861,2570043..>2570213))
                     /locus_tag="BRARA_H00281"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00281"
     CDS             complement(join(2567566..2567936,2568048..2568344,
                     2568414..2568821,2569750..2569861,2570043..2570213))
                     /locus_tag="BRARA_H00281"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49482.1"
                     /db_xref="Phytozome:Brara.H00281"
                     /translation="MIFIIPKKLKAGNGVDLETANGTGVEGEVAGEGGGEGEESGGVD
                     GGGVEVEVEGEGDRRLAGVATAPPCGASSLVSSGRCLKRKIGCIDVSTQTGKFGSVRI
                     CRSKSNGIDFACKTLKKGEETVHREVEIMQHLSGHPRVVTLHAVYEESDCFHLVMELC
                     SGGRLIDQMVKEGRYSEQRAANIFKDLMLVINYCHEMGVVHRDIKPENILLTAAGKIQ
                     LADFGLAMRIAKGQTLSGLAGSPAYVAPEVLSESYSEKVDVWSAGVLLYALLSGVLPF
                     KADSLDAIFEAIKKVKLDFNSGVWESVSKPARDLLSTMVTRDESARITADEVLRHPWI
                     LFYTDRTLKTMCIKSKHKGQSGSPPGLQLRSPIKKTDVNRANREKKTTYDDDSPTDSF
                     SNTEEEEDESGVVDVLVVAISNVRISEPKRSRLCSPTNSPIEQQHSSNLTTTTNTLCR
                     AF"
     gene            <2578047..>2581168
                     /locus_tag="BRARA_H00282"
                     /db_xref="Phytozome:Brara.H00282"
     mRNA            join(<2578047..2578837,2581096..>2581168)
                     /locus_tag="BRARA_H00282"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00282"
     CDS             join(<2578047..2578837,2581096..2581168)
                     /locus_tag="BRARA_H00282"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49483.1"
                     /db_xref="Phytozome:Brara.H00282"
                     /translation="GCPRIVTCFGDSLRQGLSNYGNKVHKLQLEYASEGSLSAFMDHY
                     ADRKLPEALVKDFTRMILEGLVSIHDHGYVHCDIKPDNLLVFPSRQDSYELKISDFGN
                     TLEVGEVPKFWESEFPWVGTPIYMPPESVRDGFANKGIGLWSVGCLVLEMYTGVIPWE
                     GVNLDLLASRLHCGKAPEIPESLPSDAKAFIETCFSRNPEERGSVCELLLHPFLPRPL
                     VEGEEKKTSNSFLLKLFKLRIRRTSSNKKPTADVVAVSDKKPLKLSRELSVRTRAKAC
                     GSVTLRAEETA"
     gene            complement(<2582356..>2583494)
                     /locus_tag="BRARA_H00283"
                     /db_xref="Phytozome:Brara.H00283"
     mRNA            complement(join(<2582356..2582829,2582886..>2583494))
                     /locus_tag="BRARA_H00283"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00283"
     CDS             complement(join(2582356..2582829,2582886..2583494))
                     /locus_tag="BRARA_H00283"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49484.1"
                     /db_xref="Phytozome:Brara.H00283"
                     /translation="MLRRIALSYPLRSHPLFIRHFPRYYQPLSPSQTAVILSGSHYLC
                     RLSTTTLRCISSQTSSDLVSEHPPFVRIYKDGRVERLAGTETIPASLTPQNGVVSKDV
                     VYSPEHNLSVRLFLPHKSTELVTGNNNKLPLLIYIHGGAWLIGSPFSPIYHNFLTEVV
                     KTANCLAVSVQYRLAPEYPIPAAYEDSWSAIQWIISHSNESGPRRRGGNMAHHMAVRA
                     GKEKLNARIKGTAIVHPAFWGKEPIDELDVQDGEARRRVAEVWEKLVSPGSVDGADDP
                     WFNVVGSGSDFLGLGCEKVLVAVAGRDVFVRQGLGYAEKLKKSGWRGDVEVMEEEDED
                     HCFHLLNPCSENAPRFMTKFVEFITG"
     gene            complement(2584009..2588651)
                     /locus_tag="BRARA_H00284"
                     /db_xref="Phytozome:Brara.H00284"
     mRNA            complement(join(2584009..2584407,2584622..2584708,
                     2584798..2584884,2585049..2585126,2585230..2585358,
                     2585434..2585553,2585637..2585711,2585832..2585927,
                     2586009..2586110,2586198..2586266,2586347..2586473,
                     2586549..2586735,2586909..2586996,2587195..2587271,
                     2587349..2587454,2587536..2587717,2587797..2587970,
                     2588403..2588651))
                     /locus_tag="BRARA_H00284"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00284"
     CDS             complement(join(2584357..2584407,2584622..2584708,
                     2584798..2584884,2585049..2585126,2585230..2585358,
                     2585434..2585553,2585637..2585711,2585832..2585927,
                     2586009..2586110,2586198..2586266,2586347..2586473,
                     2586549..2586735,2586909..2586996,2587195..2587271,
                     2587349..2587454,2587536..2587717,2587797..2587970,
                     2588403..2588457))
                     /locus_tag="BRARA_H00284"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49485.1"
                     /db_xref="Phytozome:Brara.H00284"
                     /translation="MEIKPGLSALVTGGASGIGRALCLALAEKGVFVTVVDFSEEKGK
                     ETTSLVQKANASFHPGLNSPSAIFVKCDVTNRGDLIAAFDKHLATFGTLDICINNAGI
                     ANPARFDKDDSDGSRSWRHTINVDLVAVVESTQLAIKAMKGKQKPGVIINMGSAAGLY
                     PMSFDPIYSAAKGGVVLFTRSLAHLKRQGVRINVLCPEFIQTDLAEAIGASFLQAIGG
                     YMPMDMLIKGAFELITDESKAGACLWISNRRGLEYWPTPMEQAKYLVGSGSRKRTSFK
                     VTSTIELPQSFEKIIVHALSHNFRNATRIVRTPLKLPIGPHQVLLKIIYAGVNASDVN
                     FSSGRYFSGGSPKLPFDAGFEGVGLIAAVGESVNNLEVGTPAAVMTFGAYAEYMIVSA
                     KHVLPVPRPDPEVVAMLTSGLTALTALEKAGQMKSDETVLVTAAAGGTGQFAVQLAKL
                     AGNKVIATCGGSEKAKLLKELGVDRVIDYKAEDIKTVLKKEFPKGVDIIYESVGGKMF
                     DLCLNALAVYGRLIVIGMISQYQGEKGWQPANYPGLCEKILAKSQTVAGFFLVQYSQL
                     WKQNLDKLFNLYSLGKLKVGIDQKKFIGLNTVSDAVEYLHSGKSTGKVVVCMDPTFEQ
                     TTSRL"
     gene            complement(2613395..2616048)
                     /locus_tag="BRARA_H00285"
                     /db_xref="Phytozome:Brara.H00285"
     mRNA            complement(join(2613395..2613822,2613898..2614128,
                     2614207..2614363,2614789..2614893,2614972..2615213,
                     2615286..2615446,2615529..2616048))
                     /locus_tag="BRARA_H00285"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00285"
     CDS             complement(join(2613567..2613822,2613898..2614128,
                     2614207..2614363,2614789..2614893,2614972..2615213,
                     2615286..2615446,2615529..2615885))
                     /locus_tag="BRARA_H00285"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49486.1"
                     /db_xref="Phytozome:Brara.H00285"
                     /translation="MGVFSNLRGPRIGATHDEMPVANTSSSTPTLSIKRKLSSLLPIC
                     VALVVIAEICFLGRLDKVSLVNTLTDFFAQSPPSRPDQNIGLMSESCEEWLTRQDSVT
                     FSRDFKKDPIFVYGGQKDFQSCSIDCTFGDSSGRAPDAAFGLGNQPGSLSILRSMESA
                     QYYPENDISQARRSGYDIVMTTSLSSDVPVGYFSWAEYDIMAPVQPKTEKAIAAAFIS
                     NCGAPNFRLKALEALMKSSIKIDSYGGCHRNRDGEVDKVEALKRYKFSLAFENTNEED
                     YVTEKFFQSLVAGSVPVVVGAPNIDEFAPASDSFLHIKSMEDVEPVAKKMKYLAANPA
                     AYNQTLRWKYEGPSDSFKALVDMAAVHSSCRLCIFLATRIQEQEEKSPSFKKRPCKCT
                     RGGSDTVYHVFVRERGRFEMESIFLRGKHLTLEALESAVVAKFKSLKHEPVWKKERPP
                     SLKGDNELRVHRIYPLGLTQRQALYKFKFEGNSSLSTHIQHNPCAKFEVVFV"
     gene            complement(<2626688..>2626903)
                     /locus_tag="BRARA_H00286"
                     /db_xref="Phytozome:Brara.H00286"
     mRNA            complement(<2626688..>2626903)
                     /locus_tag="BRARA_H00286"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00286"
     CDS             complement(2626688..>2626903)
                     /locus_tag="BRARA_H00286"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49487.1"
                     /db_xref="Phytozome:Brara.H00286"
                     /translation="PCPVLVRMVFQMTVYHIWRERNARRHGKAWIPYEKLTSQIDKTM
                     RNRISSLKYFYGDKLAGLMRRWFEVTM"
     gene            complement(2627455..2628131)
                     /locus_tag="BRARA_H00287"
                     /db_xref="Phytozome:Brara.H00287"
     mRNA            complement(join(2627455..2627696,2627940..2628131))
                     /locus_tag="BRARA_H00287"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00287"
     CDS             complement(join(2627608..2627696,2627940..2628018))
                     /locus_tag="BRARA_H00287"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49488.1"
                     /db_xref="Phytozome:Brara.H00287"
                     /translation="MFLFTSRSQKRIDLREEASALYCLRNTHSRHLFLSTDTQHQSLQ
                     FIVTVFNTHNF"
     gene            complement(<2643158..>2644798)
                     /locus_tag="BRARA_H00288"
                     /db_xref="Phytozome:Brara.H00288"
     mRNA            complement(join(<2643158..2644258,2644538..>2644798))
                     /locus_tag="BRARA_H00288"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00288"
     CDS             complement(join(2643158..2644258,2644538..2644798))
                     /locus_tag="BRARA_H00288"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49489.1"
                     /db_xref="Phytozome:Brara.H00288"
                     /translation="MGKRKGPKLRSPPKEGRSTSGSASVPKVPPSDPPTPTGSVVVES
                     DTESVAAGSPAPLKESTTLQLENEAPNGLEPQSKPAGGPVIAILKKSCDSYILPSGEA
                     CVKIPNSVIEKHRKSWDCFVIGQFYVDPPSQGTIHNIVNGIWSKQYRDIAVSKMEGFT
                     YLFRIPNVSTRNHVINQRLWQIDGKTMFVAKWEPGVVPSKPELSEAPIWLELRQVPLQ
                     FFNEDGLERIASLVGDPKFLHPTTANKTNLEVAKVFTIIDPRKPLPEVVNVQFEAGKI
                     CRVLVSSPWMPPVCGHCKEIGHTSTKCKLALITCIPCNLTSHSPLTCPKTKSLEAKRR
                     KTRRAKPKEKQWALVNPKHQDLPGLDSSVKSKLGTSSDFAIGECSKSHKNQLQPQEDN
                     SKQKEAQADVSSGVDPDSSDVESSEEEEGEILEDDEENYRQVHNKSNSKYGDSRGEGP
                     NLA"
     gene            2645367..2648119
                     /locus_tag="BRARA_H00289"
                     /db_xref="Phytozome:Brara.H00289"
     mRNA            join(2645367..2645846,2646057..2646179,2646272..2646409,
                     2646598..2646696,2646778..2647081,2647163..2647386,
                     2647563..2647649,2647735..2648119)
                     /locus_tag="BRARA_H00289"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00289"
     CDS             join(2645766..2645846,2646057..2646179,2646272..2646409,
                     2646598..2646696,2646778..2647081,2647163..2647386,
                     2647563..2647649,2647735..2647755)
                     /locus_tag="BRARA_H00289"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49490.1"
                     /db_xref="Phytozome:Brara.H00289"
                     /translation="MLQRLVFLLIVLLIQSSFLFEISSALQEGKTCILNDNCDAGLHC
                     ETCLANNNLRPRCSRTQPINPISKVKGLPFNKYAWLTTHNSFARLGQVSKTGSVILAP
                     TNQQDSVTSQLANGVRGFMLDMYDFENNIWLCHSFDGTCFNFTAFQPAVNVLREIQVF
                     LENNKDEVVTIIIEDYVKSPKGLTKVFNAAGLQKFMFPVTRMPKIGGDWPTLDDMIQQ
                     NQRLLVFTSDRSKEATEGIAYQWKYMVENQYGNGGLKVGACPNRAQSAPMSDKSKSLV
                     LVNHFPDAPDLVVACRQNSAPLLESIKACYQAAGQRWPNFIAVDFYKRSDGGGAPQAV
                     DVSNGNLICGCDNFAACKANGECG"
     gene            complement(2657910..2663243)
                     /locus_tag="BRARA_H00290"
                     /db_xref="Phytozome:Brara.H00290"
     mRNA            complement(join(2657910..2658738,2662329..2663243))
                     /locus_tag="BRARA_H00290"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00290"
     CDS             complement(join(2658162..2658738,2662329..2663179))
                     /locus_tag="BRARA_H00290"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49491.1"
                     /db_xref="Phytozome:Brara.H00290"
                     /translation="MASLLLLLLSLSLVSFTLPTGDTHITKRKSFEIIIGGGGNPPPS
                     PSPEPEPEPEDCSPPPPPPPCLPAPQLPPPQRQRAPPKPPPKSRGQPPLPLVGFESPL
                     LEKVFPVLKAFKKLVTRDPMLILKTWEGTDICNKYKYLGLECAIFPNTTDKALASIQF
                     NGFNFGGDKLVLHNFLDKLDTVTIFHANSNDFLGSVPEVTNLKYLFELDLSNNKLTGD
                     FPASVLKAKNLTFLDLRFNTFSGCVPPQVFNLDLDVLFINNNNLVQTLPSNLGSITAL
                     YLTFANNRFTGPIPASIGNIKFLQEVLFLNNSLTGCLPYQIGKLNRATVFDVGFNQLT
                     GLIPYSFGCLAKMEQLNLARNKFYGTIPEIVCELSSLKNLSLSYNYFTQAGPKCRELI
                     KRNILDVRMNCILDLPNQKMASECSTFFMQRQTCPDPKSMYLIPCGKNPNGVKLDQER
                     LEAKEAQASSPVSYGVLNPDGVRNR"
     gene            complement(<2672160..>2673689)
                     /locus_tag="BRARA_H00291"
                     /db_xref="Phytozome:Brara.H00291"
     mRNA            complement(join(<2672160..2672498,2672699..2673400,
                     2673588..>2673689))
                     /locus_tag="BRARA_H00291"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00291"
     CDS             complement(join(<2672160..2672498,2672699..2673400,
