LOCUS       CP000612             3608104 bp    DNA     circular BCT 28-JAN-2014
DEFINITION  Desulfotomaculum reducens MI-1, complete genome.
ACCESSION   CP000612 AAOP01000000 AAOP01000001-AAOP01000104
VERSION     CP000612.1
DBLINK      BioProject: PRJNA13424
            BioSample: SAMN02598304
KEYWORDS    .
SOURCE      Desulfotomaculum reducens MI-1
  ORGANISM  Desulfotomaculum reducens MI-1
            Bacteria; Firmicutes; Clostridia; Clostridiales; Peptococcaceae;
            Desulfotomaculum.
REFERENCE   1  (bases 1 to 3608104)
  AUTHORS   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina
            del Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Pitluck,S.,
            Sims,D., Brettin,T., Bruce,D., Han,C., Tapia,R., Schmutz,J.,
            Larimer,F., Land,M., Hauser,L., Kyrpides,N., Kim,E., Tebo,B.M. and
            Richardson,P.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Complete sequence of Desulfotomaculum reducens MI-1
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 3608104)
  AUTHORS   Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina
            del Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Pitluck,S.,
            Sims,D., Brettin,T., Bruce,D., Han,C., Tapia,R., Schmutz,J.,
            Larimer,F., Land,M., Hauser,L., Kyrpides,N., Kim,E. and
            Richardson,P.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Direct Submission
  JOURNAL   Submitted (14-MAR-2007) US DOE Joint Genome Institute, 2800
            Mitchell Drive B100, Walnut Creek, CA 94598-1698, USA
COMMENT     URL -- http://www.jgi.doe.gov
            JGI Project ID: 4000266
            Source DNA and bacteria available from Bradley M. Tebo
            (tebo@ebs.ogi.edu)
            Contacts: Bradley M. Tebo (tebo@ebs.ogi.edu)
                 Paul Richardson (microbes@cuba.jgi-psf.org)
            Quality assurance done by JGI-Stanford
            Annotation done by JGI-ORNL and JGI-PGF
            Finishing done by JGI-LANL
            Finished microbial genomes have been curated to close all gaps with
            greater than 98% coverage of at least two independent clones. Each
            base pair has a minimum q (quality) value of 30 and the total error
            rate is less than one per 50000.
            The JGI and collaborators endorse the principles for the
            distribution and use of large scale sequencing data adopted by the
            larger genome sequencing community and urge users of this data to
            follow them. It is our intention to publish the work of this
            project in a timely fashion and we welcome collaborative
            interaction on the project and analysis.
            (http://www.genome.gov/page.cfm?pageID=10506376).
FEATURES             Location/Qualifiers
     source          1..3608104
                     /organism="Desulfotomaculum reducens MI-1"
                     /mol_type="genomic DNA"
                     /strain="MI-1"
                     /db_xref="taxon:349161"
     gene            365..1690
                     /locus_tag="Dred_0001"
     CDS             365..1690
                     /locus_tag="Dred_0001"
                     /note="KEGG: chy:CHY_2710 chromosomal replication
                     initiation protein;
                     TIGRFAM: chromosomal replication initiator protein DnaA;
                     PFAM: Chromosomal replication initiator, DnaA C-terminal
                     domain; Chromosomal replication initiator, DnaA;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="chromosomal replication initiator protein DnaA"
                     /protein_id="ABO48553.1"
                     /db_xref="InterPro:IPR001957"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR013159"
                     /db_xref="InterPro:IPR013317"
                     /translation="MQNDVLARWEQVLIRLEKQVNKHSFETWLTKCKPVAFYDNTIII
                     EVPDHFSKSWLADRYAPIIKQAYESIMHQEISLQFILAGQEVDQPKPKERSSEETYIN
                     ILNPRYTFDTFVVGNSNRFAHAASLAVAESPAKAYNPLFIYGGVGLGKTHLMHAIGHY
                     ILENNQNLKVAYVTSEKFTNELINSIRDDQTVEFRNKYRSMDILLIDDIQFLEKKERT
                     QEEFFHTFNTLYEANKQIIISSDRPPKEIATLEDRLRSRFEWGLITDMQSPDYETRVA
                     ILRKKAQLEAIKNIPDETIAYIADKIQSNIRELEGALIRVSAFSSLEQRDATPQLAAE
                     VLKDVIAPSKPKIITTPLIMQTVADFYGLRIEDLKAKKRTRSVAFPRQVAMYLARELT
                     DLSLPKIGDEFGGRDHTTVLHACDKITTDLSSDPVLQETIKELKKRIGE"
     gene            1923..3020
                     /locus_tag="Dred_0002"
     CDS             1923..3020
                     /locus_tag="Dred_0002"
                     /EC_number="2.7.7.7"
                     /note="KEGG: dsy:DSY0002 DNA polymerase III beta chain;
                     TIGRFAM: DNA polymerase III, beta subunit;
                     PFAM: DNA polymerase III, beta chain"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III, beta subunit"
                     /protein_id="ABO48554.1"
                     /db_xref="InterPro:IPR001001"
                     /translation="MKIICTRQNLIQGVTTAQRAVSAKNPLPILSGILLTAKDNKLKL
                     QATDLEMGIQCVVPCTTQEEGSIVLPAKYLSEIVRRLPDSPIQIESNQGTNVIIRYGQ
                     SEITINGFDAEEFPTFPKPQSKNSLTIPEEELKEYLRQILFATLSDENRPVFTGVLME
                     ILNGTLRLVTTDTHRLAMREIKDSSVDNDINIIIPGKTLNELTRVIGAADQQVTISLG
                     ENQIIFGMEDTLLISRLIEGQFPNYRQVIPQGHKTRIRLKTKDLLEASERASLLARVG
                     TQIIRLNIEEEKIILTANTEVGRIHEEVPVYLQGESLQISFNAMYLIDALRAIGSDNI
                     YFDLSGPLSPGILRPVEGDDYLSLILPVRTT"
     gene            3033..3245
                     /locus_tag="Dred_0003"
     CDS             3033..3245
                     /locus_tag="Dred_0003"
                     /note="PFAM: RNA-binding S4 domain protein;
                     KEGG: gsu:GSU0464 S4 domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA-binding S4 domain protein"
                     /protein_id="ABO48555.1"
                     /db_xref="InterPro:IPR002942"
                     /translation="MTQPIKVNKDIRLDQFLKWANITGSGGESKILIQSGHVKVNGIT
                     EIRRGKKLQSNDIVEVDGAGNFLVVM"
     gene            3256..4371
                     /locus_tag="Dred_0004"
     CDS             3256..4371
                     /locus_tag="Dred_0004"
                     /note="TIGRFAM: DNA replication and repair protein RecF;
                     PFAM: SMC domain protein;
                     KEGG: bcz:BCZK0004 DNA replication and repair protein"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA replication and repair protein RecF"
                     /protein_id="ABO48556.1"
                     /db_xref="InterPro:IPR001238"
                     /db_xref="InterPro:IPR003395"
                     /translation="MRVKKLSLRNFRNYKEAQFIPHPSINIITGPNAQGKTNLLEAIY
                     YSLRGCSFRAEKDRDVTNWESNHTVINTEVNLSSRLIKLQWKIQEGSKKLSLNGVERP
                     RSELDLFGVVLFCPEDLSLIKGSPQERRHFLDYEVGTLSPGYSQLWRQYAKILSQRNS
                     LLKEIRDHRSKQEVLEVWDEQLYRYGAKVIYLRLQVLKKLIPIARKTHFGLTGGTEEL
                     QAKYLSSLVLEPGLSEGQIYQVFSSSSKKIRQMELKRCQTLLGPHRDDLSLAINGVEA
                     KTFGSQGQQRTVTLSLKLSQLDLWYHEFGEYPVLLLDDVLFELDRSRQNMLIDKILNK
                     VQTFITTSFTGGIEETIKGAGLLWQVNAGSLTQKEEF"
     gene            4371..4634
                     /locus_tag="Dred_0005"
     CDS             4371..4634
                     /locus_tag="Dred_0005"
                     /note="KEGG: tte:TTE0005 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABO48557.1"
                     /translation="MFLHLGGDVVVLKKDIIAILDARTKNSAITKEFIEIAKDEGFIQ
                     PISNQDKEKSFVITTKEIYVSPISCTTLKKRSDNILENNEDEE"
     gene            4808..6724
                     /locus_tag="Dred_0006"
     CDS             4808..6724
                     /locus_tag="Dred_0006"
                     /EC_number="5.99.1.3"
                     /note="KEGG: chy:CHY_2705 DNA gyrase, B subunit;
                     TIGRFAM: DNA gyrase, B subunit;
                     PFAM: DNA gyrase, subunit B domain protein; ATP-binding
                     region, ATPase domain protein domain protein; TOPRIM
                     domain protein; DNA topoisomerase, type IIA, subunit B,
                     region 2 domain protein;
                     SMART: DNA topoisomerase II"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase subunit B"
                     /protein_id="ABO48558.1"
                     /db_xref="InterPro:IPR000565"
                     /db_xref="InterPro:IPR001241"
                     /db_xref="InterPro:IPR002288"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR006171"
                     /db_xref="InterPro:IPR011557"
                     /db_xref="InterPro:IPR011558"
                     /db_xref="InterPro:IPR013506"
                     /translation="MDQQQQNNKYSADQIQVLEGLEAVRRRPGMYIGSTSARGLHHLV
                     YEVVDNSIDEALAGYCDKIIVTIQEDNSITVEDNGRGIPVDLHPKVGRPAVEVVLTML
                     HAGGKFGGGGYKVSGGLHGVGVSVVNALSKYLSVEIKRNGKIYKQEYSRGIPTTELQI
                     VGNSKTTGTKVTFKPDEEIFEELVFSLETLSQRIRELAYLNKGIKIILQDKRKDPVAE
                     QIFQYDGGIKDFVKHLNRNKQTIHTKPIYVSGEKEQIVVEVAIQYNDGYTENMLSYAN
                     NIHTVDGGTHEVGLKTALTRVINDYGRQHGVLKNNDANLSGEDIREGATIVISVKVPE
                     PQFEGQTKTKLGNSEVRGIVDSIFAEKLSTYLVENPSVAKKIIEKGITAARAREAARK
                     ARELTRRKSALETMSLPGKLADCSEKDPSVSEIYLVEGDSAGGSAKQGRERRFQAILP
                     LKGKILNVEKARMDKILANEEIRAMITAMGTGIGEDFDIAKARYHKIVIMTDADVDGA
                     HIRTLLMTFFYRYMRQLIEAGYVFVAQPPLYRVRKGKHDSYCYSDNELEELLNRIGHD
                     RVNIQRYKGLGEMNPEQLWETTMDPDTRTMLQVTLEDAIEADATFSMLMGDRVEPRRD
                     FIQENAKYVRNLDI"
     gene            6995..9451