                     2673588..>2673689))
                     /locus_tag="BRARA_H00291"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49492.1"
                     /db_xref="Phytozome:Brara.H00291"
                     /translation="AREDVHTKNSYVLDGFSYAFQIWIMEGIPDIGSMGELFTFISST
                     GDFDVIADTEFLREDEKKDERVGRIVELINAKQDWTHFDWEVESLPAHMDLSDSEQDE
                     PADVAEEPSEQEEATVVAGEPAVTAKRGKRKLIDPGAESRKKQLLCQRAAEHNSGVSS
                     EMKTFIEGLFTASFNSFKEVVQKDIHERFDNLANEVSQLKEQVSQLKGLSETVGKGNT
                     SEILSPSATIGKDQGPSSHSTGPPAGNGKGKASANVVPPPVRRSPRPVREDVQTDENE
                     MMDFLKNLTKSARCVDKGTQDSLQEAMGNLSQASHVKGFDPSQHLDGDEPADFATPLS
                     SFKPADWRPPTLKDVDSLEDRIHDPDYSLVFVPEASWGKLVDWTKTF"
     gene            complement(<2675805..>2677076)
                     /locus_tag="BRARA_H00292"
                     /db_xref="Phytozome:Brara.H00292"
     mRNA            complement(<2675805..>2677076)
                     /locus_tag="BRARA_H00292"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00292"
     CDS             complement(2675805..2677076)
                     /locus_tag="BRARA_H00292"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49493.1"
                     /db_xref="Phytozome:Brara.H00292"
                     /translation="MPGNLEPLDLGIQIPYHFRCPISLELMTDPVTVSTGQTYDRTSI
                     ESWIATGNTSCPVTRLPLSDFTLIPNHTLRRLIQEWCVANRSSGVERIPTPKQPADPI
                     SVRSLLSQASAISGTHVSVRSRAAAIRRLRGLARDSEKNRVLIAGHNAREILVRILFA
                     DVDVGVETSSSEVVTESLALLVMFHMTEGECESISSDPGRVGFMTRLLFDSSIENRVN
                     AAALVEMVLTGSKSTDLKMIISGSGSVFEGVMDLLRSSVSSRRALKIGIKALFALCLV
                     KQTRHLAISAGAPGTLIDRLAADFDRCDTERGLATVELLCRLPEGCAAFGEHALTVPL
                     LVKTILRVSDRATEYAAGALLALCTAEERCRDEAAAAGLVTQLLLLVQSDCTERAKRK
                     AQMLLKLLRDSWPDDTLVNSDEFGRSEVAPF"
     gene            complement(2689712..2690261)
                     /locus_tag="BRARA_H00293"
                     /db_xref="Phytozome:Brara.H00293"
     mRNA            complement(2689712..2690261)
                     /locus_tag="BRARA_H00293"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00293"
     CDS             complement(2689877..2690206)
                     /locus_tag="BRARA_H00293"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49494.1"
                     /db_xref="Phytozome:Brara.H00293"
                     /translation="MVIAKNRTEHYVVLVLVLINMVGSVLLATEGRPVKYSSTALTQL
                     RDSPVYNGSVMSKLKPVESSAQDVSWLATVKQSGPSPGVGHHRAKGYKTFGRVRDESG
                     PSPGVGH"
     gene            complement(2704102..2707154)
                     /locus_tag="BRARA_H00294"
                     /db_xref="Phytozome:Brara.H00294"
     mRNA            complement(join(2704102..2704445,2704514..2704681,
                     2704760..2704930,2705002..2705117,2705211..2705507,
                     2705830..2705908,2705984..2706092,2706165..2706206,
                     2706276..2706406,2706495..2707154))
                     /locus_tag="BRARA_H00294"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00294"
     CDS             complement(join(2704302..2704445,2704514..2704681,
                     2704760..2704930,2705002..2705117,2705211..2705507,
                     2705830..2705908,2705984..2706092,2706165..2706206,
                     2706276..2706406,2706495..2707028))
                     /locus_tag="BRARA_H00294"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49495.1"
                     /db_xref="Phytozome:Brara.H00294"
                     /translation="MGGCTSKPSTSGRPDNPFFPGNDYPLIDNSTPTNPTPSAAKASP
                     FFPFYTPSPARHRRNKSRDVTGGESKSVTSTPLRQLRRAFNPPSPAKHIRAALRRRKG
                     KKEAALAAEATEAPPQEEGEELGLDKRFGFAKDFHSRVELGDEIGRGHFGYTCSAKFR
                     KGELKGQVVAVKIIPKSKMTSAIAIEDVRREVKILQALSGHKNLVQFYDAFEDNANVY
                     IAMELCEGGELLDRILARGGKYSEDDAKPVIIQILNVVAFCHLQGVVHRDLKPENFLY
                     TSKEENSQLKAIDFGLSDFVKPDERLNDIVGSAYYVAPEVLHRSYTTEADVWSIGVIA
                     YILLCGSRPFWARTESGIFRAVLKADPSFDEAPWPFLSSEAKDFVKRLLFKDPRRRMS
                     ASQALMHPWIRGYDRDMNVPFDILIFRQMKAYLRSSSLRKAALRALSKTLITDEIIYL
                     KTQFSFLSPNKDGFITLGSIRSSLSSNATDEMKETRIPEFLALLNGLHHRGMDFEEFC
                     AAAINVHQHESLDCWEESIRHAYELFERNGNRAIVIEELASELGVGPAITVHSVLHDW
                     IRHTDGKLSFFGFAKLLHGVSVRPSVKTTR"
     gene            complement(2711681..2714622)
                     /locus_tag="BRARA_H00295"
                     /db_xref="Phytozome:Brara.H00295"
     mRNA            complement(join(2711681..2712314,2713415..2713580,
                     2713704..2713895,2714253..2714622))
                     /locus_tag="BRARA_H00295"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00295"
     CDS             complement(join(2711899..2712314,2713415..2713580,
                     2713704..2713895,2714253..2714588))
                     /locus_tag="BRARA_H00295"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49496.1"
                     /db_xref="Phytozome:Brara.H00295"
                     /translation="MDRKIFSYWFITHLALLSLLFNDVVSSFPSEYNDGPKNGYNNGY
                     NNGHNGGYNNGHGSRGYGMISNLDYRFYDRSCPRLQMMVKSGVWRAFKDDSRIAASLL
                     RLHFHDCFVNGCDGSILLDDSEDFKGEKNALPNRNSVRGFDVIEDIKTDIESACPLTV
                     SCADIVALAAREAVVLTGGPYWPVPLGRRDSLTASEQAANTNLPSPFEPLENITAKFV
                     SLGLDFKDVVVLSGAHTIGFAQCFVFKHRLFNFKGSGQPDPNLAASSDLLSKLTDTCP
                     NVDSSNSNLAALDAASVVKFDNAYYVNLMNNVGLLDSDQILMSDSNAAALVKSYSENP
                     YLFSRDFAVSMVKMGKIGVMTGSDGVIRAKCGFPG"
     gene            complement(2730807..2731492)
                     /locus_tag="BRARA_H00296"
                     /db_xref="Phytozome:Brara.H00296"
     mRNA            complement(2730807..2731492)
                     /locus_tag="BRARA_H00296"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00296"
     CDS             complement(2731030..2731347)
                     /locus_tag="BRARA_H00296"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49497.1"
                     /db_xref="Phytozome:Brara.H00296"
                     /translation="MMGNWRKKRDDEKGLVWKLFEDIGNVGPALGLGAGCGFGFGAGL
                     TGGYGPGLPKLQFGVGFGTGCGIGVGLGFGVGRGAVFDHARAFNNVVDYLWWKLIGFA
                     QSP"
     gene            <2739001..>2740206
                     /locus_tag="BRARA_H00297"
                     /db_xref="Phytozome:Brara.H00297"
     mRNA            join(<2739001..2739451,2739632..>2740206)
                     /locus_tag="BRARA_H00297"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00297"
     CDS             join(2739001..2739451,2739632..2740206)
                     /locus_tag="BRARA_H00297"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49498.1"
                     /db_xref="Phytozome:Brara.H00297"
                     /translation="MVSVWFVLVALTIISINLKIFQVTSHVTLNGQSIFDYHQKWMIQ
                     FSKVYKDDFEKEMRLKVFKKNLIFIENFNNMGNQSYKLGVNEFTDMTKEEFLATYTGG
                     LQSINVTSLPEVVDQTMSSRKLNFSELLFVKDWRIEGAVTPVKNQRSCGSCWAFSSVA
                     AVEGLTKISGNNLVSLSEQQLVDCTNGCNAGRIDQAFDYMIKNGGISSDSEYPYQAKS
                     GQCRSDARPAIMIKGYERVPFNNENALLDAVLRQPVSVDIDARTDSFRHYKEGVFDAR
                     DCGIDVNHSVALVGYGVTEDGIKYWLVKNSWGENWGEKGYMRIRRMVEWPEGMCGVAQ
                     YAFYPVV"
     gene            <2762667..>2763355
                     /locus_tag="BRARA_H00298"
                     /db_xref="Phytozome:Brara.H00298"
     mRNA            join(<2762667..2763111,2763186..>2763355)
                     /locus_tag="BRARA_H00298"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00298"
     CDS             join(2762667..2763111,2763186..2763355)
                     /locus_tag="BRARA_H00298"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49499.1"
                     /db_xref="Phytozome:Brara.H00298"
                     /translation="MVSVLSVFVALTIISINLMTFQASYNVTLNEKSISDYYQKWMIQ
                     FSKVYKDNFEKEMRFKVFKKNLIFIENFNNMGNQSYKLGVNEFTDMTKEEFLATYTGR
                     LRGINITSLPKVVDQSMSSRKLNFSELFYALLDSVLRQPISVDIDSIVLVGYGVTDDG
                     IMYWLAKNSWGENWGEQGYMRIRRMVEWPEGMCGLSQYANYPVV"
     assembly_gap    2776914..2786913
                     /estimated_length=unknown
                     /gap_type="between scaffolds"
     assembly_gap    2787798..2797797
                     /estimated_length=unknown
                     /gap_type="between scaffolds"
     gene            2809126..2809581
                     /locus_tag="BRARA_H00299"
                     /db_xref="Phytozome:Brara.H00299"
     mRNA            2809126..2809581
                     /locus_tag="BRARA_H00299"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00299"
     CDS             2809213..2809404
                     /locus_tag="BRARA_H00299"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49500.1"
                     /db_xref="Phytozome:Brara.H00299"
                     /translation="MVTMKLEICIELVKLTVDFVAAVAESIEVAFRNRPPPPIPHLAV
                     RNGRRSNHSAIPIPLVGFL"
     gene            2810969..2813501
                     /locus_tag="BRARA_H00300"
                     /db_xref="Phytozome:Brara.H00300"
     mRNA            2810969..2813501
                     /locus_tag="BRARA_H00300"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00300"
     CDS             2811043..2813277
                     /locus_tag="BRARA_H00300"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49501.1"
                     /db_xref="Phytozome:Brara.H00300"
                     /translation="MDKPLGTFFILLLISPIVVATINEETSFPENAHLINNLDQKCVD
                     IIKVDPSLKFENDRLKRAYIALQAWKKAIYSDPFKTTKNWVGPDVCSYNGVYCAEALD
                     DPSLKVVAGVDLNHADIAGHLPAELGLITDLAMFHINSNRFCGIIPKSLSKLALMYEF
                     DVSNNRFVGSFPEVSLSWPSLKFLDLRYNEFEGCLPSEIFDKNLDAIFLNNNRFESVI
                     PDTIGKSAASVVTFANNKFSGCIPRSIGQMKNLNEVIFTGNNLTGCFPNEIGSLNNVT
                     VFDASNNGFIGSLPLTLSSLSRVEQLDLSNNKLTGSVVDTFCKLPNLERFKFSYNYFN
                     GEAESCVHGKNNGKQFDDRSNCLKNRPDQKSVNQCVPVVSRPVDCSKDKCSGGSQRGS
                     PPSIKTPEIIPPKPKELVIPKPEESPKPEPQNPLRPETPTTNVQQPIPEHEPPKHESP
                     KPENRTNKPEQPKPETPKPQQPKSEESPKPEQPKINPPEQKESPKNSETPEPVSPPKE
                     DPYNASPVKNRRPPPPPPPKVKEIQVPPPQPPMPSSPPPPVYSSPPPPAPVNSPPPPV
                     ASPPPPSPPPPVNSPPPPPIFSPPPPSPVYSPPPPIHSPPPPPIFSPPPAHIIIQPPI
                     QAPTPVQAPSSESDQSPVSSPIQSPTPIQSPTPSSVLDQPTIDAQSPGQSPTPLNEPA
                     SSPKEAEDRDAPEPSLSTPSPSPSPSENVAPPPENNNHSDLNLPPHIGFEYGSPPPPM
                     FPGY"
     gene            2819939..2821880
                     /locus_tag="BRARA_H00301"
                     /db_xref="Phytozome:Brara.H00301"
     mRNA            join(2819939..2820210,2820747..2821014,2821092..2821291,
                     2821358..2821880)
                     /locus_tag="BRARA_H00301"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00301"
     CDS             join(2820786..2821014,2821092..2821291,2821358..2821606)
                     /locus_tag="BRARA_H00301"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49502.1"
                     /db_xref="Phytozome:Brara.H00301"
                     /translation="MDSTHSEFNKRARLFEDHQNKDAKVIHPMIPESTTPLDKGYDAS
                     TTTQNLFTESKPEVATPKVLKKRGRKKKNPNPEEVNSSTPRGDDSENRSKFYESASAR
                     MRTVTAEERERAITAAKAYEPTNPFFRVVLRPSYLYRGCIMYLPSGFAEKYLSGISGF
                     IKIQLGEKQWPVRCLYKAGRAKFSQGWYEFTLENNIGEGDVCVFELLSTRDFVLKVTA
                     FRVNQYV"
     gene            complement(2822282..2823391)
                     /locus_tag="BRARA_H00302"
                     /db_xref="Phytozome:Brara.H00302"
     mRNA            complement(join(2822282..2822528,2822615..2823053,
                     2823176..2823391))
                     /locus_tag="BRARA_H00302"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00302"
     mRNA            complement(join(2822282..2822528,2822615..2823056,
                     2823176..2823391))
                     /locus_tag="BRARA_H00302"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00302"
     CDS             complement(join(2822524..2822528,2822615..2823053,
                     2823176..2823310))
                     /locus_tag="BRARA_H00302"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49504.1"
                     /db_xref="Phytozome:Brara.H00302"
                     /translation="MNTTRRASARITSAASQRRQKPEPEPAVKKFIKVILPSTIKEKM