                     /locus_tag="Dred_0007"
     CDS             6995..9451
                     /locus_tag="Dred_0007"
                     /EC_number="5.99.1.3"
                     /note="TIGRFAM: DNA gyrase, A subunit;
                     PFAM: DNA gyrase/topoisomerase IV, subunit A; DNA gyrase
                     C-terminal repeat, beta-propeller;
                     KEGG: chy:CHY_2704 DNA gyrase, A subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase subunit A"
                     /protein_id="ABO48559.1"
                     /db_xref="InterPro:IPR002205"
                     /db_xref="InterPro:IPR005743"
                     /db_xref="InterPro:IPR006691"
                     /translation="MASLTGKVIPLDINNEMKNSYLDYAMSVIVGRALPDVRDGLKPV
                     HRRILYSLHELGLTPDKSYRKSAGIVGKVMQDFHPHGDSAIYDAMVRLAQDFASRYPL
                     IQGHGNFGSIDGDPPAAMRYTEARMAKITLEMLADIDKETVDFAPNYDNRTEEPTILP
                     SKIPNLLVNGSSGIAVGMATNIPPHNMGEVIDGVLMMIKDPNVTPDDLMKVIKGPDFP
                     TGATIMGKDGIRQAYRTGRGSVKMRAQTTIETKANGRPVIIVNEIPYQVNKAKLIEKI
                     AELVKDKKIEGISDLRDESDRRGMRIVIELKKDSNPNVILNLLYKHTQMQESFGIIML
                     ALVNNEPKVLNLAQVIFHYLEHQKDVITRRTRYELKKAEARAHIVEGLRIALANLDEV
                     IKTIRESKNTEEARRGLVDKFNLTEIQAEAIVEMRLRSLTALEVEKLEKEYKELLEKI
                     DYLRSILADEQKVLNIIRDELLVVKEKFADARRTLISNVAAGDFDIEDLIDEEDMVVT
                     ITNQGYIKRISMDTYRSQKRGGKGITAMGTKEEDFVRDLFIASTHHFLLFFTNKGKVY
                     RLKVYEVPEASRTAKGTPIINLLSFDSDEYVTTVIPIKEFEETAYLFMATKHGIVKKT
                     ALTEYNSSRRDGLIAINLDEKDKLVAVELTHGKEEIIMCTQEGIAIRFSEEDVRPMGR
                     VTRGVKGITLSQNDHVVKMDVIKEGASLLTVTANGYGKRTPMDEYRIQARGGKGIINI
                     KTTKRNGAVTGVLVVSEEDEVMMISAEGIIIRINVKDVSSMGRNTQGVTLMRTGENDH
                     IVAIAKVITEENEEKKILDI"
     gene            10048..11659
                     /locus_tag="Dred_R0001"
     rRNA            10048..11659
                     /locus_tag="Dred_R0001"
                     /product="16S ribosomal RNA"
     gene            11738..11814
                     /locus_tag="Dred_R0002"
                     /note="tRNA-Ile1"
     tRNA            11738..11814
                     /locus_tag="Dred_R0002"
                     /product="tRNA-Ile"
     gene            11832..11907
                     /locus_tag="Dred_R0003"
                     /note="tRNA-Ala1"
     tRNA            11832..11907
                     /locus_tag="Dred_R0003"
                     /product="tRNA-Ala"
     gene            12068..15659
                     /locus_tag="Dred_R0004"
     rRNA            12068..15659
                     /locus_tag="Dred_R0004"
                     /product="23S ribosomal RNA"
     gene            13433..13786
                     /locus_tag="Dred_0008"
     CDS             13433..13786
                     /locus_tag="Dred_0008"
                     /note="PFAM: S23 ribosomal protein;
                     KEGG: chy:CHY_0463 intervening sequence, 23S rRNA"
                     /codon_start=1
                     /transl_table=11
                     /product="S23 ribosomal protein"
                     /protein_id="ABO48560.1"
                     /db_xref="InterPro:IPR008815"
                     /translation="MIKDYHDLEVYKRGYKLALQIHKTTKGFPQHELYEIGSQIRRAA
                     VSIPLNIAEGYGRKNYVDDFKRFLINALGSCNEVAVLLDMIKDLGYISDQYEGFKEEY
                     DHLGRQLNKLIQTWK"
     gene            15847..15963
                     /locus_tag="Dred_R0005"
     rRNA            15847..15963
                     /locus_tag="Dred_R0005"
                     /product="5S ribosomal RNA"
     gene            16219..17436
                     /locus_tag="Dred_0009"
     CDS             16219..17436
                     /locus_tag="Dred_0009"
                     /note="PFAM: metal-dependent phosphohydrolase, HD sub
                     domain;
                     SMART: metal-dependent phosphohydrolase, HD region;
                     KEGG: swo:Swol_2407 HD domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="metal dependent phosphohydrolase"
                     /protein_id="ABO48561.1"
                     /db_xref="InterPro:IPR003607"
                     /db_xref="InterPro:IPR006674"
                     /translation="MQHFLTNYYKLLSSLSLAMDFSTNGLMRHHQRVALISLQIGKLY
                     GLNIYQQEKLFTAAILHDAGSSSWNEKDLLFDFFTTGTFKHCKKGYELFKNHSLFKSI
                     ADIVLYHHDRWDGRNNASGLKREEIPIESRIIHLSDRIDVLIREDIYILEQKEYICRQ
                     INQEKNKIFDPQLVEAFNDISNRECFWLDLHSPFLNEILSHHCPVITKELGLAEVLSV
                     ADTMSKVIDFKSPFTRRHSSGVANVASFLALKAGFSAEQCDIIKVAGLLHDLGKLGIP
                     DSVLDKPGKLTKSEFNIMKRHTYYTYHILKMIDKFDTINHYASSHHETLSGRGYPFKL
                     DGSDLENGARIVAVADIFSALTEIRPYRQAMEKAKVINILSNQVKAGAIDSELTSLLL
                     ANYEGAHILNEIS"
     gene            17807..18691
                     /locus_tag="Dred_0010"
     CDS             17807..18691
                     /locus_tag="Dred_0010"
                     /note="TIGRFAM: pyridoxine biosynthesis protein;
                     PFAM: Vitamin B6 biosynthesis protein;
                     KEGG: chy:CHY_2703 pyridoxine biosynthesis protein"
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxal phosphate synthase yaaD subunit"
                     /protein_id="ABO48562.1"
                     /db_xref="InterPro:IPR001852"
                     /translation="MAEKGTWTVKKGLAEMLKGGVIMDVTTPEQAKIAEEAGACAVMA
                     LERVPADIRAAGGVARMADPNIILRIMDAVTIPVMAKARIGHFVEAQILEALGADYID
                     ESEVLTPADEVFHIDKHQFKVPYVCGARNLGEALRRIGEGAAMIRTKGEPGTGNVVEA
                     VRHMRQVMSEIRMVHNMPKDELMTAAKEMGAPYDLVLQVHELGKLPVVNFAAGGIATP
                     ADAALMMQLGCDGIFVGSGIFKSNDPVSRAKAIVAATTHYNDPKILAEISKDLGEAMP
                     GMEISSIPTEHRMQERGW"
     gene            18699..19265
                     /locus_tag="Dred_0011"
     CDS             18699..19265
                     /locus_tag="Dred_0011"
                     /note="PFAM: SNO glutamine amidotransferase; CobB/CobQ
                     domain protein glutamine amidotransferase;
                     KEGG: chy:CHY_2702 glutamine amidotransferase, SNO family"
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxal phosphate synthase yaaE subunit"
                     /protein_id="ABO48563.1"
                     /db_xref="InterPro:IPR002161"
                     /db_xref="InterPro:IPR011698"
                     /translation="MVIGVLALQGAFIEHQKSLAACGVDSIQVRKPHQLEDIQGLIIP
                     GGESTTMGKLMNQFELFEPIVEKAHNGLPLFGTCAGMIMLAKDIAGSTQPRLGLMDIE
                     VERNAFGRQVESFETELTISELGEAPVRAVFIRAPYIKSVAANVKVLAKYNEKIVLAQ
                     QDHYLVAAFHPELTNDVRLHQHFLKMIK"
     gene            19566..19859
                     /locus_tag="Dred_0012"
     CDS             19566..19859
                     /locus_tag="Dred_0012"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABO48564.1"
                     /translation="MKFVNLNKLGKWVVTLAVIFSFMFGTLLENKLQVMANLQNIVEN
                     VNAVALPAGNKIKERFDAYYKEAEKTYEALKIGTAISMAILLSSLPKTTNRGP"
     sig_peptide     19566..19676
                     /locus_tag="Dred_0012"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.870) with cleavage site probability 0.496 at
                     residue 37"
     gene            20292..21449
                     /locus_tag="Dred_0013"
     CDS             20292..21449
                     /locus_tag="Dred_0013"
                     /EC_number="2.6.1.1"
                     /EC_number="2.6.1.52"
                     /note="PFAM: aminotransferase, class V;
                     KEGG: chy:CHY_2699 soluble hydrogenase, 42 kDa subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="L-aspartate aminotransferase apoenzyme /
                     phosphoserine aminotransferase apoenzyme"
                     /protein_id="ABO48565.1"
                     /db_xref="InterPro:IPR000192"
                     /translation="MMKDKKYLLIPGPTQVPPRVVEAMSRPIIGHRSAEFQGVVERVT
                     GKLKKVFQTENHVFILGSSGTGALEAAVANLVNPGDKVLALSCGKFGERFRDLAKIYG
                     GEVDFVDFGWGYDIDLNIVKKKLEENPDIKVVLATQNETSTGVQNDIEGLGKLVAQYE
                     AVLAVDAVSGLAAIDLKTDEWHVDVVVSGSQKAFMLPPGLAFVSVSDKAWKKIEQNTS
                     PKYYFDLLKAKKSIAKWNTAYTTPVTMVYGLEAALDMILEEGLDNVFARHKLLAKATR
                     AAIQGLGLELLAPEDCASMAVTAVQAPMVVDADTLRKVLLRDYGVTFAGGQDMMKGKI
                     FRIAHMGFADKMDVIIAISALEMALGKCGYKAELGAGVREAQMVFVGGDHA"
     gene            21449..23029
                     /locus_tag="Dred_0014"
     CDS             21449..23029
                     /locus_tag="Dred_0014"
                     /EC_number="1.1.1.95"
                     /note="TIGRFAM: D-3-phosphoglycerate dehydrogenase;
                     PFAM: amino acid-binding ACT domain protein; D-isomer
                     specific 2-hydroxyacid dehydrogenase, catalytic region;
                     D-isomer specific 2-hydroxyacid dehydrogenase,
                     NAD-binding;
                     KEGG: chy:CHY_2698 D-3-phosphoglycerate dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="D-3-phosphoglycerate dehydrogenase"
                     /protein_id="ABO48566.1"
                     /db_xref="InterPro:IPR002912"
                     /db_xref="InterPro:IPR006139"
                     /db_xref="InterPro:IPR006140"
                     /db_xref="InterPro:IPR006236"
                     /translation="MKVLVMDGVSEQGLAPLRQHTDIEVVIGEKMTEDQLVEVIGEYD
                     AMIVRSATKVTPRVVEAAKKLKVIGRAGVGVDNIDRNAATNKGIVVVNAPDGNTIAAA
                     EHTMAMMLGLARKVPAACGKLKNGIWDKKAFLGVELRGKTLGVIGLGRIGTAVAKRAQ