                     MIPARFVRLGPKLTDTVTIQTPVGFKRSIGIKRTGNEVWFDNGWSEFAEAHSISEGHF
                     LYFCSEGNSSFRVMIFDVSASEIDYPMDKVHVIESDDDEVMEVMDTDDGEGFTRVDSS
                     DNDSSDEEAIDLEKLLKKKPRVNVKFETINID"
     CDS             complement(join(2822524..2822528,2822615..2823056,
                     2823176..2823310))
                     /locus_tag="BRARA_H00302"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49503.1"
                     /db_xref="Phytozome:Brara.H00302"
                     /translation="MNTTRRASARITSAASQRRQKPEPEPAVKKFIKVILPSTIKEKM
                     MKIPARFVRLGPKLTDTVTIQTPVGFKRSIGIKRTGNEVWFDNGWSEFAEAHSISEGH
                     FLYFCSEGNSSFRVMIFDVSASEIDYPMDKVHVIESDDDEVMEVMDTDDGEGFTRVDS
                     SDNDSSDEEAIDLEKLLKKKPRVNVKFETINID"
     gene            complement(2829020..2830172)
                     /locus_tag="BRARA_H00303"
                     /db_xref="Phytozome:Brara.H00303"
     mRNA            complement(2829020..2830172)
                     /locus_tag="BRARA_H00303"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00303"
     CDS             complement(2829119..2830018)
                     /locus_tag="BRARA_H00303"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49505.1"
                     /db_xref="Phytozome:Brara.H00303"
                     /translation="MGTFLGHFVPGLSLALLGLWHLFNIIRSYCLKGPETFSAKFWFP
                     FPKLKHLELVLILFFSFFAIILLTIDFPDFNFSSFKPDNLEHASMFLHLIIFACFALF
                     CELTLSSDLFSGIIGILSASVFAQELFLLHFHSTDHLGLEGHYHFLLQLIAFVSFSSA
                     LASASFPKSFSAALVLSVSVMFQGCWFLNMGFMLWVPRYVPRGCVSNTTASDNRSFVH
                     SSAVACESPGAEVRAKALANLQFSWILSAILIITCALCFKFSCKVMLPKNRSSSEYER
                     LCRQGSDRSPALTVEVSPNSDQK"
     gene            complement(2836531..2838432)
                     /locus_tag="BRARA_H00304"
                     /db_xref="Phytozome:Brara.H00304"
     mRNA            complement(2836531..2838432)
                     /locus_tag="BRARA_H00304"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00304"
     CDS             complement(2836918..2838321)
                     /locus_tag="BRARA_H00304"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49506.1"
                     /db_xref="Phytozome:Brara.H00304"
                     /translation="MAIQDNHSHNDHYRRLTFASFLKSDSLSTGDEAYHTDGDHNHND
                     NKDAISTNSDSQRPSNASTSDSPIYPLSPWNQTYYPPNDNTTAFSSTNQSPWNQTCSP
                     YHKSPWIYQTRNSDFEDDPDNGLVGTIVRQEGHVYSLAASGDLLFTGSDSKNVRVWKD
                     LKDLSGFKSTSGFVKAIVITGDNRVFTGHQDGKIRVWRGSKRNPERYSRVGSLPTLKE
                     FLTKSVNPKNYVETRRKKNKLKIRHFDAVSCLTVNEDLGLLYSGSWDKTLKVWRLSDS
                     KCLESIEAHDDAVNTVVAGFDDLVFTGSADGTLKVWKRELQGKETKKHVLVHVLMKQE
                     SAVTALAVNLNDAVVYCGSSDGSVNFWERKKYLTHGGTIHGHRMAVLCLTSAGSLLLS
                     GGADNNICVWRRNGDGSHTCLSVLMDHDGPVKCLTAVEEAQDDVDDGDKADQRWIVYS
                     GSLDRSVKVWRVTDYAS"
     gene            complement(<2867144..>2868208)
                     /locus_tag="BRARA_H00305"
                     /db_xref="Phytozome:Brara.H00305"
     mRNA            complement(<2867144..>2868208)
                     /locus_tag="BRARA_H00305"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00305"
     CDS             complement(2867144..2868208)
                     /locus_tag="BRARA_H00305"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49507.1"
                     /db_xref="Phytozome:Brara.H00305"
                     /translation="MQSNEEFVKFLGEGAYGYVNLVRYTNPDDGSSFLSAVKNSYDAD
                     YDTLQKELEILLKLRGCPRIVTCFGDSLRQGLSNYGNKVHKLQLEYASEGSLSAFMDR
                     YADRKLPEPLIKDFTRMILEGLVSIHDHGYVHCDIKPDNLLVFPSRQDSYELKISDFG
                     NTLEVGEVPKFWESEFPWVGTPIYMPPESVRDGFANKGIDLWSVGCLVLEMYTGVIPW
                     EGVNINLLATRLRCGKAPEIPENLPSDAKAFIETCFSRNPEERGSACELLLHPFLPRP
                     QIEEEEKKTKNSFLLKLFKLRIRRTSSNKIPTADVVAVSDKKPLKLRFFPTKTTQFKR
                     TLHKVLRLKKSTHFNLVSVH"
     gene            2869840..2871152
                     /locus_tag="BRARA_H00306"
                     /db_xref="Phytozome:Brara.H00306"
     mRNA            join(2869840..2870081,2870872..2871152)
                     /locus_tag="BRARA_H00306"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00306"
     CDS             2869902..2870066
                     /locus_tag="BRARA_H00306"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49508.1"
                     /db_xref="Phytozome:Brara.H00306"
                     /translation="MFSGMFMEKPDKAVALKQLRTHVALFGGWVVAIRAVPYVLSYFS
                     DSKEELKLDF"
     gene            2886722..2888017
                     /locus_tag="BRARA_H00307"
                     /db_xref="Phytozome:Brara.H00307"
     mRNA            join(2886722..2887088,2887156..2887288,2887377..2888017)
                     /locus_tag="BRARA_H00307"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00307"
     CDS             join(2886958..2887088,2887156..2887288,2887377..2887568)
                     /locus_tag="BRARA_H00307"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49509.1"
                     /db_xref="Phytozome:Brara.H00307"
                     /translation="MVEVPGSVGTSASLSLRLGQTFLAFGALLFMTIGVRFYQFTAFC
                     YLVTIMALAIPWNLTLAMVDIYCVLLNQPFQKPRILLAISIGDWVVSVLALASASSAA
                     SVVDLLRSDESVCPPTICNRYQFAATLAFLTWFLSLSSSLFNLWLLPSL"
     gene            complement(<2889840..2892194)
                     /locus_tag="BRARA_H00308"
                     /db_xref="Phytozome:Brara.H00308"
     mRNA            complement(join(<2889840..2889932,2890041..2890124,
                     2890197..2890353,2890457..2890722,2890812..2891084,
                     2891275..2891386,2891472..2891691,2891759..2892194))
                     /locus_tag="BRARA_H00308"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00308"
     CDS             complement(join(<2889840..2889932,2890041..2890124,
                     2890197..2890353,2890457..2890722,2890812..2891084,
                     2891275..2891386,2891472..2891691,2891759..2892095))
                     /locus_tag="BRARA_H00308"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49510.1"
                     /db_xref="Phytozome:Brara.H00308"
                     /translation="MIVTLNPKILHFSKLNPQCPRPRPSPRFHRTTNCKLQNPQDANK
                     TGGITKTISLSDSAPPVTEEGSAKGGGNGGGGGGGGFLKRLPRKVLSVLSNLPLAITE
                     MSTIAALMALGTVIEQGETPEFYFEKYPEDSPVLGFFTWRWIFALGFDHMYSAPIFLG
                     MLALLAASLMACTYTTQIPLVKVARRWSFMKSDESIKKQDFAESLPRASIQDLGVILM
                     GDGYEVFMKGPSLYAFKGLAGRFAPIGVHIAMILIMVGGTLSATGSFRGSVTVPQGLN
                     FVMGDVLAPIGFLSVPTDSFNTEVHVNRFTMDYYDSGEVSQFHSDLSLRDLNGKEVVR
                     KTISVNDPLRYGGVTIYQTDWSFSALQVSKDGEGPFNLAMAPIKINGDKKLYGTFLPV
                     GDTNAPNVKGISMLARDLQSIVVYDLEGKFAGIRRPNSKLPIEIDGMKIVIEDAIGST
                     GLELKTDPGVPVVYAGFGALMLTTCISYLSHSQIWALQNGTTLVVGGRTNRAKNEFPD
                     DMNRLL"
     gene            complement(<2914847..>2915908)
                     /locus_tag="BRARA_H00309"
                     /db_xref="Phytozome:Brara.H00309"
     mRNA            complement(<2914847..>2915908)
                     /locus_tag="BRARA_H00309"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00309"
     CDS             complement(2914847..2915908)
                     /locus_tag="BRARA_H00309"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49511.1"
                     /db_xref="Phytozome:Brara.H00309"
                     /translation="MDDESRRGNLRRRARQINGEDVDRPTNRRRQNELQNDGVQAGDH
                     VEPLPLELSLGSTSHSSQIPPMTTSSLPLAPPSPFALPLTTSSLPLAPASPFAPPMTT
                     WQTSGSIAQYFASSQSHYMTYPPYLSNSIYQTRPSTPMQPPFGQSFNLFPSSSFVPTR
                     PVMRPAASGAVSRRSYRSQSSVNRNDDTIPPPFPWATNKRGWIQSLENLASKQITTIT
                     GEVQCKHCEKVYQVSYNLREKFSEVENIFVMGKWIMRERAPPIWTNPEPARCDLCGRD
                     KAVKPVIAERKYQINWLFLLLGQTLGFCTLEQLKNFCKHSRSHRTGAKNRVLYLTYLG
                     LCKMLEPNRELFQRETARR"
     gene            complement(2925522..2926902)
                     /locus_tag="BRARA_H00310"
                     /db_xref="Phytozome:Brara.H00310"
     mRNA            complement(join(2925522..2926395,2926805..2926902))
                     /locus_tag="BRARA_H00310"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00310"
     CDS             complement(join(2925610..2926395,2926805..2926867))
                     /locus_tag="BRARA_H00310"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49512.1"
                     /db_xref="Phytozome:Brara.H00310"
                     /translation="MASLRFSVTFPALLSLLLLSLWVVEAYTSRKLISNNEQEGQNIS
                     HLFKDGEFEDPTMYMFFKISDLKLGTKLPIYFNKNDLRKVPPLLTRQEADLIPFSESN
                     LDFLLNHFSISKDSPQGKAMKETLKRCDFKAIEGEYKFCGTSLESMLDLAKKTIASNA
                     DLKVMTTKVMVPDQNRISYALHNYTFAEVPKELDGIKVLGCHRMPYPYVVYYCHGHKS
                     GTKVFEVNLMSDDGIQLVVGPAVCHMDTSMWNADHVAFKVLKIEPRSAPVCHFFPLDN
                     IVWVSK"
     gene            2941611..2942277
                     /locus_tag="BRARA_H00311"
                     /db_xref="Phytozome:Brara.H00311"
     mRNA            join(2941611..2941802,2941904..2942277)
                     /locus_tag="BRARA_H00311"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00311"
     CDS             join(2941746..2941802,2941904..2942092)
                     /locus_tag="BRARA_H00311"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49513.1"
                     /db_xref="Phytozome:Brara.H00311"
                     /translation="MKQQRFLVAFFVVLFSFLLFVYLSEGKSEVAEDYWKKMMKSEPL
                     PEPIKDILNNPFRTGQERFAKNFNTKSVVIIYHNPNV"
     gene            complement(2945876..2947520)
                     /locus_tag="BRARA_H00312"
                     /db_xref="Phytozome:Brara.H00312"
     mRNA            complement(join(2945876..2946134,2946213..2946439,
                     2946514..2946660,2946802..2946901,2947023..2947049,
                     2947331..2947520))
                     /locus_tag="BRARA_H00312"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00312"
     CDS             complement(join(2946068..2946134,2946213..2946439,
                     2946514..2946660,2946802..2946901,2947023..2947049,
                     2947331..2947383))
                     /locus_tag="BRARA_H00312"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49514.1"
                     /db_xref="Phytozome:Brara.H00312"
                     /translation="MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGAD
                     FLTKEVHYEDRLFTLQIWDTAGQERFQSLGVAFYRGADCCVLVYDVNSAKSFEDLNNW
                     REEFLIQASPSDPENFPFVVIGNKIDVDGGNSRVVSEKKARAWCASKGNIPYYETSAK
                     EGTNVEDAFMCITKNAMKSGEEEEMYMPDTIDVGTSNPQRSTGCEC"
     gene            complement(<2949005..>2949595)
                     /locus_tag="BRARA_H00313"
                     /db_xref="Phytozome:Brara.H00313"
     mRNA            complement(<2949005..>2949595)
                     /locus_tag="BRARA_H00313"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00313"
     CDS             complement(2949005..2949595)
                     /locus_tag="BRARA_H00313"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49515.1"
                     /db_xref="Phytozome:Brara.H00313"
                     /translation="MADHDEEETHHHQRPPYIPKETAVQALNTIIQLHFEKTLEKKRA
                     IDNQKKKLHNLFTLFFIFLAVVFASLSQPSSRLQCRHCWAPICFLSFSHLIFYISVAQ
                     TLRCINGFKYQRRCHKLTLGLATEKLRFVKTVAATAVGEEEISAAAAAGDLEVPYQEP
                     SESYLGKFKRNWALYFGFLILLYAFLVSFSVVVLCF"
     gene            complement(<2952053..>2952286)
                     /locus_tag="BRARA_H00314"
                     /db_xref="Phytozome:Brara.H00314"
     mRNA            complement(<2952053..>2952286)
                     /locus_tag="BRARA_H00314"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00314"
     CDS             complement(2952053..2952286)
                     /locus_tag="BRARA_H00314"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49516.1"
                     /db_xref="Phytozome:Brara.H00314"
                     /translation="MSSRSSSSSAREVELQKEAKRHEVALDELSCLSSSRSVYQKNGN
                     LFFLTTAKKVKIDAEKQLDHAKSELAKIRSQTR"
     gene            <2955811..>2956555
                     /locus_tag="BRARA_H00315"
                     /db_xref="Phytozome:Brara.H00315"
     mRNA            join(<2955811..2956026,2956028..>2956555)
                     /locus_tag="BRARA_H00315"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00315"