                     AMEMNIVAYDPYISEDHARKMAVEIVTLQELFKRADFITIHMPKTKETYHMINEEALE
                     LMKDGVRIINCARGGIVDEEALYKFMEAGKVAGAALDVFETEPCTDNPLLKLDNFIAT
                     PHLGASTQEAQINVAVDVAEEIVAALRGDLVKNAVNMPSMSPKLLAKIRPFLDLAEKL
                     GTFQAQMLDGRIEKVEVVYSGELAKYDVNPVTTILLKGLLDPILQENVNFVNATLVAR
                     NRGISVVQTTKENGEDYHNLITVYIYTDKGRRMLSGTLFQGNDPRIVNIDGFRINAAT
                     QGHMLVVPHIDKPGIVGKVGTVVGDMAINIAGMQVGRIELGGKAIMVMMVDNTLPTNA
                     LEQLATIDGILEVKMVSL"
     gene            23222..24496
                     /locus_tag="Dred_0015"
     CDS             23222..24496
                     /locus_tag="Dred_0015"
                     /EC_number="6.1.1.11"
                     /note="KEGG: chy:CHY_2697 seryl-tRNA synthetase;
                     TIGRFAM: seryl-tRNA synthetase;
                     PFAM: tRNA synthetase, class II (G, H, P and S);
                     seryl-tRNA synthetase, class IIa"
                     /codon_start=1
                     /transl_table=11
                     /product="seryl-tRNA synthetase"
                     /protein_id="ABO48567.1"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR002317"
                     /db_xref="InterPro:IPR006195"
                     /translation="MLDIKFVRSNPELVLEGLKKRGSDISLDEFLKLDSMRREKLVVA
                     EQLKNTRNVVSQEIGKLKKAGQDAEEKTLEMRKVSQKIKDMDDEIRNIEEKLQEILLS
                     IPNIPHESVPVGKDENDNVEIRRWGKPRGFEFEPKPHWDLGEDLNILDFERGGKVTGA
                     RFSFYKGMGARLERALINFMLDLHTREHGYTEIFPPFIVNGDSMLGTGQLPKFAEDMF
                     KLEGLNYYLIPTAEVPVTNLYRDEILAEEQLPIYHCAYSACFRAEAGAAGRDTRGLIR
                     QHQFNKVELVKFSKPEESFDELERLTANAEKILQALGLPYRVVLLSTGDMGFTSAKTY
                     DLEVWLPSYNAYKEISSCSNFLDFQARRANIKYRPTPKSKPEFVHTLNGSGIAVGRAL
                     SAILENYQEADGSITVPPVLVPYMGGIERITL"
     gene            24602..24691
                     /locus_tag="Dred_R0006"
                     /note="tRNA-Ser1"
     tRNA            24602..24691
                     /locus_tag="Dred_R0006"
                     /product="tRNA-Ser"
     gene            24708..24801
                     /locus_tag="Dred_R0007"
                     /note="tRNA-Ser2"
     tRNA            24708..24801
                     /locus_tag="Dred_R0007"
                     /product="tRNA-Ser"
     gene            complement(24816..25547)
                     /locus_tag="Dred_0016"
     CDS             complement(24816..25547)
                     /locus_tag="Dred_0016"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABO48568.1"
                     /translation="MDNEHNRFECGLKYIVLVNILIFLFFFFVQIVHVPIYHITDQQE
                     YILHFAEKVNSSMVILFLSVVVFSTIVIAIVFRSNIKLNIKKDQLLVDVGIQEKDFSQ
                     GIDGIKKVVDEHGNIPLYNSEVYRQLTKDYIISEVNKEGKPERFITMESYLSGFMQLC
                     ESANCHNHNITPQNLKIDKVYAPTEYVQVGDQLLTIIKKMNKNKLSALPVVNKDGVMI
                     GSINYLQVLKLVTDAAKQQKTASIN"
     gene            25698..25774
                     /locus_tag="Dred_R0008"
                     /note="tRNA-Arg1"
     tRNA            25698..25774
                     /locus_tag="Dred_R0008"
                     /product="tRNA-Arg"
     gene            25832..25908
                     /locus_tag="Dred_R0009"
                     /note="tRNA-Arg2"
     tRNA            25832..25908
                     /locus_tag="Dred_R0009"
                     /product="tRNA-Arg"
     gene            25960..26036
                     /locus_tag="Dred_R0010"
                     /note="tRNA-Arg3"
     tRNA            25960..26036
                     /locus_tag="Dred_R0010"
                     /product="tRNA-Arg"
     gene            26061..26516
                     /locus_tag="Dred_0017"
     CDS             26061..26516
                     /locus_tag="Dred_0017"
                     /EC_number="3.5.4.-"
                     /note="PFAM: CMP/dCMP deaminase, zinc-binding;
                     KEGG: chy:CHY_2682 cytidine/deoxycytidylate deaminase
                     family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA-adenosine deaminase"
                     /protein_id="ABO48569.1"
                     /db_xref="InterPro:IPR002125"
                     /translation="MSHALFMREALIEAQKAAVKGEVPIGAVVVWKDEVIGRGYDLRE
                     SLCDASAHAEILAMRKAAKHLGDWRLNDATLYVTVEPCAMCAGAIVQFRINRLVYGAP
                     NAKSGSVDTILNIVQEARFNHRVEVIAGILEDQCKEIIQNFFRELRKNK"
     gene            26520..26611
                     /locus_tag="Dred_R0011"
                     /note="tRNA-Ser3"
     tRNA            26520..26611
                     /locus_tag="Dred_R0011"
                     /product="tRNA-Ser"
     gene            complement(26734..27900)
                     /locus_tag="Dred_0018"
     CDS             complement(26734..27900)
                     /locus_tag="Dred_0018"
                     /note="PFAM: phage integrase family protein;
                     KEGG: chy:CHY_1702 prophage LambdaCh01, site-specific
                     recombinase, phage integrase family"
                     /codon_start=1
                     /transl_table=11
                     /product="phage integrase family protein"
                     /protein_id="ABO48570.1"
                     /db_xref="InterPro:IPR002104"
                     /translation="MATIKFNEKKGYYEVRYDAGFDGNGKRIQKYKGGFKKERDAKLF
                     AAQLTVNISQGTHIEPNKMFLFEYLNNWLEEKKETISPTSYCGYEVNIRCHINPYIGG
                     IKLSDLRAAHIRGLYSKLQKAREIKIDGEKRSFKPLSGTSIRYVHRVLSKALEDAYRE
                     ETIPKNPAKLVTPPTKNKFEAGFLSTKQIREMLDKLREDALYMPVYLSVVLGARRGEV
                     LGLQWSDVDMENKLIHIRHNLIMDNGNPVLREKTKTDSSNRVIVVTDRLIKALKEHKL
                     KLKQKEMKLQHGQLYHKSDFVCTWPDGKPFNPSHLSRSFSLRLQKYGLPNIRFHDLRH
                     SNAALMIAQNVPMKGASDRLGHSTIQITNDLYGHTERSVQEEIAIKIDQAIWGS"
     gene            complement(27993..28400)
                     /locus_tag="Dred_0019"
     CDS             complement(27993..28400)
                     /locus_tag="Dred_0019"
                     /note="PFAM: protein of unknown function DUF955;
                     KEGG: bcz:BCZK3460 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF955"
                     /protein_id="ABO48571.1"
                     /db_xref="InterPro:IPR010359"
                     /translation="MDQAINKLIRKFKTNDPFTIANGLNIEAWFEDLGVGTRGLYYNK
                     LRRRYIVIHCALSDEWQRFICAHELAHDRLHPGLSRFWLDEHSLFNPGKYERQANKFA
                     VKLLLSKTEIYPGETLENVFRRNYIPVEMLQYY"
     gene            complement(28384..28809)
                     /locus_tag="Dred_0020"
     CDS             complement(28384..28809)
                     /locus_tag="Dred_0020"
                     /note="PFAM: helix-turn-helix domain protein;
                     KEGG: tte:TTE2125 predicted transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, XRE family"
                     /protein_id="ABO48572.1"
                     /db_xref="InterPro:IPR001387"
                     /translation="MSRNISGTKIAKELNITPTYFYEIERGKKRLSAEMAAKLAAIFN
                     VTIDYLLGHDEQPVNNDHAEAAIPTWATSKYKRDFKQMLEDDAPLMFDGVPIRKEDKE
                     KIKRVMEAMFWDAKEKNKKTYGRKKKKNNAGDDLSGPSH"
     gene            28943..29466
                     /locus_tag="Dred_0021"
                     /pseudo
     gene            29603..29788
                     /locus_tag="Dred_0022"
     CDS             29603..29788
                     /locus_tag="Dred_0022"
                     /note="KEGG: chy:CHY_2518 ISChy6, transposase"
                     /codon_start=1
                     /transl_table=11
                     /product="ISChy6, transposase"
                     /protein_id="ABO48573.1"
                     /translation="MDEKVRESVALFRYGIIAPILNDQVTSQKDYLAEIASKKHQVPH
                     YGLKEYTPKAIATWLLA"
     gene            30026..30846
                     /locus_tag="Dred_0023"
                     /pseudo
     gene            30849..31649
                     /locus_tag="Dred_0024"
     CDS             30849..31649
                     /locus_tag="Dred_0024"
                     /note="SMART: AAA ATPase;
                     KEGG: chy:CHY_2519 general secretion pathway domain
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="AAA ATPase"
                     /protein_id="ABO48574.1"
                     /db_xref="InterPro:IPR003593"
                     /translation="MYKAFYSLSATPFTKDLKTSNSFASTSFTEVSARLDYLKKARGM
                     GLLVGEPGAGKTFSLRNFAESLNPSLYKVIYFPLSTGTVMDFFRGLAIGLGEEPKFRK
                     VDLFHQIQRAVLVYFRERKITPVFILDEMQMARNLFLHDLSILFNFGMDSESPFILIL
                     AGLPNLQSKLTLNHNRPISQRLIMRYKMEPLNKEEVANYIQHHMELAGARHQIFSEPA
                     VSAITSHSRGWPHLINNLATNCLLSGYQMKKELIDEEVVRVAVQEMSM"
     gene            32154..34043
                     /locus_tag="Dred_0025"
     CDS             32154..34043
                     /locus_tag="Dred_0025"
                     /note="PFAM: ATPase associated with various cellular
                     activities, AAA_5;
                     SMART: AAA ATPase;
                     KEGG: ter:Tery_3583 ATPase associated with various
                     cellular activities, AAA_5"
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase associated with various cellular
                     activities, AAA_5"
                     /protein_id="ABO48575.1"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011704"
                     /translation="MARISKSWFKDDTPGLIARKKVDWSVFETGCHIPVEYHEYFREA
                     NGGILPERGQSISVKLRLNEIDYDAVLTNVDRQGVAADTLQLRYQSNSVLRKQLLEVF
                     YPSYDFIKEKRLRNENRGKKQDIIVPDNRTEYIEFYKTDFPLIYQLKLIKWRKAGSVQ
                     EESPHCDSLFLAEPFSRIFINREEALWAFEMIASAANLLGIDSPEDQRLAVTIRNKYM