     CDS             join(2955811..2956026,2956028..2956555)
                     /locus_tag="BRARA_H00315"
                     /artificial_location="low-quality sequence region"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49517.1"
                     /db_xref="Phytozome:Brara.H00315"
                     /translation="MSKLGNTLLSRLVIYLLVLPLLVSAAAEEENDFSCSVPVNSATT
                     LKYKIIAIFSTLIVGVFGVCSPIFGLDLLKISNYFSLVTGSICLIAPFLHILPDAIES
                     LTSSCLGDEPAWGDFPMVGVVSMSAMILTMIESFASSYMKRLKSIAFENKEEENKKGD
                     LIHVHNQRQHDHNNIRRKLLTHVLESGIVVHLIIVGIALGASSSVSTIKPFIGAITIR
                     QLLEGVRLGRCIRLFKRCSCRNIILHGDF"
     gene            2957242..2958085
                     /locus_tag="BRARA_H00316"
                     /db_xref="Phytozome:Brara.H00316"
     mRNA            2957242..2958085
                     /locus_tag="BRARA_H00316"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00316"
     CDS             2957807..2958022
                     /locus_tag="BRARA_H00316"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49518.1"
                     /db_xref="Phytozome:Brara.H00316"
                     /translation="MRAAVWLLSASDGAKLEHIKAHLIIELSPSEQRNAHKRTDRTIT
                     TFASKLLSSTYGDGVGLGDCSSSNLLE"
     gene            complement(<2962099..>2962779)
                     /locus_tag="BRARA_H00317"
                     /db_xref="Phytozome:Brara.H00317"
     mRNA            complement(<2962099..>2962779)
                     /locus_tag="BRARA_H00317"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00317"
     CDS             complement(2962099..2962779)
                     /locus_tag="BRARA_H00317"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49519.1"
                     /db_xref="Phytozome:Brara.H00317"
                     /translation="MSANELPSSAQAFQEQLLGGFVSRKLLMHNLFDHNTLRALAVPP
                     SPPVTHENNLSETVLMLLSVLICGIICCLVLHYIIRCAFRSCSSFMISDSTSIFLTPH
                     SSSNKGIKKKALKMFPVVSYTHEMNLSGIGEECVICLSDFVCDEKLRLLPKCNHGFHV
                     RCIDKWLQQHLTCPKCRHCLVETCQKILGDSSQADQVTETASTESVFVRISPLEPEGR
                     VNTFRESS"
     gene            complement(<2965018..>2965689)
                     /locus_tag="BRARA_H00318"
                     /db_xref="Phytozome:Brara.H00318"
     mRNA            complement(<2965018..>2965689)
                     /locus_tag="BRARA_H00318"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00318"
     CDS             complement(2965018..2965689)
                     /locus_tag="BRARA_H00318"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49520.1"
                     /db_xref="Phytozome:Brara.H00318"
                     /translation="MSANKLPSSAQEFQELVRGGFVSRKLLLHNPFDHNPQGAFAVAP
                     SPHITDENNLSGNVLMLLSVLVCGVICCLGLHYIIRCAFRRSPSFMISEPVSSIPTRR
                     GSPNKGIKKKALNMFPVVTYSREMNLPGLGEECVICLSDFVCGEKLRLLPKCNHGFHV
                     RCIDKWLKQHLTCPKCRHCLVETCQKILGDSSQVTATAPTESLTVRIAPLEPEGRVNT
                     YREST"
     gene            complement(<2986934..>2988668)
                     /locus_tag="BRARA_H00319"
                     /db_xref="Phytozome:Brara.H00319"
     mRNA            complement(join(<2986934..2987371,2987465..2987553,
                     2987640..2988134,2988235..2988387,2988491..>2988668))
                     /locus_tag="BRARA_H00319"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00319"
     CDS             complement(join(2986934..2987371,2987465..2987553,
                     2987640..2988134,2988235..2988387,2988491..2988668))
                     /locus_tag="BRARA_H00319"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49521.1"
                     /db_xref="Phytozome:Brara.H00319"
                     /translation="MSIAHITEAGDKALFLQQETSEINSPLNEFPPSTNVLVVDANLS
                     TLLDMKEIMERCAYHVTAYADSEEAIAFLTKCKHEINIVIWDYHMPGINGLQALAIIG
                     SKMDLPVVIMSGDDQTESVMNAMVHGACHYVMKPVRKEIIATIWQHIVRKRMMSKPGL
                     VPPVVVHGDCSKQEKDDSVTVDQDDSEESIDKIEEKATQKQTMICIEETQPMQSHLVK
                     SNGSDQDDDDSRSVRNYNYEQSIDKKKERYLKRPRISWTGDLQQKFLEAIDIVGGPKT
                     EASPKVLLKCLHDMNIEGLTRNNVSSHLQKYRLSLEENKIPQQFPETGWSSLSRPSPF
                     LGMNNGFIAPTSLRNWPAVYPVQDNQYQNGYLAINNNQFVTNNMPGFPYSENDHHLQQ
                     QHQQRQYQLSNHVMNYMMRNEPQQAYNSIGLTDLEPNIYPSLPYDPNEFLFDGYNFSN
                     "
     gene            3002330..3004491
                     /locus_tag="BRARA_H00320"
                     /db_xref="Phytozome:Brara.H00320"
     mRNA            join(3002330..3002710,3002780..3002838,3003227..3003291,
                     3003380..3003473,3003548..3003628,3003701..3003812,
                     3003901..3004491)
                     /locus_tag="BRARA_H00320"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00320"
     CDS             join(3002380..3002710,3002780..3002838,3003227..3003291,
                     3003380..3003473,3003548..3003628,3003701..3003812,
                     3003901..3003953)
                     /locus_tag="BRARA_H00320"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49522.1"
                     /db_xref="Phytozome:Brara.H00320"
                     /translation="MDEYKAKSKLSESSTSTVWLAKHMLTGEEAVMKCFDLSKLNHNL
                     RICLENELDFLSSVDHPNIIRLLQVLQEKDLLVMILEYCDGGTLSSYIKRHGRVQQHI
                     ARRFMKQIGAGLEIIHDNHIIHRDLKPENILLAGSGDESVLKIADFSISRKLLPGKYL
                     ETVCGSPFYMAPEVLQFQRYNEKADMWSVGAILFELLHGYPPFSGRNNVQVLRNIKSS
                     LSCPFSRLIVQQLHPDCIDVCSRLLSTNPVTRLSFDEFYKHKFLSI"
     gene            <3014239..>3018255
                     /locus_tag="BRARA_H00321"
                     /db_xref="Phytozome:Brara.H00321"
     mRNA            join(<3014239..3014370,3015323..3015548,3015633..3015878,
                     3015954..3016004,3016088..3016147,3016211..3016348,
                     3016446..3016613,3016698..3016952,3017148..3017670,
                     3017733..>3018255)
                     /locus_tag="BRARA_H00321"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00321"
     CDS             join(3014239..3014370,3015323..3015548,3015633..3015878,
                     3015954..3016004,3016088..3016147,3016211..3016348,
                     3016446..3016613,3016698..3016952,3017148..3017670,
                     3017733..3018255)
                     /locus_tag="BRARA_H00321"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49523.1"
                     /db_xref="Phytozome:Brara.H00321"
                     /translation="MAEIGEREETIEGRNVGAMWDLEQKLDQPMDEEAHKLKNMQKEK
                     GLSTLMLLRLAFQSLGIVYGDLGTSPLYVFYNTFPDGINDTEDVIGALSLIIYSLLLI
                     PLIKYVFIVCKANDNGQGGTLAIYSLLCRNGKLKLIPDQQRSDQELTTYGRTFLPEGS
                     MAAKTMNWLEKKDSRKRALLIIVLVGTCMTIGDGIFTPAISVLSATGGIKVNNPQMSS
                     DTVVIVAVLILVGLFSMQQYGTGLYNICIYDTSVLKAFSPTYVYMYFRRRGRDGWVSL
                     GGILLSITGTEALYDDIAYFPLLAIQLAFTLFVFPCLLLAYCGQAAYLVKNKDNYANA
                     FYESIPDSIYWPMFIVATGAAVVGSQATISGTYSIIKQAVAHGCFPPVKVVHTSKKFL
                     GQIYSPDINWILMVGCIAVTARFKNQNQIGNAYGTAVAVVMLVTTVLMVLLMLLVWRC
                     NWFLILVFTVLSLMVEGAYFSAVLLKVNQGGWLPLVIAAVLLVVMLVWNYVKIKRYEF
                     QVHSKVSMSWIISLGPSLGLVRVPGIGIVYSELASGVPHIFSHVITNLPAIHSVVVFV
                     CVKYLPVYTVPEEERFLVKRIGSKTFRMFRCVARYGYKDLQKKDDDFENKLFNNLFSF
                     IQMERMMEPVSNSSNSSSASICSQPHQSREVLINNNDMDMFSSMVDYTVSTLDTIIPL
                     DIPINAASYYPDRAVGEEETNELEFLKSGRDSGVVHIQGNTVVKARRNSSLPKKIAIN
                     YVYAFLKKICRGNNVIFNVPHESLLNVGQVFYV"
     gene            complement(3021483..3022773)
                     /locus_tag="BRARA_H00322"
                     /db_xref="Phytozome:Brara.H00322"
     mRNA            complement(join(3021483..3022135,3022228..3022773))
                     /locus_tag="BRARA_H00322"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00322"
     CDS             complement(join(3021649..3022135,3022228..3022727))
                     /locus_tag="BRARA_H00322"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49524.1"
                     /db_xref="Phytozome:Brara.H00322"
                     /translation="MPTTRLTQRREKKKNRESERVKRLKQNLMESVAVTWSREEEKSF
                     ENAIAMHCVEEEITEDQWMKMASMVPTKSLQEVKNHYQMLLEDVKAIESGQVPLPRYQ
                     RTGEEAAATSPANRDCHSSGGGGSTEKKPNHGVSGISSSNGGGRSSSKLEQERKKGIP
                     WTQEEHRLFLLGLEKFGKGDWRSISRNYVITRTPTQVASHAQKYFIRLNSMNRDRRRS
                     SIHDITSVNNQAPAVTGQQQQQQQVVKHRPAQPQPQPQHHTMAGLGMYGGAPVGQPII
                     APPDHMGSAVGTPVMLPPPMGTHHHIGVAPYAVPSYPVPPLPQQHPAPSTMH"
     gene            complement(<3028111..>3028620)
                     /locus_tag="BRARA_H00323"
                     /db_xref="Phytozome:Brara.H00323"
     mRNA            complement(join(<3028111..3028380,3028444..>3028620))
                     /locus_tag="BRARA_H00323"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00323"
     CDS             complement(join(3028111..3028380,3028444..3028620))
                     /locus_tag="BRARA_H00323"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49525.1"
                     /db_xref="Phytozome:Brara.H00323"
                     /translation="MDHMKELIAVHKPIMLDGSNFGDWKVKIRYIICGIDEEAWASIF
                     NGWTERTLMNEKRKQAISTIFSTVYIDQFKIIQYCESAKDSWNTLVNYFEGDSSVKRT
                     RLDHLETKWENLRMEEDEPLGSFTNKLNMIENEAAVLGEKYKKEAC"
     gene            <3038503..>3038805
                     /locus_tag="BRARA_H00324"
                     /db_xref="Phytozome:Brara.H00324"
     mRNA            <3038503..>3038805
                     /locus_tag="BRARA_H00324"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00324"
     CDS             3038503..3038805
                     /locus_tag="BRARA_H00324"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49526.1"
                     /db_xref="Phytozome:Brara.H00324"
                     /translation="MKKHPKPCSFLFHISLLSVLFVFLLVSFAFTTSYTRKSGIGLSH
                     KRILASNFDFTPFIKIKDRTQRQRRRRSQSLAGEETGSWYNDEERLVPSGPNPLHH"
     gene            3050782..3051334
                     /locus_tag="BRARA_H00325"
                     /db_xref="Phytozome:Brara.H00325"
     mRNA            3050782..3051334
                     /locus_tag="BRARA_H00325"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00325"
     CDS             3050809..3051099
                     /locus_tag="BRARA_H00325"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49527.1"
                     /db_xref="Phytozome:Brara.H00325"
                     /translation="MRSPRPKEFLMTLSHKAMTMVGRKNTCYSGGYKPEKKRAGAMEE
                     EEEHGLWQREILMGGKCEPLDFSGVIYYDCNGRQLRDAPPRSPRRTPLPIRS"
     gene            complement(<3051956..>3052456)
                     /locus_tag="BRARA_H00326"
                     /db_xref="Phytozome:Brara.H00326"
     mRNA            complement(<3051956..>3052456)
                     /locus_tag="BRARA_H00326"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00326"
     CDS             complement(3051956..3052456)
                     /locus_tag="BRARA_H00326"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49528.1"
                     /db_xref="Phytozome:Brara.H00326"
                     /translation="MADRTSPSHIQQRPYGSTIAPPRGNNINHPIASFLRQLQSQSPE
                     HSRQRFGLLAFFISGGILLLLTGITVTAFVLGFIAFLPVIVISSPIWIPLFLLVTGFL
                     SVAGFLFSTAVVMSWMYRYFKGMHPVGSEQVDYARSRIYDTAAHVKDYAGGYFHGKLK
                     DAAPGA"
     gene            3065760..3068804
                     /locus_tag="BRARA_H00327"
                     /db_xref="Phytozome:Brara.H00327"
     mRNA            join(3065760..3066363,3066570..3066698,3066920..3067266,
                     3067350..3068094,3068183..3068279,3068356..3068410,
                     3068498..3068804)
                     /locus_tag="BRARA_H00327"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00327"
     CDS             join(3065826..3066363,3066570..3066698,3066920..3067266,
                     3067350..3068094,3068183..3068279,3068356..3068410,
                     3068498..3068560)
                     /locus_tag="BRARA_H00327"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49529.1"
                     /db_xref="Phytozome:Brara.H00327"
                     /translation="MDPRRGPLAVPKVRRVGFFTSIEPSPETPRPNRSLSGPAEAITS
                     SSPLSDSPSGQFISPVQIPPSRHHSDNLASRAAPVPVPGPSAFRRQLANDRALHVGSY
                     NPVDSLLGTSPPSSNGEVSEDSGSLFGFQRSDSAKLSASFPNGGFDMTMRVRAPQESE
                     AKVAIASTSDGRKKNVEASGEGESVAAKPRKEKETKSLKEKTSKAERRAIQEAQRAAK
                     AAAKGEGSKRAGESSRPKPSKPAKQPQPKKEAPQVTSSVSEKRAVSVEKERRMDVPQT
                     QMQYDDKSRVDKAKRRSVVEQTESKNKVELFLHLPQYERGNQLPNLSSNIFSLDTIHH
                     AVYKVGLQHLAGDIAGDNARCIAMLHAFQEAINDYTTPPMKDLTMDLTAKINGYVSFL
                     IECRPLSMSMGNAIRFLKNQIRKLPVDLSEPEAKASLCSEIGRFIDEKILLADKVIVQ
                     HAVTKIRDGEVLLTYGFSCVVEMILLYAHEIGRKFRVVIVDSRPNLEGQKLLRRLVTR
                     GLDCTYTHINAVSYIMGEVTRVFLGASSIFSNGTLYSKVGTACVAMVANAFSVPVIVC
                     CEAYKFHERVLLDSICSNELGDPDAIANVPLRNNKKHSKTMDNNKNLQFLNLMYDSTP
                     AEYISMIVTDYGMIPPTSIPVIVREYRREDLLL"
     gene            complement(3068991..3070268)
                     /locus_tag="BRARA_H00328"
                     /db_xref="Phytozome:Brara.H00328"
     mRNA            complement(join(3068991..3069266,3069426..3069611,
                     3069693..3069814,3069891..3070268))
                     /locus_tag="BRARA_H00328"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00328"
     CDS             complement(join(3069152..3069266,3069426..3069611,
                     3069693..3069814,3069891..3070118))
                     /locus_tag="BRARA_H00328"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49530.1"
                     /db_xref="Phytozome:Brara.H00328"
                     /translation="MGDVRRIVVVVEDKEAARTALQWALHNLFRQGDIIVLLHVISPP
                     PRKKKSTAARLLRRHGYHLALSFREICDAFFNTNTEIIVREGDEDGRTIAEVVKELGA
                     SMILVGLHQNSFLYRWAMSGIDVTRNLGCKVMAIKQPSSEESPPGKVKGRRMTSHTTA
                     TSDSLTNFDFSQIEISGLQVPEIRTPKVPYRLCPSPRAILWRTRPRRSKARYAVVS"
     gene            complement(3071953..3075132)
                     /locus_tag="BRARA_H00329"
                     /db_xref="Phytozome:Brara.H00329"
     mRNA            complement(join(3071953..3072245,3072549..3072724,
                     3072893..3073634,3073950..3074284,3074365..3074488,
                     3074560..3074782,3074896..3075132))
                     /locus_tag="BRARA_H00329"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00329"
     CDS             complement(join(3072159..3072245,3072549..3072724,
                     3072893..3073634,3073950..3074284,3074365..3074488,
                     3074560..3074782,3074896..3074990))
                     /locus_tag="BRARA_H00329"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49531.1"
                     /db_xref="Phytozome:Brara.H00329"
                     /translation="MAQDSEKRFHQIMNKLFTPSKSPLPSSPSSTSSPVEQQSRGKKR
                     PNPSSALALVEPKTALATTIDRSLKAPATGTSQSGLCRPWDRGDLMRRLASFKSMTWF
                     AKPQVISALNCARRGWVNADTDTISCESCGAHLYFSAPASWSKQQVEKAASVFSLKLD
                     NGHKLLCPWIENSCEETLSEFPSMTPQDLVDRHEERSEALLQLLALPVISPSAIDYMK
                     SSDLEEYLRRHIASGDTTAECSQTESLINHVGASPAQLFYQAQKLISLCGWEPRALPY
                     IVDCKDKSGEAAKGTDTIDLLPETATRELLSSSSSTSNPNGVSENSENPVVPDTLNSD
                     PSSVVLDCKLCGACVGLWVFSTVPRPLELCRVTGDTEVNTEKNSRDGTLQRQTSSLQF
                     TIAGGPPATKQNFKATISLPIVGRNLRSRFASYSRDRDHGTDNSIQDQQCRTPERNGG
                     GIENSDQDMIDVGEKADGGRNASDLVSNTTPQSKDKQLMVVTSSLPENYKPKDSTGDT
                     GKSNKQMEFDPINQHRHFCPWIWSTGRRGPGWRQTLSALQRQKGSCQTPPSPSSIFKV
                     DDPLTSVRNLFKSPSPKKARLNRGSSS"
     gene            complement(<3077209..3090199)
                     /locus_tag="BRARA_H00330"
                     /db_xref="Phytozome:Brara.H00330"
     mRNA            complement(join(<3077209..3077261,3078966..3079297,
                     3079344..3079624,3079699..3079819,3079905..3079990,
                     3080226..3080354,3080448..3080633,3080726..3080821,
                     3080927..3081052,3081108..3081191,3089492..3089572,
                     3089727..3089878,3089986..3090034,3090119..3090199))
                     /locus_tag="BRARA_H00330"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00330"
     CDS             complement(join(3077209..3077261,3078966..3079297,
                     3079344..3079624,3079699..3079819,3079905..3079990,
                     3080226..3080354,3080448..3080633,3080726..3080821,
                     3080927..3081052,3081108..3081191,3089492..3089572,
                     3089727..3089878,3089986..3090034,3090119..3090142))
                     /locus_tag="BRARA_H00330"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49532.1"
                     /db_xref="Phytozome:Brara.H00330"
                     /translation="MGKKSATKVEAAPVAIKATKPLKKGKREAEDDVDTKVSLKKQKK
                     DVIAAVKKEKAVKKVPKKVESSSESSDSEEEAKKVPAKKVESSSDSSSESSDSEEEVK
                     AKKVPAKKAPAKADSSSEESSDDSSSDDRLSKTFNVLSLKEPVVAKKATNGKVAKKTK
                     DDSSSEEESSDDKPAAAAKNGSVKAKSESSSEEEDSSDEESSDEEPATKKPVAAKKPA
                     AKAKDSSSSDDDDSSEYKSEDEKPAAKKAAPATKAASSSESSDEDSDEESEDEKPAPK
                     KAITKAAKKDSSSGESDSDESESEDEKETPKKKPKTPATPATGGPKTLFAGNLSFQIE
                     RSDVETFFKEAGEVVDVRFATNKDDGSFRGFGHVEFASSEDAQKALELNGRALLGRDI
                     RLDMAAERGDRPAYNTPQSGGGNFRSGGGGGEGQKIFVKGFDSSLPEEDIRQALTQHF
                     ASCGEITRVSIPMDRETGASRGWLTKTIVLKCIIAYIDFKEGAEKAYDLNGTELGGWN
                     IVVDEAKPRDSSGGGGFSGGGGGRFSGGGGGRFGSGRGRDSGRGRFGSGRNGGGRFGR
                     DNGGGRGFSEPSFTSSVVLIPGVAKPQPKKVHP"
     gene            3106910..>3109845
                     /locus_tag="BRARA_H00331"
                     /db_xref="Phytozome:Brara.H00331"
     mRNA            join(3106910..3107253,3107333..3107432,3107503..3107656,
                     3108255..3108405,3108488..3108547,3109741..>3109845)
                     /locus_tag="BRARA_H00331"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00331"
     CDS             join(3107023..3107253,3107333..3107432,3107503..3107656,
                     3108255..3108405,3108488..3108547,3109741..3109845)
                     /locus_tag="BRARA_H00331"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49533.1"
                     /db_xref="Phytozome:Brara.H00331"
                     /translation="MVLAELGGQIASALQKMSNVTIIDEKALNECLKEITRALLHSDV
                     SFPLVREMQNNIKKIVNLEELAAGHNKRRIIEQAIFSELCKMLDPGKPAFSPKKAKPS
                     VVMFVGLQGAGKTTTCTKYAYYHQKKGYKPALVCADTFRAGAFDQLKQNATKARIPFY
                     GSYTESDPVKIAVEGVDTFKKENCDLIIVDTSGRHKQEATLFEEMRQVAEATKPDLVI
                     FVMDSSIGQAAFDQMLKQFGGMGGLQSLMKQMGSGKDMMGMFGGGKDK"
     gene            complement(3111086..3113341)
                     /locus_tag="BRARA_H00332"
                     /db_xref="Phytozome:Brara.H00332"
     mRNA            complement(join(3111086..3111383,3111464..3111737,
                     3111810..3111968,3112048..3113341))
                     /locus_tag="BRARA_H00332"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00332"
     CDS             complement(join(3111375..3111383,3111464..3111737,
                     3111810..3111968,3112048..3112931))
                     /locus_tag="BRARA_H00332"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49534.1"
                     /db_xref="Phytozome:Brara.H00332"
                     /translation="MSSFTKSTSFNRRALSSLSVESPRSTSSTAFNSPIGSAFASPRT
                     FGGSPRPYTNRLKEISYLFQVLIVAGTLVSFLVIIAGGYLYVVPSLGYNGALQFNDTS
                     VIINSKECDIFDGSWVVDASYPLYNASECPFVERGFNCLGNGRGHDEYLKWRWKPKHC
                     SVPRFQVRDVLERLRGKRIVFVGDSMSRTQWESLICMLMTGLDDKRSVYEVNGNNITK
                     RIRFLGVRFSSFNFTVEFYRSVFLVQPGKLLRWHAPKRVKSTLKLDVLDVINNEWSSA
                     DYLVFNTGQWWVPGKLFETGCYFQVGNSLRLGMSIPSAYKVALETWASWIETQIDPNK
                     TRVLFRTFEPSHWSDHRSCNVTKYPTPDTQGRDRSIFSEMIKEVVKNMTVPVSVLDVT
                     SMSAFRSDGHVGLWSDNPLVPDCSHWCLPGVPDIWNEILLFFLFRQQVP"
     gene            <3122657..>3123136
                     /locus_tag="BRARA_H00333"
                     /db_xref="Phytozome:Brara.H00333"
     mRNA            <3122657..>3123136
                     /locus_tag="BRARA_H00333"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00333"
     CDS             3122657..3123136
                     /locus_tag="BRARA_H00333"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49535.1"
                     /db_xref="Phytozome:Brara.H00333"
                     /translation="MSTFKIITLKSCDDKIFEVEEAVAVQSQMIAHMVEDDCIDGEIP
                     ISNVTGAILAKVIEYCEKHLVNPDVDGDSSSSTEDELKNWDAEFMKNMDREMLFALIM
                     AANYLNTKDLLDLICQTIADMIKGFSVDEVRTFFNIQNDFTPEEEAEIRAETEWAFE"
     gene            3133556..3136535
                     /locus_tag="BRARA_H00334"
                     /db_xref="Phytozome:Brara.H00334"
     mRNA            join(3133556..3133845,3133981..3134131,3134211..3134287,
                     3134362..3134420,3134555..3134638,3134752..3134844,
                     3135071..3135151,3135283..3135414,3135501..3135603,
                     3135675..3135769,3135852..3135917,3136004..3136088,
                     3136174..3136535)
                     /locus_tag="BRARA_H00334"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00334"
     CDS             join(3133710..3133845,3133981..3134131,3134211..3134287,
                     3134362..3134420,3134555..3134638,3134752..3134844,
                     3135071..3135151,3135283..3135414,3135501..3135603,
                     3135675..3135769,3135852..3135917,3136004..3136088,
                     3136174..3136337)
                     /locus_tag="BRARA_H00334"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49536.1"
                     /db_xref="Phytozome:Brara.H00334"
                     /translation="MASSLTSKSILGSTKPGYSSLSPELRRLSSPAVKISIRTQTKKS
                     LQIQATGSSYGTHFRVSTFGESHGGGVGCIIDGCPPRIPLSESDLQFDLDRRRPGQSR
                     ITTPRKETDTCRISSGVSEGMTTGTPIHVFVPNTDQRGLDYSEMSVAYRPSHADATYD
                     MKYGVRSVQGGGRSSARETIGRVAPGALAKKILKQFAGTEILAYVSQVHQVVLPEDLV
                     DHENLTLEQIENNIVRCPNPEYAEKMIAAIDAVRTKGNSVGGVVTCIVRNAPRGLGTP
                     VFDKLEAELAKACMSLPATKGFEFGSGFSGTFLTGLEHNDEFYTDENGRIRTKTNRSG
                     GIQGGISNGEIINMRVAFKPTSTIGRKQNTVTRDKKETEMIARGRHDPCVVPRAVPMV
                     EAMVALVLVDQLMAQYAQCHLFPINPELQEPLRTASPVELEQPQNAAAL"
     gene            complement(<3140049..>3141338)
                     /locus_tag="BRARA_H00335"
                     /db_xref="Phytozome:Brara.H00335"
     mRNA            complement(<3140049..>3141338)
                     /locus_tag="BRARA_H00335"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00335"
     CDS             complement(3140049..3141338)
                     /locus_tag="BRARA_H00335"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49537.1"
                     /db_xref="Phytozome:Brara.H00335"
                     /translation="MAKIIRDVLMLRENQAPKVGASLSRSEPRKILMVGIKPHIPDLN
                     VKPCSDSDEKEKREIAKEFQNLVGLKTHDACYVNHKLLYELEVEIIARLPCFEYWKLQ
                     FLNKKFLQLLKSCEIFRVRQEKELVKPHMILHSGAVSNWEMFDKDFKTFRRLPKVPSS
                     DYCFFHSDKETISVGTQLIVIGREIDGIVVFRYELENHKWFKGPSMITPRAMYGSTSH
                     GKTAFFAGGIKMDENGNPVVVQTVEKYNADTKRWTMINGMHKARKFSSGCFLRGKFYV
                     FGGRHDNDKHLTCGESYDETTNSWELIPDMLKDMTVIAHSQSPPLIAVVDDNLYMLET
                     SLNELRVYDINTNIWKKLGVVPVSANVAFGWGIAFKSMGDRLLVIGTSHSWHKKTVVH
                     SCRPSPDVEEQHWEEIKHWCVGAELPQFIHNCCVMFA"
     gene            complement(<3144859..3146031)
                     /locus_tag="BRARA_H00336"
                     /db_xref="Phytozome:Brara.H00336"
     mRNA            complement(join(<3144859..3145447,3145520..3146031))
                     /locus_tag="BRARA_H00336"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00336"
     CDS             complement(join(3144859..3145447,3145520..3146004))
                     /locus_tag="BRARA_H00336"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49538.1"
                     /db_xref="Phytozome:Brara.H00336"
                     /translation="MNHNMRLAIFSKLSPLKLLAVADTRFAFVMLKRLKLVKRGLEAM
                     VISEEWSTYIEDDVGKATFVKGKILSDDWWEQVSYIIDYTRPIYEMIRFCDTDKPCLH
                     LVYEMWDSMIEKVKSEIYKKEKRLVIEVSPFYTVVHEILVDRWAKNNTTLHCLAHSLN
                     PRFYSDEWLSEDSTRLGLHRDLEVSSERMKCFRRLFPSIEDHLKVMDEYALFSMRTGH
                     FEDLTCISMMFTMEPKKWWANFGAQTPFLQTLAFRLLGQPSSSSCYERNWSTYSFIHS
                     LRRNKLNPSRAKDLVFLHNNLRFLSRNSKQYEEEKTKMWDVGGDDFDSMEDMRYLEFA
                     SLSLDEPKLENGLMDDWFVFYFT"
     gene            complement(<3146109..>3147485)
                     /locus_tag="BRARA_H00337"
                     /db_xref="Phytozome:Brara.H00337"