                     GLHINFGNWLLLGFYGPNKANRRLRLPLLEEKEQDSDIDNSYKFAQNQDEPAIASYLL
                     PMEKPVDNIQHRYVGAMKHIASRFKEYNKSPYRKHHLEQIAGAIFDRELLMRLLTEGL
                     YMQDELDESELATQDPLYITEEYSLEKLAADTETDPRELERWIKAIERKGQAILYGPP
                     GTGKTFLAKALARHLIGGSDGLVDLVQFHPAYAYEDFIQGIRPQVDNEGILKYPVLPG
                     RLLQFCQKARNRQGLCVLIIDEINRANLSRVFGELMYLLEYRDAEIPLASGGTFSLPR
                     NVRIIGTMNTADRSIALVDFALRIRFAFIPLQPNYEVLRRYHTKTGLGVEGLIETLMK
                     LNRRINDPNYVIGVSFFLRADLGEQLEDIWRMEIEPYIEEFFFDQPEKVEDFRWDKIR
                     EKVLS"
     gene            34228..35232
                     /locus_tag="Dred_0026"
     CDS             34228..35232
                     /locus_tag="Dred_0026"
                     /note="KEGG: ter:Tery_3582 McrBC 5-methylcytosine
                     restriction system component-like"
                     /codon_start=1
                     /transl_table=11
                     /product="McrBC 5-methylcytosine restriction system
                     component-like protein"
                     /protein_id="ABO48576.1"
                     /translation="MSRYLYLYLCPRVKLSNIFTMLEYAYRLKSFRILDGMVECDSLQ
                     EFYERLAMILAGMILNRNRQGLYREYREQVDKLPYIRGQLNIRHQLVKPWEVGFSCHY
                     QEHTADIEDNQILTWTLNRILYSGLCSDRGLPVIKKAYRSLLSQTSLIPLDPGRFSSR
                     VYSRLNQDYRPLHALCRFFLEQCGPGYEVGDHSMIPFLVDMPRLFELFVAQWLRTYLP
                     PEYEITPQERVEIGENGELTFSIDMVLYRKRDETAMCVMDTKYKSAATPTQADINQVV
                     TYAVAKGCRDAVLIYPSSNIRPFKETIGDITVKTLAFPLAGNLEEAGKRLVEKLISNL
                     "
     gene            35374..36351
                     /locus_tag="Dred_0027"
     CDS             35374..36351
                     /locus_tag="Dred_0027"
                     /note="KEGG: hch:HCH_01177 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABO48577.1"
                     /translation="MKYMLEIYLKENIDENITIQPWDGKKKIPLFLLEIYNFYETKIL
                     GQHCIIIEILQEAPGIDTIKKHIKVINRTVEQNLVFYYKSISWFRRKSLIQNRVPFVV
                     EDGQMYLPFLGLDLKNILYKQEKKITMFSSSTQLAFLYLLYNGNRTINATELAAVLNT
                     SKMTASRSLNDLYNFGLLTYVICGETKRSKEYKRIGDPEYYNEGSRYLKNPVWKTVYT
                     WKKIENSLVAGLEALSLISMMNPPRNPVIAISKERLSEIEPYLLKDRDRIIDEKLTEI
                     EVWNYDPRILSKENYVDLASLALSLKGINDERIEQALEERLKGEKWYMG"
     gene            36336..37112
                     /locus_tag="Dred_0028"
     CDS             36336..37112
                     /locus_tag="Dred_0028"
                     /note="KEGG: hne:HNE_0290 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABO48578.1"
                     /db_xref="InterPro:IPR000437"
                     /translation="MVHGIEKFKEYFSDYTGQYVFIGGTACSILLEEIGVSFRSTKDL
                     DMVLIIESLDEPFGIKFWEFIEDGGYEYRQKSTGKEHFYRFANPSKPGFPTMIELFSR
                     KPEKMQLHFDSLVTPIHIGDDVASLSAILLNDAYYNLLFKGKILVDGYSVLEMEYIML
                     FKIRAWLDLTIRLEAGEQIDSKNVKKHKNDIFRLLVNLTPSSKIEVEDEIYEDINRFL
                     EKITDDQPDLKNLGIKTVTFEELLNRIKELYIPMDKEGTL"
     gene            38097..38462
                     /locus_tag="Dred_0029"
     CDS             38097..38462
                     /locus_tag="Dred_0029"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABO48579.1"
                     /translation="MPTTEEIEKYLELVRLFIVEDKVDFIKGSDEKYTLGKLGISITD
                     AFEMVKDLDVKNYYRGPSPDHRYPSQQVWEFGIPEIFEDEIPPHRDLYVKLTFRNTRG
                     DLLMMSFHKARDLITYPYK"
     gene            38510..39514
                     /locus_tag="Dred_0030"
     CDS             38510..39514
                     /locus_tag="Dred_0030"
                     /note="KEGG: swo:Swol_2426 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABO48580.1"
                     /db_xref="InterPro:IPR001387"
                     /translation="MRNIYCGNCEKEVLGITKEDYFEYPVRNLVYKINGKRLFCPDCG
                     NELFHREYDEANQRAAFDLYRKETGIISPKEIKDIREKYELTQREFSYLLGFGEITVS
                     RYERGSLPTIAQSQIIKESIEPSKMLILLKENGHKIETERYIQTKNRLEEMIANKNVN
                     ENIEQYILRDMKNITTPELDVYNGFKRFDYKKFSQMVYFFALKEITSLYITKLNKLMF
                     YADYYYYKKFGTSLSGTRYIRHNYGPVPNKYQTLYDSIDTIEIFEDEYGNYIKPANDL
                     ALTFNDKEISILDLVNQKFKHMNSKEISNFSHKEKCWIETPHKQPISYLYSEFMECGL
                     "
     gene            complement(39595..39834)
                     /locus_tag="Dred_0031"
     CDS             complement(39595..39834)
                     /locus_tag="Dred_0031"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABO48581.1"
                     /translation="MRIIKSVQGINILRKADALPTEYLELLEKEFLQMVEQLGGFENY
                     DPKTYGYIVVLESGDNVRDLSVVGLTQVKEYINSF"
     gene            39909..40127
                     /locus_tag="Dred_0032"
     CDS             39909..40127
                     /locus_tag="Dred_0032"
                     /note="KEGG: chy:CHY_0930 heterodisulfide reductase,
                     subunit A, selenocysteine-containing"
                     /codon_start=1
                     /transl_table=11
                     /product="heterodisulfide reductase, subunit A,
                     selenocysteine-containing"
                     /protein_id="ABO48582.1"
                     /translation="MMANITRYCRSVCPFKAIEEKYNERTKRTLAVINTSLCQGCGAC
                     SSSWRCGAADIKGFSNTQIISEILALSW"
     gene            complement(40682..41290)
                     /locus_tag="Dred_0033"
     CDS             complement(40682..41290)
                     /locus_tag="Dred_0033"
                     /note="PFAM: transposase IS116/IS110/IS902 family protein;
                     KEGG: tte:TTE0235 transposase"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS116/IS110/IS902 family protein"
                     /protein_id="ABO48583.1"
                     /db_xref="InterPro:IPR003346"
                     /translation="MGVKRANKLMQAARESIGLSTGIEFARHEIKMLLEQYDTLCKQM
                     ETLMVAVQALLQQIPGTAEMMTIPGVGLVTVAEFLAEVGDLKGYEHGQQIIKLAGLNL
                     KENSSGKHKGQSQISKRGRPRLRALLFKTVLVMVAKNREFKAIHQYLITRHENPLKKK
                     QSIVALCGKLIRILFTIGSKKTPYDTEQVLGVVRQEQLQEAA"
     gene            complement(41281..41964)
                     /locus_tag="Dred_0034"
     CDS             complement(41281..41964)
                     /locus_tag="Dred_0034"
                     /note="PFAM: transposase, IS111A/IS1328/IS1533;
                     KEGG: bha:BH3704 transposase (03)"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase, IS111A/IS1328/IS1533"
                     /protein_id="ABO48584.1"
                     /db_xref="InterPro:IPR002525"
                     /translation="MNYKQKQRIEQLTESTLIIGADIAKSKHVARAQDFRGIELGKRL
                     IFDNTRAGLTKLMHWIRTLMVEHCKDHVLVGIEPTGYYWLPMAEFLRREGIPVVVVNP
                     LHVKRSKELDDNSPTKNDTKDARVIAQLVKDGRYSEPNLPTGVYSELRVGMAQRDRLN
                     QDLNRVKGRIHNWLDRYFPEYTGVFKDWEGKASLMILNTCPLPGKSSKQAQKPLWPCG
                     KLRLNGQWV"
     gene            42344..43342
                     /locus_tag="Dred_0035"
     CDS             42344..43342
                     /locus_tag="Dred_0035"
                     /note="PFAM: chemotaxis sensory transducer;
                     KEGG: chy:CHY_0886 methyl-accepting chemotaxis protein"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis sensory transducer"
                     /protein_id="ABO48585.1"
                     /db_xref="InterPro:IPR004089"
                     /translation="MFESFLGRNRKKESKAMVLEEKTRVETDNKRVETDNKKELIKEL
                     PTEDYYSTLEMAEAMGEMFYNMFNGENFVVVTDANFKVVKCWNSKNFNFNFKPGDTMP
                     QGTISYEALVSGKRIAKQIKKTESKFDFGYAGIGIPIKDKGHNIIGSLAITFLYIDPQ
                     ELRGVAEEMQTASDQNSQATGEIAAGATNLSTSSEMLTHNTDLARNSLKTINDVIELI
                     KGVAEQTNLLALNAAIEAARAGEHGKGFAVVAEEVRKLAQNSADRAKDMSEKLSTISK
                     MIEDIGEKTQDLNSLAQQQAASTEEINASMEQLEEQARKILTLAAELEKGLEFMLK"
     gene            43470..43670
                     /locus_tag="Dred_0036"
     CDS             43470..43670
                     /locus_tag="Dred_0036"
                     /note="PFAM: Cold-shock protein, DNA-binding;
                     SMART: Cold shock protein;
                     KEGG: gka:GK1356 cold shock protein"
                     /codon_start=1
                     /transl_table=11
                     /product="cold-shock DNA-binding protein family"
                     /protein_id="ABO48586.1"
                     /db_xref="InterPro:IPR002059"
                     /db_xref="InterPro:IPR011129"
                     /translation="MQKGTVKWFNAEKGYGFIETEEGSDVFVHFSAITGDGFKTLEEG
                     QRVSFNVVQGNRGPQAEEVVKL"
     gene            43752..45134
                     /locus_tag="Dred_0037"
     CDS             43752..45134
                     /locus_tag="Dred_0037"
                     /note="PFAM: helicase domain protein; DEAD/DEAH box
                     helicase domain protein;
                     SMART: DEAD-like helicases-like;
                     KEGG: btl:BALH_2206 ATP-dependent RNA helicase, DEAD/DEAH
                     box family"
                     /codon_start=1
                     /transl_table=11
                     /product="DEAD/DEAH box helicase domain protein"
                     /protein_id="ABO48587.1"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR014021"
                     /translation="MNDFLQLGIRRELNELLRVYGITEPTPIQKQTIPILLSGKDVIA
                     QAQTGTGKTLAFVLPILEKIDAKKSYIQALILTPTRELALQITTEVKKLASKMDANVL
                     AVYGGQDVERQNKRLQGNTHIVIATPGRLLDHLGRGTIRLTGVSMLVLDEADQMLHMG
                     FLNEVEKIIHQTSAKRQTMLFSATMPAEIRALSVKYMRKPMDIHVRGTGITLEKTKQI
                     AVETTDRTKQETLRKLLDEYQPYLGIIFCRTKRRASALNEMLLAHGYNSDELHGDLSQ