     mRNA            complement(join(<3146109..3146665,3147350..>3147485))
                     /locus_tag="BRARA_H00337"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00337"
     CDS             complement(join(3146109..3146665,3147350..3147485))
                     /locus_tag="BRARA_H00337"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49539.1"
                     /db_xref="Phytozome:Brara.H00337"
                     /translation="MSINVYFRTIMHGDGISLTSHVPAVFRGRVRRGDSVETFPKRFR
                     EDRQGSYSRIRVHLLGIKNQGIVICKKATRSQKSDMQKLEDEFEKKKNKSGSRALPLP
                     CEKNETNPASKKRKSVDSAIARSFGIEVRDQLDQEIARMFYSGGVLFNLARNPHYHMY
                     YQFAAENKIDGYVPPGYNKLRTTLLQKERNNVERLLVPFKSTWKERGVAIVSNGWSDP
                     TRKPLINFIATS"
     gene            3155582..3158698
                     /locus_tag="BRARA_H00338"
                     /db_xref="Phytozome:Brara.H00338"
     mRNA            join(3155582..3155899,3155980..3156044,3156112..3156187,
                     3156264..3156440,3156527..3156621,3156734..3156839,
                     3156913..3156959,3157079..3157409,3157496..3157585,
                     3157682..3157744,3157838..3157912,3158035..3158097,
                     3158166..3158218,3158301..3158698)
                     /locus_tag="BRARA_H00338"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00338"
     CDS             join(3155786..3155899,3155980..3156044,3156112..3156187,
                     3156264..3156440,3156527..3156621,3156734..3156839,
                     3156913..3156959,3157079..3157409,3157496..3157585,
                     3157682..3157744,3157838..3157912,3158035..3158097,
                     3158166..3158218,3158301..3158475)
                     /locus_tag="BRARA_H00338"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49540.1"
                     /db_xref="Phytozome:Brara.H00338"
                     /translation="MGSSPEIIDIATSARRIGVDNRISLKFYFRIADNILKQANIFRA
                     EKNIIDLYVMLLRYSSLALETIPSHRDYRTSLKSNKEYLRMRLLDVLAELEKLKPVVR
                     QRIEELNPKPLPRYNVQTLPSNGSQRWSSAVKPSLSSYDHTKVISPSGHNNVYMGSRG
                     QQFLNAAPLEERFRNMSVNFIRPTEETLSKHSILGPNGLRAQWQPPKNDIKVQYPSNI
                     DFSPIEIPSFRQQFVDSKPMITNGSSNEPEKPIVESSSIPSESIQKNYTEELSSMISF
                     EEEENVNDNNIIRQPSPPPVLAEVQDLAHGLCHGANEVELNIDNSLPDESLRAESPLE
                     LHIATTMMDAFMRLANSNTKKDLETCGILAGSLKNRKFYITALIIPKQESTSNSCQAT
                     NEEEIFEVQDKQSLFPLGWIHTHPTQSCFMSSIDVHTHYSYQIMLPEAVAIVMAPQDS
                     SRKHGIFRLTTPGGMTVIRNCDQRGFHAHSSPADGGPIYNTSTEVYMNPDLRFDVIDL
                     R"
     gene            complement(3159233..3160352)
                     /locus_tag="BRARA_H00339"
                     /db_xref="Phytozome:Brara.H00339"
     mRNA            complement(join(3159233..3159513,3159649..3159731,
                     3159811..3160352))
                     /locus_tag="BRARA_H00339"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00339"
     mRNA            complement(join(3159233..3159731,3159811..3160352))
                     /locus_tag="BRARA_H00339"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00339"
     CDS             complement(join(3159654..3159731,3159811..3160209))
                     /locus_tag="BRARA_H00339"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49541.1"
                     /db_xref="Phytozome:Brara.H00339"
                     /translation="MEPPPERSKRLHNFTLPYLRWGQQRFLRCVNLQSHSHHPSQSPD
                     HATQRSSPINGAVTTTRPWNLRTRGAACGDGLPAMKRGIGEEESENNEKLKFSVSLLK
                     AEIEEDFSFIIGKRPPRRPKKRPRIVQKKLNTIFPGMWLSEEVTIDSYNVPEAVET"
     CDS             complement(join(3159654..3159731,3159811..3160209))
                     /locus_tag="BRARA_H00339"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49542.1"
                     /db_xref="Phytozome:Brara.H00339"
                     /translation="MEPPPERSKRLHNFTLPYLRWGQQRFLRCVNLQSHSHHPSQSPD
                     HATQRSSPINGAVTTTRPWNLRTRGAACGDGLPAMKRGIGEEESENNEKLKFSVSLLK
                     AEIEEDFSFIIGKRPPRRPKKRPRIVQKKLNTIFPGMWLSEEVTIDSYNVPEAVET"
     gene            complement(<3172904..>3173197)
                     /locus_tag="BRARA_H00340"
                     /db_xref="Phytozome:Brara.H00340"
     mRNA            complement(<3172904..>3173197)
                     /locus_tag="BRARA_H00340"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00340"
     CDS             complement(3172904..3173197)
                     /locus_tag="BRARA_H00340"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49543.1"
                     /db_xref="Phytozome:Brara.H00340"
                     /translation="MVKMMWGSSLALAAALLLVTVANIPVAEGVTCSPTELTSCSSAF
                     MSASPPSATCCAKLREQNPCLCGYLRNPALSQYVNSPNAKKVASSCNVATPKC"
     gene            complement(3193457..3194206)
                     /locus_tag="BRARA_H00341"
                     /db_xref="Phytozome:Brara.H00341"
     mRNA            complement(3193457..3194206)
                     /locus_tag="BRARA_H00341"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00341"
     CDS             complement(3193712..3194098)
                     /locus_tag="BRARA_H00341"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49544.1"
                     /db_xref="Phytozome:Brara.H00341"
                     /translation="MNDRKTLLQREIEEENRARNQITVSPTKSQIVVTDANAASTGPS
                     EVAFNVCCLCVYCPLCVLWCCIKQPCTIGWRAILKARGQLSRCTSCGRSYSRKVKAAD
                     YSSFSDIDSDDVNCKAHNCSKRNGRL"
     gene            <3195516..>3197024
                     /locus_tag="BRARA_H00342"
                     /db_xref="Phytozome:Brara.H00342"
     mRNA            join(<3195516..3195531,3195585..3195743,3196864..>3197024)
                     /locus_tag="BRARA_H00342"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00342"
     CDS             join(3195516..3195531,3195585..3195743,3196864..3197024)
                     /locus_tag="BRARA_H00342"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49545.1"
                     /db_xref="Phytozome:Brara.H00342"
                     /translation="MNDHKTSPTRSQIVVTNANVALTDPSEVAFNVCCLCVYCPLCIL
                     WCCIKLPFFCFAKNGRAILKTARPLHGCSGCGRSLSMRIKDADYSSFLDIDLDEVKYK
                     AHSRLKLNG"
     gene            3232918..3234819
                     /locus_tag="BRARA_H00343"
                     /db_xref="Phytozome:Brara.H00343"
     mRNA            join(3232918..3233227,3233414..3233864,3234097..3234165,
                     3234393..3234819)
                     /locus_tag="BRARA_H00343"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00343"
     CDS             join(3233421..3233864,3234097..3234165,3234393..3234479)
                     /locus_tag="BRARA_H00343"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49546.1"
                     /db_xref="Phytozome:Brara.H00343"
                     /translation="MAKTSPSAHGTGLEPPRSDTLGDASDSKLPSDLTGVSAAATGSQ
                     KRGRGRPPKPKSSDSQLNGAVPDRKPSGRPRRNRAPTEAVPTSVVKRGRGRPKRSNTL
                     SGTETVVDGSRKRGRPKKDDVAAPAKKRGRKPKSEVAKRSVGRPKKATERSAGQGAAD
                     PKEIKKKSALLQKKVKQAAEKLKIAVSAIEEVQELAAGM"
     gene            complement(3245699..3247132)
                     /locus_tag="BRARA_H00344"
                     /db_xref="Phytozome:Brara.H00344"
     mRNA            complement(join(3245699..3246119,3246235..3246330,
                     3246727..3246867,3247105..3247132))
                     /locus_tag="BRARA_H00344"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00344"
     mRNA            complement(join(3245699..3246119,3246235..3246330,
                     3246727..3246936))
                     /locus_tag="BRARA_H00344"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00344"
     CDS             complement(join(3245829..3246119,3246235..3246330,
                     3246727..3246879))
                     /locus_tag="BRARA_H00344"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49547.1"
                     /db_xref="Phytozome:Brara.H00344"
                     /translation="MLFQGRSITMKPSMMESLLGLLRIRVKRGVNLAVRDLNSSDPYV
                     VVKMGKQKLKTRVIYNDVNPEWNEDLTLSVTDPSLKVLLTVYDHDTFTKDDKMGDAEF
                     EIKPYINALTMHLQDLPCGTIVTTVQPSRDNCLAEGSRIIWSDGKLVQDIVLRLKHVE
                     CGEVEVQLKWIDLPGSKGL"
     CDS             complement(join(3245829..3246119,3246235..3246330,
                     3246727..3246852))
                     /locus_tag="BRARA_H00344"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49548.1"
                     /db_xref="Phytozome:Brara.H00344"
                     /translation="MKPSMMESLLGLLRIRVKRGVNLAVRDLNSSDPYVVVKMGKQKL
                     KTRVIYNDVNPEWNEDLTLSVTDPSLKVLLTVYDHDTFTKDDKMGDAEFEIKPYINAL
                     TMHLQDLPCGTIVTTVQPSRDNCLAEGSRIIWSDGKLVQDIVLRLKHVECGEVEVQLK
                     WIDLPGSKGL"
     gene            complement(3258305..3259227)
                     /locus_tag="BRARA_H00345"
                     /db_xref="Phytozome:Brara.H00345"
     mRNA            complement(join(3258305..3258842,3259021..3259227))
                     /locus_tag="BRARA_H00345"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00345"
     mRNA            complement(join(3258305..3258861,3259021..3259227))
                     /locus_tag="BRARA_H00345"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00345"
     CDS             complement(3258375..3258731)
                     /locus_tag="BRARA_H00345"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49549.1"
                     /db_xref="Phytozome:Brara.H00345"
                     /translation="MQTQISWSFIVESVLAKFCVYLLVASHRISSLARRCKSFQDRRR
                     TREGGAVKRCNQAKKEVDGSRSGGFPAKPEPFSSDPETSIATQGCTCRSSVKVLLLRN
                     TCFSWILILCIGLRLG"
     CDS             complement(3258375..3258731)
                     /locus_tag="BRARA_H00345"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49550.1"
                     /db_xref="Phytozome:Brara.H00345"
                     /translation="MQTQISWSFIVESVLAKFCVYLLVASHRISSLARRCKSFQDRRR
                     TREGGAVKRCNQAKKEVDGSRSGGFPAKPEPFSSDPETSIATQGCTCRSSVKVLLLRN
                     TCFSWILILCIGLRLG"
     gene            complement(3265666..3268199)
                     /locus_tag="BRARA_H00346"
                     /db_xref="Phytozome:Brara.H00346"
     mRNA            complement(join(3265666..3266081,3266168..3266274,
                     3266392..3266470,3266549..3266641,3266724..3266983,
                     3267076..3267228,3267317..3267641,3267721..3268199))
                     /locus_tag="BRARA_H00346"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00346"
     CDS             complement(join(3266428..3266470,3266549..3266641,
                     3266724..3266983,3267076..3267228,3267317..3267641,
                     3267721..3267935))
                     /locus_tag="BRARA_H00346"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49551.1"
                     /db_xref="Phytozome:Brara.H00346"
                     /translation="MSFMWNVVYVIIALVIVKISQWLWQWSNPNSKGSGKLPPGSMGF
                     PIIGETIEFFKSSGLLEIPPFFQKRMLRYGPLFRTNILGSRTVISTDADVIFEIFRQE
                     NQSFVQSYPDVFVKVLGKDNVFFKTGDVHKHIKHTTMHLIGSEGLKRKMIGFMNRTTR
                     EHLRWKASEGAFNLRHAVSTLIVSYITPQMISNLKPETEAKLIDNFMAFNIEWFQSPF
                     ALSTWKNLFKVLRARKEAAKIINVALERRKDSILEKQGDFLDTLLEEMKKEGSIFDQA
                     SIVNLLLNIGVVSRDTTSHATALTVDFISKNPRVLTELQESSESMRRLYKRETIKKQD
                     LAGRNIKTACLSPAWLSTSRFGWQTWEP"
     gene            complement(3282414..3284405)
                     /locus_tag="BRARA_H00347"
                     /db_xref="Phytozome:Brara.H00347"
     mRNA            complement(join(3282414..3283260,3283472..3284405))
                     /locus_tag="BRARA_H00347"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00347"
     CDS             complement(join(3282631..3283260,3283472..3284371))
                     /locus_tag="BRARA_H00347"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49552.1"
                     /db_xref="Phytozome:Brara.H00347"
                     /translation="MVDEFQNCFIFILLCFFTVFCYSVLFCRKTKLEVDFPPSPPSLP
                     VIGHLHLLLSAVSHKAFQNISSKYGPLLYLRLFSFPIVLASSASVAYELFRTHDVNVS
                     SRMPPITIESLIFGSSGFASAPFGDYAKFMKKLLATRLFRTQAIENLRGVRAEELERF
                     YLNLYDKAAKKESVEIGEETMKFTNNMICRMCMGRSCSVENGGIERVRELIIKCFAMS
                     KKLFLANTCLTWLEKLGISPFKKEIMDVSHGFDELLERILVEHEERPEQDQDMDMMDL
                     LLEASREENAEYKITRKQIKSLFVEIFMAGIDTAAQATQWTMAEIINNPKILERLRGE
                     IDLVVGKARLIQETDIPNLPYLQAVVKEGLRLHPPGPFLVRRFQESCKVKEFYVPGQT
                     TLLVNVYAIMRDPDLWEDPDEFKPERFLSSRSSEQEEEIKGQAFKYIPFGAGRRGCPA
                     GNLGPIFVGIAVGMMVQCFDWRINGHGEISMEEVIAGISLTMAHPLKCTPVSRLSSFS
                     L"
     gene            complement(<3299768..>3300799)
                     /locus_tag="BRARA_H00348"
                     /db_xref="Phytozome:Brara.H00348"
     mRNA            complement(<3299768..>3300799)
                     /locus_tag="BRARA_H00348"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00348"
     CDS             complement(3299768..3300799)
                     /locus_tag="BRARA_H00348"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49553.1"
                     /db_xref="Phytozome:Brara.H00348"
                     /translation="MYTVSFMYVWGLVMVSLCYTFYVGKLVGRGIMRQILIFPVLLIF
                     LIVPLLVSSIHLICITSFFIAWLANFKIILFTLGRGPLYSLSLPVFLAVASLPIKIQL
                     IPKPHESREGTLLNYAKKFATLVLIIKVIEYSSKLPDKAVFTLYLMIQNYFSLKVILS
                     TVSVVVRATSNLELEPQFDEPHLATSLQNFWGRRWNLMVTGILRPTVYEPTMELLSGL
                     GRNRSRYLAVFITFAVSGLMHVLIFFYIGRLRPDWKIMWFFLINGFCTSVEIAIKKNV
                     KGRFPTTISRVLTMGFVVVTSWWLFFPEFKRCNLPQRVFQEYVSIGAFAARVKNTITA
                     SLLSAYHTM"
     gene            3316765..3323576
                     /locus_tag="BRARA_H00349"
                     /db_xref="Phytozome:Brara.H00349"
     mRNA            join(3316765..3317368,3317457..3317497,3317631..3317801,
                     3317880..3319232,3319329..3319501,3319670..3319907,
                     3320031..3320123,3320205..3320345,3320418..3320510,
                     3320721..3320925,3321211..3321296,3321558..3321646,
                     3321913..3321964,3322051..3322107,3322220..3322381,
                     3322471..3322548,3322953..3323074,3323146..3323576)
                     /locus_tag="BRARA_H00349"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00349"
     CDS             join(3316855..3317368,3317457..3317497,3317631..3317801,
                     3317880..3319232,3319329..3319501,3319670..3319907,
                     3320031..3320123,3320205..3320345,3320418..3320510,
                     3320721..3320925,3321211..3321296,3321558..3321646,
                     3321913..3321964,3322051..3322107,3322220..3322381,
                     3322471..3322548,3322953..3323039)
                     /locus_tag="BRARA_H00349"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49554.1"
                     /db_xref="Phytozome:Brara.H00349"
                     /translation="MVFKKTKLFFSSKKSGSSDSSNSPRSVGSSSPIGSDNHKSKSPN
                     STSSPFAAVFDGFKKKEKDGSSSKAKETSSSDQVPGKSKLSSEASKLTAETPIMASSL
                     GLNRIKTRSGPLPQESFFNFGDEKAVPIVPPKLGTRWDSGSSSSSHTKKKEAANVDRR
                     SNVPAMPALSTGQLKVTPSDAGTPENSYEVEPETPRNQALLRMTSAPRRRFSGDIKSF
                     SHELNSKGVRPYPLWKPRRSNSVEEILNLIRTKFDKAKEEVNLDLGVFAGDLIEISEE
                     YAESHPEWEVTIYDLLILAQKCTKSTSGEFWLQCEGIVQELDDRRQELPPGVLKKLHT
                     RMLFILTRCTRLLQFHKESWGQEEEALRQSRVLHSADKRAPTGEVRDRKGLNTATALK
                     IPSTKKAYSQEQRGLNWKDDFVNRPSPLSSPYNETSNDSESLVNMDRMSSWKKLPSPA
                     PKGVKESTVSKEQTDSKTEPPKVATSDDMAVSKAPDCSPKKLSHEHMTKHRHNISWGY
                     WGDQSYIPEESSIICRICEEDVPTTHVEDHSIVCALADKYDQKGLSVDDRLVAVAVTL
                     DKITEAFIQKDSLAAVESPDGMKISKASLTGESDVLSPKLSDWSRRGSEDMLDCFPEA
                     DNSAFMDDMRCFTSLSCRTRFGPKSDQGMTASSGGSMTPRSPIPTPRSDPVELFLGGK
                     GTFHDLDDIPQMTELADIARRASNAIPDGDRSIRLLLSCLDDLRVVIDRRNFDALTVE
                     TFGTRIEKLIQEKYLQLLDDEKFDLSSTVIDEDAPLEDDDVIRSLKTSPVHLHDRISI
                     DDFDEIKEISRGAFGRVLLAKKRTTGDLFAIKVLKKADMIRKNAVESILAERDILINV
                     RNPFVVRFFYSFTSRENLYLVMEYLGGGDFYSLLKNIGCMDESNARVYIAEVILALEY
                     LHSEGVVHRDLKPDNLLIAHDGHVKLTDFGLSKVGLISSTDDLSGPDFGASSLFLEEK
                     PKWTTSEHEFGSRDKRSAVGTPDYLAPEILLGTGHGATADWWSVGIILFEFIVGIPPF
                     NADHPEQIFDNILNRNIPWPSVPEEMSHEARDLIDRLLTEDPHQRLGARGAAEVKQHI
                     FFKDINWDTLAEQKAAFVPDSEDVLDTSYFQCRYQPSFSDKQCFPTNENGDSSESGSS
                     GCLSNDPNEEIDERGGPAELETNVSKNNPFDNFSFKNLSQLAYINYDVISKGQKEGTP
                     TNLHRR"
     gene            complement(3324700..3327291)
                     /locus_tag="BRARA_H00350"
                     /db_xref="Phytozome:Brara.H00350"
     mRNA            complement(join(3324700..3325564,3325845..3327291))
                     /locus_tag="BRARA_H00350"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00350"
     CDS             complement(join(3324969..3325564,3325845..3327252))
                     /locus_tag="BRARA_H00350"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49555.1"
                     /db_xref="Phytozome:Brara.H00350"
                     /translation="MSLLFLLPSLSLSPSMNHRTMRLFPYSSMAILSLFLTTLLLSLP
                     LPSTQDLNADRAALLSLRSAVGGRTFRWDIRQTSPCNWAGVKCDNNRVTALRLPGVSL
                     SGTIPNGVFGNLTRLRTLSLRLNALTGSLPLDLTTSSDLRHLYLQGNRFSGQIPESLF
                     SLTNLVKLNLAENSFTGGISSSFNNLTRLKTLFLQDNNLSGSIPDLDLPLVQFNVSNN
                     SLNGSIPKHLQRFESGSFLQTSLCGKPLKICPGEETVPSQPTSGGNRTPPSVGGSNEK
                     RKNKLSGGAIAGIVIGCVVGLALIVLILMVLCRKRSRAVDGSTIKQQEPAVVPREAAA
                     ENGNGYSVTAAAAAAMTGNSKAGEVAGPAAKKLVFFGNATKVFDLEDLLRASAEVLGK
                     GTFGTAYKAVLDAVTVVAVKRLKDVVMQDKDFREKIELVGAMDHENLVPLRAYYLSRD
                     EKLLVYDFMHMGSLSALLHGNRGAGRTPLTWDVRSRIALGAARGLDYLHSQGTSTSHG
                     NVKSSNILLTKSHDAKVSDFGLSQLVAASTTTPNRGTGYRAPEVTDPKRVSQKGDVYS
                     FGVVLLELITGKAPSNSVMNEEGVDLPRWVKSVVRDEWRREVFDSELLSLEREEEEMM
                     EEMVQLGIECTSQHPDQRPEMTEVVRKIESLRRSGPDQVDEAY"
     gene            complement(3337136..3338696)
                     /locus_tag="BRARA_H00351"
                     /db_xref="Phytozome:Brara.H00351"
     mRNA            complement(join(3337136..3337487,3337569..3337909,
                     3338064..3338375,3338451..3338484,3338574..3338696))
                     /locus_tag="BRARA_H00351"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00351"
     CDS             complement(join(3337269..3337487,3337569..3337909,
                     3338064..3338375,3338451..3338484,3338574..3338654))
                     /locus_tag="BRARA_H00351"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49556.1"
                     /db_xref="Phytozome:Brara.H00351"
                     /translation="MESKAICLGFLPPRLQLSSRVSLSLPRGSSTSPNSDVRQTLVWS
                     KRQGGVYLNRGRVLCSSQPDSNAPRAELFRGKSGSVSFNGLTHQLVEESKLVSAPFQE
                     EDKGSLLWVLAPAVLISSLILPQFFLSGAIEATFKNDTVAEIVTSFCFETAFYAGLAI
                     FLSVTDRVQRPYLDFSSKRWGLITGLRGYLMSTFLMMGLKVVVPVFAVYMTWPALGMD
                     ALIAVLPFLVGCAVQRGFEAQLERRGSSCWPIVPIVFEVYRLYQVTRAATFVQRLMFM
                     MKDASTTVEITERGVALVGLVVTLQFLAVLCLWSLITFLMRLFPSRPVSENY"
     gene            complement(<3345883..>3346876)
                     /locus_tag="BRARA_H00352"
                     /db_xref="Phytozome:Brara.H00352"
     mRNA            complement(join(<3345883..3346000,3346044..3346099,
                     3346532..3346614,3346705..>3346876))
                     /locus_tag="BRARA_H00352"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00352"
     CDS             complement(join(3345883..3346000,3346044..3346099,
                     3346532..3346614,3346705..3346876))
                     /locus_tag="BRARA_H00352"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49557.1"
                     /db_xref="Phytozome:Brara.H00352"
                     /translation="MALQWLILSYVVAAEVVIAVVLTLPYPMVVKKRVVSLVSLVLQP
                     AASIVAFAAFQLCDIYWKNEHRLSCSSEVCTATERDRYEKSIYKAQRNVVLCAAGILL
                     YWSQCNFTDIYLLYMCIYRICKYNKDLELLEEAEKRHKDE"
     gene            3347336..3351207
                     /locus_tag="BRARA_H00353"
                     /db_xref="Phytozome:Brara.H00353"
     mRNA            join(3347336..3347462,3347630..3347703,3347765..3347828,
                     3347898..3348010,3348085..3348132,3348208..3348279,
                     3348357..3348446,3348545..3348718,3348827..3348910,
                     3349055..3349110,3349230..3349360,3349436..3349528,
                     3349639..3349703,3349818..3349961,3350046..3350089,
                     3350177..3350260,3350351..3350424,3350499..3350611,
                     3350694..3350789,3350860..3351207)
                     /locus_tag="BRARA_H00353"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00353"
     CDS             join(3347423..3347462,3347630..3347703,3347765..3347828,
                     3347898..3348010,3348085..3348132,3348208..3348279,
                     3348357..3348446,3348545..3348718,3348827..3348910,
                     3349055..3349110,3349230..3349360,3349436..3349528,
                     3349639..3349703,3349818..3349961,3350046..3350089,
                     3350177..3350260,3350351..3350424,3350499..3350611,
                     3350694..3350789,3350860..3350985)
                     /locus_tag="BRARA_H00353"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49558.1"
                     /db_xref="Phytozome:Brara.H00353"
                     /translation="MAPPAKKFINNPNDVVTEFIEGLVETYPGLQYLDGLPEVKVVLR
                     ADVSAADYDKVAVISGGGSGHEPAQAGYVGEGMLTAAICGDVFASPPVDSIIAGIRAV
                     TGPMGCLLVVTNYTGDRLNFGLAAELAKTEGFKVETVIVGDDCALPPPRGISGRRGLA
                     GTVLVHKVAGAAAAAGLSLEEVAAEAKHASEMVGTMGVALTVCSLPGQATSDRLGPEK
                     MELGLGVHGEPGAAVVDIQPVDVVVSHVLQQILSPETNYVPITRGNSVVLMVNGLGGT
                     PLMELMIAAGKAVPKLQLEFGLAVDRVYTGSFMSSLDMAGFSISIMKADQSILERLDA
                     PTKGPSWPVGTDGNRPPSKIPVPLPPFQQNKNEESLGRPQELSQQGRILEAAIKAAAT
                     VVISLKDSLNEWDGKVGDGDCGSTMCRGATAILEDMKNYYPLNDAAETVNEIGSSIRR
                     VMGGTSGIIYSLLCKAAYAELKANAQSEVTPKNWSDALKSSISAVSKYGGASAGYRTM
                     LDALIPASKVLEEKLSVGEDPVSAFVLSAEAATAGAESTIQMQAQAGRSSYVSAEILA
                     SIPDPGAMAAAAWYSAAARAVKEQSQGL"
     gene            3360453..3366384
                     /locus_tag="BRARA_H00354"
                     /db_xref="Phytozome:Brara.H00354"
     mRNA            join(3360453..3360583,3360983..3361719,3361801..3362009,
                     3362096..3362245,3362336..3362469,3362568..3362677,
                     3362813..3362919,3363010..3363148,3363221..3363337,
                     3363452..3363559,3363655..3363726,3363818..3363940,
                     3364036..3364198,3364277..3364536,3364644..3364786,
                     3364884..3364946,3365036..3365099,3365191..3365326,
                     3365424..3365497,3365592..3365686,3365786..3365817,
                     3365933..3366384)
                     /locus_tag="BRARA_H00354"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00354"
     CDS             join(3360991..3361719,3361801..3362009,3362096..3362245,
                     3362336..3362469,3362568..3362677,3362813..3362919,
                     3363010..3363148,3363221..3363337,3363452..3363559,
                     3363655..3363726,3363818..3363940,3364036..3364198,
                     3364277..3364536,3364644..3364786,3364884..3364946,
                     3365036..3365099,3365191..3365326,3365424..3365497,
                     3365592..3365686,3365786..3365817,3365933..3366144)
                     /locus_tag="BRARA_H00354"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49559.1"
                     /db_xref="Phytozome:Brara.H00354"
                     /translation="MVRKKRTDGSSEGGEGSGSREAGPHSGGGRGGYQQGGGRGGGGG
                     QQQGGRGYGPQSQQGGRGGGRGYGQPPQQYGGPREGQQPQQYGGPREGQQPQQYGGPR
                     EGQPPQHQHQQQYGGPRGGPPRGGYGGGGRGGAPSAGQPQRQSVPELHQATSPTYQAV
                     SSQPTPSEVSPTRIPDTSAPVQEFEQLSIEQGASSQAIQPIPSSSKAFKFPMRPGKGQ
                     VGKRCIVKANHFFAELPDKDLHQYDVTITPEVTSRGVNRAVMKQLVDLYRESHLGRRL
                     PAYDGRKSLYTAGPLPFVSKEFRILLHDEEEGAGGQRREREFKVVIKLAARADLHHLG
                     MFLQGKQADAPQEALQVLDIVLRELPTSKYTPVARSFYSPDIGRKQSLGDGLESWRGF
                     YQSIRPTQMGLSLNIDMSSTAFIEALPVTEFVCQLLNRDIRSRPLSDADRVKIKKALR
                     GVKVEVTHRGNMRRKYRISGLTAVATRELTFPVDERNTQKSVVEYFYETYGFRIQHTQ
                     LPCLQVGNSNRPNYLPMEVCKIVEGQRYSKRLNERQITALLKVTCQRPQEREKDILRT
                     VELNDYSHDPYAKEFGIKISASLASVEARILPPPWLKYHESGREGTCLPQVGQWNMMN
                     KKMINGGTVSNWICINFSRQVPDNMARSFCQELAQMCHISGMAFNPEPVLPPVSARPE