                     AKREQVMKRFREAKLQILVATDVAARGLDVEGVTHVFNYDIPQDVESYIHRIGRTGRA
                     GDTGLAVTFVSPRDRTDLQMIEKGIGMKLEKRSAHRQTIQEVPGDKTFVKKSTKEKAG
                     PYSTEKAMKNKKPLNGKLGFKKGKKNSTEAKSIKEVAPLKQKRRKESPLSKKRTSNKN
                     GNSRGKKLVK"
     gene            complement(45181..45870)
                     /locus_tag="Dred_0038"
     CDS             complement(45181..45870)
                     /locus_tag="Dred_0038"
                     /EC_number="1.97.1.4"
                     /note="KEGG: cno:NT01CX_0016 pyruvate formate-lyase
                     activating enzyme;
                     TIGRFAM: pyruvate formate-lyase activating enzyme;
                     PFAM: Radical SAM domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate formate-lyase activating enzyme"
                     /protein_id="ABO48588.1"
                     /db_xref="InterPro:IPR001989"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="InterPro:IPR012838"
                     /translation="MKGRIHSFESCGTVDGPGIRCVVFFQGCLLRCRYCHNPDTWDLL
                     GGQEMDSDEIVKKVRRFKSYFHNNGGITLSGGEPLLQPDFAFAILQQCKKEGIHTAVD
                     TSGCIDVGALEKILPFTDLLLLDVKAVDDSLYHWLTGGKAETFQMAVDYIRQQKTPLW
                     LRYVVLPGMNDSPEYRYRLEKLINSLGDQVKKVELLPYHTMGVHKWKKLGLVYPLNNL
                     KPATASTIANF"
     gene            complement(45889..48120)
                     /locus_tag="Dred_0039"
     CDS             complement(45889..48120)
                     /locus_tag="Dred_0039"
                     /EC_number="2.3.1.54"
                     /note="KEGG: cya:CYA_0477 formate acetyltransferase;
                     TIGRFAM: formate acetyltransferase;
                     PFAM: formate C-acetyltransferase glycine radical;
                     pyruvate formate-lyase, PFL"
                     /codon_start=1
                     /transl_table=11
                     /product="formate acetyltransferase"
                     /protein_id="ABO48589.1"
                     /db_xref="InterPro:IPR001150"
                     /db_xref="InterPro:IPR004184"
                     /db_xref="InterPro:IPR005949"
                     /translation="MKQAWSDFLGFKWQQEINVRNFIQCNYKPYEGKSNFLCEQTPKT
                     KQLWEKCLKLFQAERKNNGVLSINTSRATGINTFGPGFIDRDLELIFGLQTEKPLERS
                     VNPFGGLRMAKESCKAYGYSLDKQLEDFFVKYKKTHNDGVFDAYTPEMRLARSLGIIT
                     GLPDAYGRGRIIGDYRRVPLYGVDRLIEEKEKDLANMPTHTLTSQAIQLREEIREQIK
                     SLVDLKEMARQYGFDIGSPAANAKEAFQWLYFAYLGAIKEQNGAAMSLGRVSTFLDIY
                     IERDIEAGVLQETEAQELVDQFVIKLRLARQLRTPEYDKLFAGDPMWITEAIGGMGLD
                     GRTLVSKNSYRFLQTLINLGPAPEPNLTILWSDRLPENFKKFSAQISIKTSSIQYEND
                     DLMREYYGDDYGIACCVSAMKIGKQMQFFGARANLAKLLLLAINGGQDEMTGKQLAPP
                     IPSLDDDYLDYEKVMKNFLLLQDWLCKLYVNTLNIIHFMHDKYAYEKIQLALHDSDVE
                     RLMAFGMAGLSVVADSLSAIKYAKVYPIRNEEGIAVDFRIEGDFPKYGNDDDRVDDIA
                     VALVRSFNNNLQKYTTYRNAKHTLSILTITSNVMYGKKTGTTPDGRQKGEPFAPGATP
                     MHGRDVNGALASLNSVAKLPYNSSLDGISNTFSIVPAALGKTHEDREANLVNILRGYF
                     NQQAHHLNVNVLDRTTLERAMEEPENYPQLTVRVSGYAVHFTKLSRAHQLEVIKRTFF
                     ERF"
     gene            48513..49604
                     /locus_tag="Dred_0040"
     CDS             48513..49604
                     /locus_tag="Dred_0040"
                     /note="KEGG: mta:Moth_2363 putative transmembrane
                     transcriptional regulator (anti-sigma factor)"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transmembrane anti-sigma factor"
                     /protein_id="ABO48590.1"
                     /translation="MNCQVVLELLSPYLDGVLDPVEHATVQKHLASCPACSRELAELK
                     ACIDLLQELPDIAPPADFRAGLMEKIDRLPSSTKSNDQRNWFDCVNGVTRKSWYRTVA
                     VAAVMVMTLGVTSLWQNEGHQLIPVPNEAQEIAEQTNNQQARQEPLGDLQTTKPTSDT
                     VTKSVNKTPSKGKVEATNTKSQGFKAVPKQAEKATPVTLASQNDRRFVPENYQPQPSI
                     GMTARSVTLKLGVQDQSEALKSIGSITQSNNGSIMVPYNESNGKLAIKVPVQTSRSVE
                     SQLKQLGQVITDMPSERDLSGQHEQAVNALEQLKVQQSDLQKQLSEQSDPGLEQQLAN
                     LTTVINQQIGLIQRLEQQSNYSVITVTIE"
     gene            49815..49906
                     /locus_tag="Dred_R0012"
                     /note="tRNA-Ser4"
     tRNA            49815..49906
                     /locus_tag="Dred_R0012"
                     /product="tRNA-Ser"
     gene            50041..50141
                     /gene="ffs"
                     /locus_tag="Dred_R0013"
     misc_RNA        50041..50141
                     /gene="ffs"
                     /locus_tag="Dred_R0013"
                     /product="SRP RNA; RNA component of signal recognition
                     particle"
     gene            50452..52116
                     /locus_tag="Dred_0041"
     CDS             50452..52116
                     /locus_tag="Dred_0041"
                     /note="PFAM: phosphoribulokinase/uridine kinase;
                     KEGG: tte:TTE1778 uridine kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribulokinase/uridine kinase"
                     /protein_id="ABO48591.1"
                     /db_xref="InterPro:IPR000764"
                     /db_xref="InterPro:IPR006083"
                     /translation="MEIKVLLEGDQSFEVSQGTPVMELLKIRHKEGSVPVVAAFIDNV
                     LKDLRTPLTSDCHVRFVDLTMPEGVRVYRRSVTALLMRAISEILPGSNAVIQHSLGNG
                     IYGEIHYDRPLKDKDIARIERQMHYIIEADEPWVLMNLKKEDAERLLTEAGQTEKIQL
                     LHYLPKEEIELYSCGGYYDLCHGALVPSTGILKNFRLRFYLPGFILELPNLESPSKIP
                     PYIEQGKLANIHFEAKKWANILKVNNVVSLNDVVTKGDVGNLIRVSEAFHEKKIGEIA
                     DQISDNIDRIRIVLIAGPSSSGKTSFAQRLSTQLQVNGIRPVAISLDDYFVDREMTPR
                     DEEGNYDFESIFSIDIALFNDHLIKLIQGEEIELPYFNFKTGKREYHGERLQLGSADL
                     LVVEGIHGLNDMLTSSIPKGRKFKIYVSALTQINLDNQNRIPTTDVRLLRRIARDQRC
                     RGRSAGETISMWSSVRRGEEKNIFPFQESADVMFNSALPYELAVLKSVVEPHLKQITP
                     EYPEYAEAQRLLDFVSYFAPLGPDEVPLNSIVREFIGGSCFVGTVR"
     gene            52517..54139
                     /locus_tag="Dred_0042"
     CDS             52517..54139
                     /locus_tag="Dred_0042"
                     /EC_number="2.7.7.7"
                     /note="KEGG: bca:BCE_0020 DNA polymerase III, gamma and
                     tau subunits;
                     TIGRFAM: DNA polymerase III, subunits gamma and tau;
                     PFAM: AAA ATPase, central domain protein;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III, tau subunit"
                     /protein_id="ABO48592.1"
                     /db_xref="InterPro:IPR001270"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR012763"
                     /translation="MAYKALYRTWRPQYFSDIVGQRHITRTLQNALLQDKVAHAYLFC
                     GPRGTGKTTTAKVLAKALNCLVPTSGEPCNDCENCRAVNEGNSVDVVEIDAASNRGID
                     EIRDLREKVKFAPSTGEKKVYIIDEVHMLTDQAFNALLKTLEEPPSHVVFVLATTEAH
                     KVPVTILSRCQRFDFRRIKPDEMVGRLQEVAQGANIEVEEEALQLIAKAAEGGLRDAL
                     SILDQGAAFAEKTVTTEDIHSILGTVKQDILVKMTHCLAEGKAGEALKLVAEISNRGK
                     DLRLFGREMTSFLRGLLVEGIEGRHTGIGNETLFSILQVLVQAEQEMKWSSQPALVLE
                     LALVKAARPEIAGTTEALSRRVAELEKRLEQGVVITAPRETVAQVEERTLGVNKQAQP
                     DQTKISEPVEAVTSEPLVMAKTPIASDSATAEKIKKNWPALMKGIKEGKKMPLWSLLN
                     SHQPDLEVQGHTLIMYFQEDFDMRTADKPEYRKYMEWLLGKHFDGQWEVRCVHGKKSM
                     PRSAPTPENDPVYTEAVRIFGKDIVYLENDPD"
     gene            54179..54496
                     /locus_tag="Dred_0043"
     CDS             54179..54496
                     /locus_tag="Dred_0043"
                     /note="PFAM: conserved hypothetical protein 103;
                     KEGG: chy:CHY_2674 conserved hypothetical protein
                     TIGR00103"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein 103"
                     /protein_id="ABO48593.1"
                     /db_xref="InterPro:IPR004401"
                     /translation="MMGGNMNKMMKQVQKMQQDMAKMQEELGNRTVETTAGGGVVKVV
                     ASGKQEIISITIKPEAVDPDDVEMLQDLLITAVNDALRQSQEMVAKEMGKLTGGLNIP
                     GLF"
     gene            54738..55340
                     /locus_tag="Dred_0044"
     CDS             54738..55340
                     /locus_tag="Dred_0044"
                     /note="KEGG: sth:STH15 recombination protein;
                     TIGRFAM: recombination protein RecR;
                     PFAM: RecR protein; TOPRIM domain protein;
                     SMART: Toprim sub domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA replication and repair protein RecR"
                     /protein_id="ABO48594.1"
                     /db_xref="InterPro:IPR000093"
                     /db_xref="InterPro:IPR006154"
                     /db_xref="InterPro:IPR006171"
                     /translation="MLYYSGPVARLVDEFAKLPGIGPKTAQRLAFHVLNSPPELAQGL
                     AKALVEVRQSIKRCSLCCNLTDEDPCSICQDTTRNSNLLCVVEEPRDVIAMEKARGYR
                     GYYHVLHGAISPMEGIRPEDLTIKELLHRLQNGDIQEVILAANSDVEGETTALYLARL
                     LKPLGVKVTRIAHGIPVGSDLEYADAMTLNKALEGRGEFG"
     gene            55506..55844
                     /locus_tag="Dred_0045"
     CDS             55506..55844
                     /locus_tag="Dred_0045"
                     /note="KEGG: chy:CHY_2672 sigma-K processing regulatory
                     protein BofA"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABO48595.1"
                     /translation="MGFLMHVLLGVFSPWPMDKYKEGFALEWKTIVLSLLGLFGLYLF
                     GTIFARPLVLLGKLGLSLVVGGVLLALVNFVCSGLGIHIAMNPVTLITAGILQIPGIV
                     LLVLANYVVL"
     gene            56188..56880
                     /locus_tag="Dred_0046"
     CDS             56188..56880
                     /locus_tag="Dred_0046"
                     /note="KEGG: chy:CHY_0042 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABO48596.1"
                     /translation="MKKNGGGFAISARIVEAYVGEYASGKSEVAVNRALEIGRSGRKV
                     NLVDLDIVEPCYTLRPIKKELEESGLTVIAWETKDTVGLGEAGNIIKPESRWALYREG
                     DVILDIGYGVEGAKTLNLLEGVDETPELQIYAVLNAKRPMTSTVQEILDYIKELGPIH
                     GLINNTHLGDETTPEVVQEGAQIIGEVSKILGIPVVVTTADQEVAKKIGQVDGMGNPV
                     RPLTRYMPRTFW"
     gene            56958..58043
                     /locus_tag="Dred_0047"
     CDS             56958..58043
                     /locus_tag="Dred_0047"
                     /EC_number="1.2.7.3"
                     /note="PFAM: pyruvate flavodoxin/ferredoxin oxidoreductase
                     domain protein; Transketolase domain protein;
                     KEGG: chy:CHY_0043 putative keto/oxoacid ferredoxin
                     oxidoreductase, alpha subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="2-oxoglutarate ferredoxin oxidoreductase, alpha
                     subunit"
                     /protein_id="ABO48597.1"
                     /db_xref="InterPro:IPR002880"
                     /db_xref="InterPro:IPR005476"
                     /translation="MSEKPITGEKRAFMTGNEVVAWACLAAGADIMYGYPITPQNEIM
                     HYWTRQIPKYGRKFLQTEDELSAGFTTVGGVLAGLKAFTATAGPGNTLMQEPMSMAEM
                     MRLPVVTIVQQRGGPSTATVIYSQQEVTLTTQGGNGEGMRIVYSPSNHQELFDYTIKA
                     FNTAWKYRFPTFVLGDGYQAKLRESVTLYDPEEKGIERVPSEKYVGKPGTPGVDREPG
                     HYRNTYNTEEELFEVLQQHFADFEKMTPEVVEYAQDNVEDADLVIVAHGVVFRGVRDA
                     VKELREAGYKVGFFRPITLRPFPAEQLKAIANKTKKLLIAESAQGQLAKLVKDAIYGA
                     SAEIVPMFRPGVGITTEQIVAKVKEVL"
     gene            58074..58847
                     /locus_tag="Dred_0048"
     CDS             58074..58847
                     /locus_tag="Dred_0048"
                     /note="PFAM: thiamine pyrophosphate enzyme domain protein
                     TPP-binding;
                     KEGG: chy:CHY_0044 putative keto/oxoacid ferredoxin
                     oxidoreductase, beta subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine pyrophosphate enzyme domain protein
                     TPP-binding protein"
                     /protein_id="ABO48598.1"
                     /db_xref="InterPro:IPR011766"
                     /translation="MSVSPQPAMPKSWRVESKPHKFCPGCGHGLVLKCLGEAIDELGI
                     QDKVVFGCDIGCSLLSWDFFNCDSVQTHHGRTTPVMTGIKRANPDAICVAYMGDGGGY
                     AIGIGGIVNAAARNEKVTVLLANNTVYAMTGGQMSPCTMPGQKVETAPYGRDPEATGM
                     PTQGPEMISAITGDGAYVARGTTSNLKQLKSYIKKALQNQMEGNGFSFVEALAGCPTN
                     WRTNAEKTWAFIEKEMPQYYKVGEKKNPFEAKKEAQQNG"
     gene            58840..59403
                     /locus_tag="Dred_0049"
     CDS             58840..59403
                     /locus_tag="Dred_0049"
                     /note="PFAM: pyruvate ferredoxin/flavodoxin
                     oxidoreductase;
                     KEGG: chy:CHY_0045 putative keto/oxoacid ferredoxin
                     oxidoreductase, gamma subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate ferredoxin/flavodoxin oxidoreductase"
                     /protein_id="ABO48599.1"
                     /db_xref="InterPro:IPR002869"
                     /translation="MAKAVKICLAGEGGQGVQSVAEILAAAANAEGREALYIPNFGVE
                     QRGGVSIAYLQIADNAIGAPKFDKADILVALSDRAVRRCKQYVDANTVYVYDTSIEGV
                     EKDVPQEGEAKKVLAIPALEISKNELHPRVFNILIMGAVIGATGVIPVEAAKAAIEKK
                     LGYKFEQNPQLRELNFKAIDRGIELMK"
     gene            59415..59660
                     /locus_tag="Dred_0050"
     CDS             59415..59660
                     /locus_tag="Dred_0050"
                     /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
                     protein;
                     KEGG: chy:CHY_0046 putative keto/oxoacid ferredoxin
                     oxidoreductase, delta subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="4Fe-4S ferredoxin, iron-sulfur binding domain
                     protein"
                     /protein_id="ABO48600.1"
                     /db_xref="InterPro:IPR001450"
                     /translation="MEFKGRTLELTKADWTLFPGLCKGCGLCIQKCPKKCISWSKVLG
                     VYGTPSVEANDECIACGICQMVCPDTAIRVDKKKAQA"
     gene            complement(59762..60841)
                     /locus_tag="Dred_0051"
     CDS             complement(59762..60841)
                     /locus_tag="Dred_0051"
                     /note="TIGRFAM: spore germination protein;
                     PFAM: Spore germination protein;
                     KEGG: mta:Moth_1460 spore germination protein"
                     /codon_start=1
                     /transl_table=11
                     /product="spore germination protein"
                     /protein_id="ABO48601.1"
                     /db_xref="InterPro:IPR004761"
                     /translation="MQNQYISPKQCFLLLVGFTIGTATILVPTSAAALAHQDSWMTPP
                     LAAIPGLGLVAMLVALNRRFPGQSLVQYSSSILGIPGKLLGLLTIWFAFHLSSLVLRN
                     IGSYIHVAVLFETPLWVTHLFIVTLGTFALRLGIETITRAFSILMLLNIPFYLIIITF
                     STKTAKLDNLLPVLSHGWAPVIHASLNQATFPMGEIVLFGMVIFHIKDIKNLNLYLST
                     GLLTTALAGVFALATPVIVLGADMVARTADAVLISVTNASGSNLIVPLLALSWFIFSV
                     CKFLICYYAFVLSASHWARLSDYKPLIFPAGALIMVYSIIAYSNTIEEAEFAKRIWTV
                     YAIPFEYGIPLVLLIAAVVRAKGKG"
     sig_peptide     complement(60743..60841)
                     /locus_tag="Dred_0051"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.507 at
                     residue 33"
     gene            complement(60955..61200)
                     /locus_tag="Dred_0052"
     CDS             complement(60955..61200)
                     /locus_tag="Dred_0052"
                     /note="KEGG: mta:Moth_2039 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABO48602.1"
                     /translation="MLFNLLFISLAYIIIIILEVPRLVVQKMWRDLLAFSILLLPAMV
                     YSYGLALDIDMPNPTKLIEVIFEPLAKQLEQLLGTWT"
     gene            complement(61213..62421)
                     /locus_tag="Dred_0053"
     CDS             complement(61213..62421)
                     /locus_tag="Dred_0053"
                     /note="PFAM: spore germination B3 GerAC family protein;
                     KEGG: dsy:DSY4477 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="spore germination B3 GerAC family protein"
                     /protein_id="ABO48603.1"
                     /db_xref="InterPro:IPR000437"
                     /db_xref="InterPro:IPR008844"
                     /translation="MKAKLIPLLAIFFITFFSSGCWDHREAENTGIIIGAGIDQTEDG
                     KIIVIGQTMIPQQPGAGGGDKTGEVISFHNWYATGETLFDAIRDLTLQSPTPLFWSHA
                     QVIVFSERLARKGLLEAIDFLERDPEIKQSTWVLIAQGDLNDVMQTREMAFQPPTKIM
                     ADVIKTRNRNAKYAVTSLGDFLRTMDNPDTQPFTAGVNFFKGPMKDMNKLTSRVQEAP
                     REYEIKISDTAVFHEDKMVGWFNTKESRGLLFIKGEIKSGVLVLEKEKQRLSVEMFGS
                     SSKLKPVVQDGQLVMKVEIKVTGSLAEALPGIYELDKKVVKDIEQQMNTVVKEEVMAA
                     ITRAQELNTDVLGFGRVVHQHFPKEWDKELAQSWPELFKDLEVEVTVDGKIKTTGLIT
                     TSVNPRKKNK"
     gene            complement(62436..64070)
                     /locus_tag="Dred_0054"
     CDS             complement(62436..64070)
                     /locus_tag="Dred_0054"
                     /note="PFAM: Bacillus/Clostridium GerA spore germination
                     protein;
                     KEGG: mta:Moth_2042 GerA spore germination protein"
                     /codon_start=1
                     /transl_table=11
                     /product="GerA spore germination protein"
                     /protein_id="ABO48604.1"
                     /db_xref="InterPro:IPR004995"
                     /translation="MAFFQSLKNLGAAKKRKKPSPPGQDKPGENINPTQPYTREELIS
                     LKVDHNLNRNLNHINNLLGHNADYVQRKFVLGHDQTLEAAIIFLDSMIDPALLGGEIM
                     KPLLEPRLKDSSGSEMLKLLTNGGLISRAQMETFNHFQGVVSNVLTGEVALFVEGFAH
                     CFIISSKGYKSRSIPEPHYENAVRGPREAFVENISINISLLRKRLVTPNLVFENITLG
                     KISSTNISIVYIKGLASEGLIEEVRERLRRIETDAILESGYLESFIVDNPRSPFPQLG
                     NTERPDRVAGDLLEGRVAILTDTTPLVLIAPGELMSFLQTSEDYYTKYQWSTFVRWLR
                     FFSLFLALTLPSLYIAITTFHQEMLPTTLFVSVAAARKGVPFPAVVEALIMEVLFETI
                     REAAIRLPANISNTISIVGALVLGQAAVQANIVSPLMIIIVAATGVASFTIPQYSLST
                     AVRLIRFPLMLLSAVLGLFGLMVGLLAVLLHLCSLRSFGVPYLSPIAPFNWDGIKDTL
                     LRSAHWSKVNRPQELVQRNRQRMKENLQPGTPDKLG"
     gene            complement(64073..65182)
                     /locus_tag="Dred_0055"
     CDS             complement(64073..65182)
                     /locus_tag="Dred_0055"
                     /note="TIGRFAM: spore germination protein;
                     PFAM: Spore germination protein;
                     KEGG: bcz:pE33L466_0136 spore germination protein"
                     /codon_start=1
                     /transl_table=11
                     /product="spore germination protein"
                     /protein_id="ABO48605.1"
                     /db_xref="InterPro:IPR004761"
                     /translation="METWKISHWQAMGYMISIVFATAILFIPGITSKGAGPNAWLSLF
                     IALGFGLLVACLACSLGLRYPNKTVIDYSVDILGFPLGKLVGFIYIYYFFYAAYIVAR
                     EFSELMSTVYLPKTPPLVIALVLTLLSCLVLYLGLEVIVRANGIILFFSILTILLVFF
                     TYVWTINWSMLKPDFFKGIGPILYGSVSPAAWFGQTAVILMLMPFIKNQSGAKPASLL
                     AIFILFIMLESVIIVTVGIFGAATSSRLIFPLFYALAKPPEYIQAFLFQPSGFFMVIW