                     HVEKVLKTRYHDAMAKLSQGKEIDLLIVILPDNNGSLYGDLKRICETELGIVSQCCLT
                     KHVFKMSKQYMANVALKINVKVGGRNTVLVDALSRRIPLVSDRPTIIFGADVTHPHPG
                     EDSSPSIAAVVASQDWPEVTKYAGLVCAQAHRQELIQDLFKEWKDPQKGVVTGGMIKE
                     LLIAFRRSTGHKPLRIIFYRDGVSEGQFYQVLLYELDAIRKACASLEAGYQPPVTFVV
                     VQKRHHTRLFAQNHNDRNSVDRSGNILPGTVVDSKICHPTEFDFYLCSHAGIQGTSRP
                     AHYHVLWDENNFSADGLQSLTNNLCYTYARCTRSVSIVPPAYYAHLAAFRARFYMEPE
                     TSDSGSMASGSMARGGGMGGRNMRGPHVNAAVRPLPPLKDNVKRVMFYC"
     gene            complement(3380176..3380938)
                     /locus_tag="BRARA_H00355"
                     /db_xref="Phytozome:Brara.H00355"
     mRNA            complement(join(3380176..3380581,3380753..3380938))
                     /locus_tag="BRARA_H00355"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00355"
     CDS             complement(join(3380397..3380581,3380753..3380852))
                     /locus_tag="BRARA_H00355"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49560.1"
                     /db_xref="Phytozome:Brara.H00355"
                     /translation="MKKITQSLLLSLVPILLCVSFQVGVIEARLRHLGTPITETRMIH
                     VNPPPPCGAKIQVAPPLPPSTQIQTGEMPPFETQTGGACRPVPRRLPRPP"
     gene            <3389655..>3390631
                     /locus_tag="BRARA_H00356"
                     /db_xref="Phytozome:Brara.H00356"
     mRNA            join(<3389655..3389700,3389790..>3390631)
                     /locus_tag="BRARA_H00356"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00356"
     CDS             join(3389655..3389700,3389790..3390631)
                     /locus_tag="BRARA_H00356"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49561.1"
                     /db_xref="Phytozome:Brara.H00356"
                     /translation="MDASQPSLPQFPSLSELESRMQVLRVSALEENQTGETLSQRADW
                     FYQRRPLILSLCEDLYDSYTTLLNRYNHAKPQNLPKPVSHDNDSDTSSEVTSILSFQH
                     MQITTCDKQKIEELVSQLATANTEKDMAQDELRRGEQKFREASKTIELLKKLVTLLDM
                     EKEVAVEETTNLGYKLTSLLEENRDLATEALFMKKEAVRLARCVLKMRNDHFHEMCLL
                     QNQVYALQSSSRESVYENETSPRCFGLDKSKSKKRKMSETRTEPGEKKRKSKWLKRLN
                     PFIKSSVSPSPALLHRPAQ"
     gene            3392075..3393934
                     /locus_tag="BRARA_H00357"
                     /db_xref="Phytozome:Brara.H00357"
     mRNA            join(3392075..3392449,3392525..3392635,3392708..3392797,
                     3392871..3393130,3393498..3393934)
                     /locus_tag="BRARA_H00357"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00357"
     CDS             join(3392138..3392449,3392525..3392635,3392708..3392797,
                     3392871..3393130,3393498..3393804)
                     /locus_tag="BRARA_H00357"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49563.1"
                     /db_xref="Phytozome:Brara.H00357"
                     /translation="MVRASSSKKGGDKDDPESKQRKRLKTLALDNKLLSDSPSRCLSS
                     LKPSKQVLKHHGCDIIRKSQRKNRFLFSFPGLLAPVSGATIGDLDRLSTKNPVLYLNF
                     PQGRMKLFGTILYPKNRYLTLQFSRGGKNVLCDDYFDNMIVFSESWWIGTKEENPEEA
                     RLDFPKELSPQAEKTEEFDFRGGAGAASTTAAASASVKTAATPETGSQPTETETDSPE
                     VEMEEILSDDGEFTDDKIQVTPVQLTPVRQSQRNSGKKFNFAETSPENSSGESEGNTS
                     DEEDEKPLLETDSSTRVREEPQADITTASTGKLPTELPAKKEKSNSKDGKLVQATVAN
                     LFKKAEQKTVGTSKAKSSSKASQKK"
     gene            complement(3393935..3396788)
                     /locus_tag="BRARA_H00358"
                     /db_xref="Phytozome:Brara.H00358"
     mRNA            complement(join(3393935..3395186,3395270..3395459,
                     3395551..3395685,3395768..3395865,3395938..3396095,
                     3396265..3396788))
                     /locus_tag="BRARA_H00358"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00358"
     CDS             complement(join(3394065..3395186,3395270..3395459,
                     3395551..3395685,3395768..3395865,3395938..3396095,
                     3396265..3396706))
                     /locus_tag="BRARA_H00358"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49562.1"
                     /db_xref="Phytozome:Brara.H00358"
                     /translation="MRKGDLTPDRDRVIEEHELQETRFSPETERNKNARQYQREEEEE
                     EEESVEGIFESREVPSWKKQLTIRAFVVSFALSILFSFIVMKLNLTTGIIPSLNVSAG
                     LLGFFFVKTWTKMLHKSGLLKQPFTRQENTVIQTCVVASSGIAFSGGFGTYLFAMSER
                     IANHSGDAARGVKDPSLGWIIAFLFVVSFLGLFSVVPLRKIMIIDFKLTYPSGTATAH
                     LINSFHTPQGAKLAKEQVRVLGKFFSLSFLWGFFQWFFTAGENCGFHSFPTFGLRAYQ
                     YKFYFDFSATYVGVGMICPYIINISLLLGGILSWGLMWPLIETRKGDWFPSDVDSSSM
                     SGLQAYKVFIAVAMILGDGVYNFCKVLSRTLSGLFKQIRGEASWRNSLSREEEPPASQ
                     LTPKISYDDQRRTRFFLKDQIPSWFAGGGYVLIAAVSIAILPQMFDQLRWYYILVIYV
                     FAPVLAFCNAYGAGLTDWSLASTYGKLAIFTIGAWAGSDHGGVLAGLAACGVMMNIVS
                     TASDLTQDFKTGYLTLSSPRAMFVSQVIGTAMGCLVSPCVFWLFYKAFDDLGLPNSKY
                     PAPFATVYRSMAKLGVEGVSSLPRDCLVLCYAFFGFAILINVVKDGLGNRWGRYVPLP
                     MAMAIPFFLGPYFAIDMCVGSLVLFVWERLDAPRAEAFATAVASGLICGDGIWTLPSS
                     VLAIAGVEPPICMKFLSSETNHRVDKFLQGSS"
     gene            complement(3397361..3401844)
                     /locus_tag="BRARA_H00359"
                     /db_xref="Phytozome:Brara.H00359"
     mRNA            complement(join(3397361..3397927,3398004..3398511,
                     3398590..3398789,3398865..3399005,3399084..3399171,
                     3399258..3399328,3399418..3399533,3399629..3399703,
                     3400186..3400248,3400367..3400634,3400710..3400814,
                     3400899..3401221,3401296..3401398,3401485..3401844))
                     /locus_tag="BRARA_H00359"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00359"
     CDS             complement(join(3397484..3397927,3398004..3398511,
                     3398590..3398789,3398865..3399005,3399084..3399171,
                     3399258..3399328,3399418..3399533,3399629..3399703,
                     3400186..3400248,3400367..3400634,3400710..3400814,
                     3400899..3401221,3401296..3401398,3401485..3401577))
                     /locus_tag="BRARA_H00359"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49564.1"
                     /db_xref="Phytozome:Brara.H00359"
                     /translation="MLTGQESLLRLIGKRRRCLPNRHNLLSTPTPNSLNLDVNDSGNL
                     ISPTGDNIRSPETPPTYPGNSDDLSVSRKNKKKRRLTQTTLLQWSGSKQSQHSPLIHP
                     PKQQQSILEFDDDSSSEEISKTVALDEANGDEAIQTFIVGRKFSDVQDLEAGEKICLL
                     RHPENIKDPNAIKVLSSDSGLSEILGYLPKDVSQCLSPLIDQYDLKFEGTINSVPKNS
                     SEAVSVKVVCRKMTSDVWKESESAGGDFKLMWEKVLQVVEHQMQFPPKTTRYQLNFSV
                     LVQEVLRSCSHLFTADEKAFLESFTSLSEDSQRLFIRLYTRKGPWFRLSNISYPEVSD
                     SLQALKDLTVKGFMTSVENANDLNYQTMKEIIELLNVTELRDILSVNKVFSRGSRKRD
                     LINSLCSYYNDGTRINVGTMILERTGLCAKISSTSESLIWRVERLFFLNGEQDLSSFV
                     LLDLGIIKYPIYKCIDSEQIFSDRTKLLAYEEAIEVAQLMDESLDCEDSGTVLKCIMI
                     AETRISSSSSSESALFNCFTAPWVYSKMVLLGVSFLENQKRYNQAVYLLRRLLSCFSC
                     DGRRGYWTVRLSTDLEHMGRPNESLSVAEQGLLDPWVRAGSRIALQRRILRLAKPPRR
                     WKTPTFPNLVDNKIPEVTIQGRSLNCEVGMKNRFYGEDGEQCGVEQLALQYYNGEGGG
                     WQGMHTESSIWLTIFGLLMWDILFSDVPGVFQTRFQTAPLDLETESFYQTRKETIEAQ
                     LEKVASGMAEEILIISYETHRGTACRGVAWERFSLEELRAAVACVGGKCVASLCRYLA
                     QDYRSWCSGMPDLLLWRFKENGYEGEAKLVEVKSEKDRLSEQQRAWLLLLMDSGFNVE
                     ICKVRPACV"
     gene            complement(3401927..3402908)
                     /locus_tag="BRARA_H00360"
                     /db_xref="Phytozome:Brara.H00360"
     mRNA            complement(join(3401927..3402201,3402282..3402443,
                     3402648..3402908))
                     /locus_tag="BRARA_H00360"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00360"
     CDS             complement(join(3402052..3402201,3402282..3402443,
                     3402648..3402851))
                     /locus_tag="BRARA_H00360"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49565.1"
                     /db_xref="Phytozome:Brara.H00360"
                     /translation="MASVSGCGSVSLLTNRNAFLGSGLQHHAVFLKPWSPPSLLKSGS
                     LVVEAKTKTSSEDRIARHSRIRKKVNGTTERPRLCVFRSNKHLYVQVIDDTKMHTLAS
                     ASTKQKPISEEFDYTSGPTIEVAKKVGEVIAKSCLEKGITKVAFDRGGYPYHGRIEAL
                     AAAAREHGLQF"
     gene            complement(3405424..3406139)
                     /locus_tag="BRARA_H00361"
                     /db_xref="Phytozome:Brara.H00361"
     mRNA            complement(3405424..3406139)
                     /locus_tag="BRARA_H00361"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00361"
     CDS             complement(3405771..3406004)
                     /locus_tag="BRARA_H00361"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49566.1"
                     /db_xref="Phytozome:Brara.H00361"
                     /translation="MTSWKKTIATPFKKAATFFNQPQQTSHNRHANAKAREEHERRTV
                     KELQGDVMACGYEDVLVMWSILDKSNSSNNLSS"
     gene            3436900..>3437593
                     /locus_tag="BRARA_H00362"
                     /db_xref="Phytozome:Brara.H00362"
     mRNA            join(3436900..3437014,3437096..>3437593)
                     /locus_tag="BRARA_H00362"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00362"
     CDS             3437258..3437593
                     /locus_tag="BRARA_H00362"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49567.1"
                     /db_xref="Phytozome:Brara.H00362"
                     /translation="MIWKFLPNSCFGLNVADEQKAEHDSGLSLLFLCGCIDIQKLYRK
                     CVRNKKVVYMHTPKLVYACVQVLVCYTVVLVFLKLLVKPKMEICGSHEERWSVWINIM
                     ICINVLSVK"
     gene            complement(<3442584..>3445513)
                     /locus_tag="BRARA_H00363"
                     /db_xref="Phytozome:Brara.H00363"
     mRNA            complement(join(<3442584..3442783,3444905..3445043,
                     3445367..>3445513))
                     /locus_tag="BRARA_H00363"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00363"
     CDS             complement(join(3442584..3442783,3444905..3445043,
                     3445367..3445513))
                     /locus_tag="BRARA_H00363"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49568.1"
                     /db_xref="Phytozome:Brara.H00363"
                     /translation="MISALPDDLLVQILLFLPTEDAVITMIMSKLWRLIWTMIPKLDY
                     NDRYKKYEDSHVKLLSSCPVLKKLSVLRDEFDDNVTTFIVKVPSLENLIYESSQKGCS
                     RNLPISWNQPSSVPVCLLSHLEIFQFKGYRKRREEKLFVAYILANSKCLKTAGISLRS
                     S"
     gene            3449134..3449943
                     /locus_tag="BRARA_H00364"
                     /db_xref="Phytozome:Brara.H00364"
     mRNA            join(3449134..3449322,3449405..3449943)
                     /locus_tag="BRARA_H00364"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00364"
     CDS             join(3449197..3449322,3449405..3449746)
                     /locus_tag="BRARA_H00364"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49569.1"
                     /db_xref="Phytozome:Brara.H00364"
                     /translation="MVSASSKTKALDPPLHALGFEIDELSPTRVTGRLPVSPICCQPF
                     KVLHGGVSALIAESLASMGAHMASGFKRVAGIQLSINHVKSADLGDLVFAEASPVSTG
                     KTIQVWEVKLWKSKEGSENRTLISSSRVTLLCNLPVPDHVKDASDPLKLISKL"
     gene            complement(<3453728..>3454350)
                     /locus_tag="BRARA_H00365"
                     /db_xref="Phytozome:Brara.H00365"
     mRNA            complement(join(<3453728..3453870,3453903..3453962,
                     3454042..3454114,3454195..>3454350))
                     /locus_tag="BRARA_H00365"
                     /product="hypothetical protein"
                     /db_xref="Phytozome:Brara.H00365"
     CDS             complement(join(3453728..3453870,3453903..3453962,
                     3454042..3454114,3454195..>3454350))
                     /locus_tag="BRARA_H00365"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="RID49570.1"
                     /db_xref="Phytozome:Brara.H00365"
                     /translation="IKEYISVELFFEILELEPDKLEILKVENMIIKEKRVTDATIEII
                     YVRLIKHRAIPDETIKKDWSSYYGLVKNQGPRDICWAIVAVELITAIRWIKNQLVEFV
                     CPGRGILNEKLHNFCYKLNIMSTLEYVIKHGVQEAADRPFD"
     gene            complement(3456514..