                     VPSMLLKLTTFFFAGVYGLAQWFNLKCYRPLVLPGGAFILLLSIVSWHNIIDLLNSSQ
                     YTVPLFITFANLGLTLILFSVSLIRHRNKNVKGRT"
     sig_peptide     complement(65078..65182)
                     /locus_tag="Dred_0055"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.834) with cleavage site probability 0.832 at
                     residue 35"
     gene            65437..65658
                     /locus_tag="Dred_0056"
     CDS             65437..65658
                     /locus_tag="Dred_0056"
                     /note="KEGG: tte:TTE0092 sigma-F transcribed protein CsfB"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABO48606.1"
                     /translation="MIINRAGGLVLMQEKSKCVLCKAAVQETNIGIRILGKYICTSCE
                     QKIINLSWDDPDYEAYKSGLKKIWRFNEA"
     gene            complement(65613..65882)
                     /locus_tag="Dred_0057"
     CDS             complement(65613..65882)
                     /locus_tag="Dred_0057"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABO48607.1"
                     /translation="MRQQKSPQIDEQALSKKYRTSVRKLIRLWKNGQSDVEIAAHTGI
                     DLFTLREVKNDIELAYRKYRLEKKKEALAKSQASLKRQIFLRPLL"
     gene            66116..67564
                     /locus_tag="Dred_0058"
     CDS             66116..67564
                     /locus_tag="Dred_0058"
                     /EC_number="4.1.1.19"
                     /note="PFAM: aminotransferase, class V; Cys/Met metabolism
                     pyridoxal-phosphate-dependent enzymes; Orn/Lys/Arg
                     decarboxylase, major region; aromatic amino acid
                     beta-eliminating lyase/threonine aldolase; Orn/Lys/Arg
                     decarboxylase domain protein;
                     KEGG: mta:Moth_2265 Orn/Lys/Arg decarboxylase, major
                     region"
                     /codon_start=1
                     /transl_table=11
                     /product="arginine decarboxylase"
                     /protein_id="ABO48608.1"
                     /db_xref="InterPro:IPR000192"
                     /db_xref="InterPro:IPR000277"
                     /db_xref="InterPro:IPR000310"
                     /db_xref="InterPro:IPR001597"
                     /db_xref="InterPro:IPR008286"
                     /translation="MKQNYAPLWEAIKKQVKAMTAQFHIPGHNSGRAIQQDFKEMAGQ
                     GVFQMDLTEIPGLDDLHNPQEAIAEAQALAADLYGADRSFFLVNGTSCGLMALILALC
                     GPGDKIIVPRNAHRSVASGLILSGAMPVYYQPVLIPEFGCLTGSNPQSIKDLLHKHPD
                     AKAVVAINPTYYGVAGDIAGVAEICHRAGVPLLVDEAHGAHFKFHPQLPLDGLSSGAD
                     AVVQSTHKTGGSLTQSSMLHLKGERIHWERVAEALRMVQSTSPSYLLMASLDLARMQM
                     AIQGKEMLNHTLELAYWCRKKLSNISGVQVLGAENLRVSGAKSLDYTRLTISLLNKGL
                     TGYRTADLLQRERGVVVEMADYASVVAVLSLGSNSKDCQRLVEGIRKIVSSESGQTLM
                     IPQSMLLPSPEVVLSPREAWQSRQKKVILESSLGQVCGETVAVYPPGIPVVCPGERIT
                     PTVLDYLLGVRRLGYKLQGPSDPTLKGLKVII"
     gene            67601..68224
                     /locus_tag="Dred_0059"
     CDS             67601..68224
                     /locus_tag="Dred_0059"
                     /EC_number="2.7.4.9"
                     /note="PFAM: thymidylate kinase;
                     KEGG: sth:STH3258 thymidylate kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="thymidylate kinase"
                     /protein_id="ABO48609.1"
                     /db_xref="InterPro:IPR000062"
                     /translation="MALIFIVFEGVDGSGKSTQLNLLNKYLSQKEIKTICTREPGGTP
                     VGEKIRELLLDPNFAEIQDRTEALLYSAARAQLVAQVIRPQLEQGTVVLCDRYIDSTL
                     AYQGYGRGMDISFLAQINELASGGLMPNITILLDLPPEEGLQRSRKDRPADRLENESL
                     TFYHKVRSGYLEMAKRKPDTYLVLDARQTMEQLHRQICCRVGGLLGV"
     gene            68217..69224
                     /locus_tag="Dred_0060"
     CDS             68217..69224
                     /locus_tag="Dred_0060"
                     /EC_number="2.7.7.7"
                     /note="TIGRFAM: DNA polymerase III, delta prime subunit;
                     KEGG: sat:SYN_02985 DNA polymerase III, gamma subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III, delta prime subunit"
                     /protein_id="ABO48610.1"
                     /db_xref="InterPro:IPR004622"
                     /translation="MCRLSNIIGHQQIIQTLKNAVQKSRVAHAYLFMGPPGIGKQTVA
                     RSFAQVLLCEAPQGGDACGNCKSCRQTDGGNHPDLHLLRPSGVTIKIEQIRELQRQVQ
                     YKPYQGIRHVFILEKSETMTQEAANCFLKTLEEPGSATVFILLSDQPYGLLPTILSRC
                     QQLQFRSLSNQEVSEGLRVLCQVARDRAEELAPLASGSIGRAIQLAGGEDQWPLREKA
                     LWLVQRFPQMSQYQALQAAEELSNDRSAAVEALEIMLLWFRDLLVYHYTRQKEILINQ
                     DKIDTLLEQENWYAPSKVVEIIEEIKLAKERLMANANTRMALEVMMLKINSYGGNNDV
                     G"
     gene            69214..70062
                     /locus_tag="Dred_0061"
     CDS             69214..70062
                     /locus_tag="Dred_0061"
                     /note="PFAM: PSP1 domain protein;
                     KEGG: chy:CHY_0052 putative tpl protein"
                     /codon_start=1
                     /transl_table=11
                     /product="PSP1 domain protein"
                     /protein_id="ABO48611.1"
                     /db_xref="InterPro:IPR007557"
                     /translation="MSVRVVGVRFKKAGKVYYFDPVEIPLQQGQHVVVETTRGIEYGE
                     VVVAPRDVPDEEVVAPLKQVLRQATPEDDQQVAENREKEQRAYEVALEKIALHQLPMK
                     LISVEQTFDGNKIIFYFTADGRIDFRELVKDLAAVFRTRIELRQIGVRDEAKMVGGLG
                     CCGRELCCSSWLADFAPVSIRMAKEQNLSLNPTKISGICGRLMCCLKYENDVYEEAKA
                     GYPDLGTQVLAPEGEGKIVAVNIFRNTVSVELQESKAIREYPLNELKIKKGRGECNCG
                     CPARQN"
     gene            70037..70351
                     /locus_tag="Dred_0062"
     CDS             70037..70351
                     /locus_tag="Dred_0062"
                     /note="PFAM: protein of unknown function DUF972;
                     KEGG: dsy:DSY0124 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF972"
                     /protein_id="ABO48612.1"
                     /db_xref="InterPro:IPR010377"
                     /translation="MAALPGRINRLEQALRQICDEVDRLKQEVKELEDENARLRREVA
                     GLYLEDGEVAEVKNKPGARNLWDLYDKGFHICNMYFGKGREGECLFCYALMNRGEERD
                     GA"
     gene            70341..71201
                     /locus_tag="Dred_0063"
     CDS             70341..71201
                     /locus_tag="Dred_0063"
                     /note="PFAM: Uroporphyrin-III C/tetrapyrrole
                     (Corrin/Porphyrin) methyltransferase;
                     KEGG: dsy:DSY0125 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Uroporphyrin-III C/tetrapyrrole
                     (Corrin/Porphyrin) methyltransferase"
                     /protein_id="ABO48613.1"
                     /db_xref="InterPro:IPR000878"
                     /db_xref="InterPro:IPR008189"
                     /db_xref="InterPro:IPR008190"
                     /translation="MEHKTQGILYLCATPIGNLEDITLRVLRILKEADCIAAEDTRHT
                     RKLLSHFDIHTPLVSYHSHSSEGKEEQLLDRLQQGENIALVSDAGMPGISDPGADLVR
                     LALEYGIEVVPLPGASAGIAALVASGLPTHKFIFEGFLSSQRKTRRKQLQALKWEQRT
                     LIFYESPHRLTDTLKDMVQEFGDRPGVVARELTKLHEEFKRGMLSELLIHYGHNHPRG
                     EICLLVAGISKEEATSGIEEEWCELSVREHVASLVEQGHNKKGAIKLVAQLRGMPKRE
                     VYAMVHGEDK"
     gene            complement(71256..71516)
                     /locus_tag="Dred_0064"
     CDS             complement(71256..71516)
                     /locus_tag="Dred_0064"
                     /note="TIGRFAM: transcriptional regulator, AbrB family;
                     PFAM: SpoVT/AbrB domain protein;
                     KEGG: chy:CHY_2622 transcriptional regulator, AbrB family"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, AbrB family"
                     /protein_id="ABO48614.1"
                     /db_xref="InterPro:IPR006339"
                     /db_xref="InterPro:IPR007159"
                     /translation="MKSTGIVRKVDELGRVVIPIELRRTLGIDEKDALEIYVDNEKII
                     LRKYEPACVFCGNASDVTHYKGKMVCHECIAAMGESVKKEVV"
     gene            71984..73540
                     /locus_tag="Dred_0065"
     CDS             71984..73540
                     /locus_tag="Dred_0065"
                     /EC_number="6.1.1.10"
                     /note="TIGRFAM: methionyl-tRNA synthetase;
                     PFAM: methionyl-tRNA synthetase, class Ia;
                     KEGG: chy:CHY_2621 methionyl-tRNA synthetase"
                     /codon_start=1
                     /transl_table=11
                     /product="methionyl-tRNA synthetase"
                     /protein_id="ABO48615.1"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR002304"
                     /translation="MVLKKPNFYITTPIYYPSDNLHIGHAYTTVAADTMARYKRLTGY
                     DVWFLTGSDEHGQKIERAAKNKNQTPKEYVDHIVSGFKKLWERLDVSYNDFIRTTDER
                     HHKVVQKFFQQLFDQGDIYKSEYEGWYCTPCETFFTEYQLAEGKCPDCQREVEKVREE
                     SYFFRQSKYAERWLKFIEENPEFIQPVSRRNEMVSFVKQGLEDLCVSRTTFDWGIRVP
                     FDPKHVVYVWVDALTNYISALGYDTGDNSLFQKFWPADIHLMAKDIVRFHAIIWPILL
                     MALDLPLPKKVIAHGWLLLDSGKMSKSKGNVVDPHVLIDKYGVDAVRYFLLRELPFGS
                     DGLYSEEALVKRINTDLANDYGNLLSRSATMMEKYQQGVLQTPGAPEGPDEELIDLAT
                     ATPKLVEEYMEKSELSNALAAIWQMVGRANKYLEETAPWTLAKNNETERLNTVLYNVA
                     EVMRFATIMITPFMPQLPKRVWPQLGIEDQTEIHTWESLRWGKLPVGTTVKRGEVLFP
                     RIDLKTLEQA"
     gene            73666..74439
                     /locus_tag="Dred_0066"
     CDS             73666..74439
                     /locus_tag="Dred_0066"
                     /note="TIGRFAM: hydrolase, TatD family;
                     PFAM: TatD-related deoxyribonuclease;
                     KEGG: bld:BLi00052 similar to proteins; RBL03161"
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase, TatD family"
                     /protein_id="ABO48616.1"
                     /db_xref="InterPro:IPR001130"
                     /translation="MLIDSHAHLDNERFLEDQAEVIARCKEKLTAVINVGYDLASSRR
                     SLELAETYPFIYAAVGVHPHDAKEASGNYLHQIKEMAGHPRVVAIGEIGLDYYYDLSP
                     RETQQRVFREQLRLAKELNKPYIIHNRDAHADIMQILREEAPYPAGGVMHCFSASWEI
                     AQECIKLGLYVSLAGPVTFSNAGKLKDIARQVPVDYLLVETDCPYLTPVPHRGKRNEP
                     VYVQHVVDHVAKLRNMAAEELSQITAENTCRLFNLPIVK"
     gene            74472..75002
                     /locus_tag="Dred_0067"
     CDS             74472..75002
                     /locus_tag="Dred_0067"
                     /EC_number="2.5.1.17"
                     /note="TIGRFAM: cob(I)alamin adenosyltransferase;
                     PFAM: ATP:corrinoid adenosyltransferase BtuR/CobO/CobP;
                     KEGG: chy:CHY_2619 cob(I)alamin adenosyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="cob(I)yrinic acid a,c-diamide
                     adenosyltransferase"
                     /protein_id="ABO48617.1"
                     /db_xref="InterPro:IPR003724"
                     /translation="MEKEQGLVLVFTGNGKGKTTAALGLAMRSWGHQMKILILQFIKG
                     RQCGEHLAAQRMKPGLEIRPLGMGFIQFHDPEDMKRQRIAASEAMKEVESTMLSGQYH
                     LLILDEILYAIKYGLIELGDVLSLLDNKPGSLHLVLTGRDVPPEIVERADLVTEMREI
                     KHPFKQGIPAQKGIEF"
     gene            complement(75252..76298)
                     /locus_tag="Dred_0068"
     CDS             complement(75252..76298)
                     /locus_tag="Dred_0068"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABO48618.1"
                     /translation="MPNGTVCQLVNLPVVIGDVVTSVTVENVTCLDEQAKKVDHIDVV
                     VRDLEGEPIFGGIPANTSGKPYPYPGHNSGQCTSPTATIHVGDAVCGPRELKGIRIFG
                     TIHKQIFYVNKLDDVRHMGEDIEFTKVIDLKPPLIVMNSQNIEIDFRNVDLSVDFDLH
                     KSIRIQQTATVSFLIKIVEATQMFISIFPNGCETATLGIQDTFEDFIGDVPSNWQGTN
                     VGPNPAGRTGEAVEIGVCPTRPASLAQNVPNVVGGQSYELTFWARSLEKMTDPCCFTL
                     LAQVMFLDASGNPISTVDQTIHSQDLSDTYRQFRITGTAPEGTASATIGFVFTPEPHN
                     TCSVLMDDLVFAPF"
     gene            76530..77357
                     /locus_tag="Dred_0069"
     CDS             76530..77357
                     /locus_tag="Dred_0069"
                     /note="PFAM: 3D domain protein; G5 domain protein;
                     KEGG: chy:CHY_2617 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="3D domain protein"
                     /protein_id="ABO48619.1"
                     /db_xref="InterPro:IPR010611"
                     /db_xref="InterPro:IPR011098"
                     /translation="MLWQEKACRLLLGVLCLQVAFFIYCLCCANHLVIIVDGRKIPVI
                     HFQGSVADALDKAQVTLRRADIVEPSLSSRVREDIHIFVTRVHTKEITNQEVIQYKIL
                     KKLDYNLHTGEQKVLQYGKIGLKRKYVQITYQNGKEVKRETLRTQVIRKPKPQVIAYG
                     AAKAVSRGVSRPTKGGAIRNYSNLVQDGKTITVVSTAYTNTGRRTATGVYPSEGMVAV
                     DPKVIPLGTKLYIEKYGFAVAADTGGDIKGNRVDVFFGSYNQAIKWGRRTVKVQILE"
     gene            77541..78470
                     /locus_tag="Dred_0070"
     CDS             77541..78470
                     /locus_tag="Dred_0070"
                     /note="PFAM: protein of unknown function DUF348; 3D domain
                     protein; G5 domain protein;
                     KEGG: chy:CHY_2617 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="3D domain protein"
                     /protein_id="ABO48620.1"
                     /db_xref="InterPro:IPR007137"
                     /db_xref="InterPro:IPR010611"
                     /db_xref="InterPro:IPR011098"
                     /translation="MNWCPVEWPTKPRPTLANIEAKQSGKKATMAGLLGLSVLVLMAS
                     VVLGYALWSQSITVSEIINETEGFIHEVVTGKLPVTLQVDGKTTVLQTTSKTVQGLLE
                     EQRIGLKPEDKVFPALSAPIKKNIKVQVIRVEVKKEYHNLPVPFTTERMASQEMPRGF
                     ARKVRNGKEGLQKEVWSVRYEDGVEVSRICEAREIIQQPVNALVQYGTLSNVNRGGEN
                     LRINRAMEMLATGYSYTGYNTATGVVPRPGIAAVDPRVIPLGTRLYVEGYGKATALDT
                     GGAIQGGRIDLFYETEAEALQWGKRNTRVYVLE"
     misc_binding    78543..78639
                     /note="TPP riboswitch (THI element) as predicted by Rfam
                     (RF00059), score 72.83"
                     /bound_moiety="thiamin/thiaminpyrophosphate"
     gene            78802..79605
                     /locus_tag="Dred_0071"
     CDS             78802..79605
                     /locus_tag="Dred_0071"
                     /note="TIGRFAM: phosphomethylpyrimidine kinase;
                     PFAM: Phosphomethylpyrimidine kinase type-1;
                     KEGG: cno:NT01CX_0246 phosphomethylpyrimidine kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphomethylpyrimidine kinase"
                     /protein_id="ABO48621.1"
                     /db_xref="InterPro:IPR004399"
                     /db_xref="InterPro:IPR013749"
                     /translation="MKNVLTIAGSDSCGGAGIQADIKTFSALGTYGMSVITAITAQNT
                     MGVFKVTELEEEIVAAQINCIYEDIKVDAVKIGMVSNSIIIKTIAQCLRKHAAKNIVI
                     DPVMVSKSKYKLLRPEACEALVSFLFPLAQVVTPNIPEAEVILGKRIQNVEHMQEAAV
                     AIHKMGPANVIVKGGHLPGDAVDVLFDGQKFTLLSDVRIATKNTHGTGCTFSSAIAAS
                     LAKGFNIREAFGAAKEYIHGAIENSFSIGQGVGPTHHFYSLYKRAGLVD"
     gene            79629..79865
                     /locus_tag="Dred_0072"
     CDS             79629..79865
                     /locus_tag="Dred_0072"
                     /note="TIGRFAM: thiamine biosynthesis protein ThiS;
                     PFAM: thiamineS protein;
                     KEGG: dde:Dde_1554 thiamine biosynthesis protein ThiS"
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine biosynthesis protein ThiS"
                     /protein_id="ABO48622.1"
                     /db_xref="InterPro:IPR003749"
                     /db_xref="InterPro:IPR010035"
                     /translation="MFKPYRCCGGIEVNIVYNGKVATLPDAMTIGQFIQEKGFNPNTI
                     IIEHNNRLIKKDDWSKLVLQENDQLEVLRFVGGG"
     gene            79870..80643
                     /locus_tag="Dred_0073"
     CDS             79870..80643
                     /locus_tag="Dred_0073"
                     /note="PFAM: thiazole biosynthesis family protein;
                     KEGG: mta:Moth_1663 thiazole biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="thiazole-phosphate synthase"
                     /protein_id="ABO48623.1"
                     /db_xref="InterPro:IPR008867"
                     /translation="MKEVFSVGGKELTSRLLIGSGKYSTNKLIPAILDASGSQVITMA
                     MRRVDTEFTEENILNYIPSDCVLMPNTSGARNAQEAIRIARLARAAGCGDWVKIEVIS
                     DNRYLLPDNYETIRATEVLTAEGFQVFPYMSPDLMVAKELERVGAAAVMPLGAPIGSN
                     RGLQTRELVRILIEEISLPVIVDAGIGRPSEAAEAMEMGAAAVLVNTAVATAKDPVAM
                     ARAFGLAVEAGRTAYLAGPGATQQVARASSPLTGFLREE"
     gene            80653..81759
                     /locus_tag="Dred_0074"
     CDS             80653..81759
                     /locus_tag="Dred_0074"
                     /note="TIGRFAM: thiazole biosynthesis protein ThiH;
                     PFAM: Radical SAM domain protein; biotin and thiamin
                     synthesis associated;
                     KEGG: mta:Moth_1664 thiazole biosynthesis ThiH"
                     /codon_start=1
                     /transl_table=11
                     /product="tyrosine lyase ThiH"
                     /protein_id="ABO48624.1"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="InterPro:IPR010722"
                     /db_xref="InterPro:IPR012726"
                     /translation="MGFYQECKEYQKSDFNSFFNKLTDEDIRRIIYKSRLSPWDYLAL
                     LSPVAERHLEEMAQRAQQLTLQHFGRSILLFTPLYLANYCVNQCVYCGFGAKNLINRK
                     KLTLDEVAAEAKAIAATGLKHILILTGESRVHSSVQYIRDCVEVLKEYFTSVSIEIYP
                     LEEEEYADLIATGVDGLTMYQEVYDEAEYDKIHLAGPKKNYRFRLEAPERACRAGIRT
                     VNIGALLGFYDWRSEAFLTGVHANYLQSQYPAVEVSISPPRMRPHVGGYMPREKITDK
                     NLVQYILAYRLFMPRGGITLSTRESAELRDHLLPLGVTKMSAGSSTNVGGHAGGEPST
                     SQFDISDERDVPAMVKMLYNQGYQPVFKDWQMLG"
     gene            81767..82375
                     /locus_tag="Dred_0075"
     CDS             81767..82375
                     /locus_tag="Dred_0075"
                     /note="TIGRFAM: thiamine biosynthesis protein ThiF;
                     PFAM: UBA/THIF-type NAD/FAD binding protein;
                     KEGG: sat:SYN_00438 ThiF family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine biosynthesis protein ThiF"
                     /protein_id="ABO48625.1"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="InterPro:IPR012729"
                     /translation="MNNFERALAVTLGEGSLAKIQKIKVGIAGAGGLGSNCAQFLVRS
                     GFKYFKIVDYDKVDHSNLNRQFYFKNQVGLFKVDALYYNLLKINPAVAIETIKEKIDQ
                     TNVQTLFQDCDVVIEAVDGPEDKRLLVEAYLNRGKLLVAVSGMAGWGNTEAIRVRQVT
                     EDFFLVGDRVSEVSPANPPLAPGVVVAAAKQADIVLQHVLDQ"
     gene            82393..83040
                     /locus_tag="Dred_0076"
     CDS             82393..83040
                     /locus_tag="Dred_0076"
                     /EC_number="2.5.1.3"
                     /note="KEGG: dvu:DVU2091 thiamine-phosphate
                     pyrophosphorylase;
                     TIGRFAM: thiamine-phosphate pyrophosphorylase;
                     PFAM: thiamine monophosphate synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine-phosphate pyrophosphorylase"
                     /protein_id="ABO48626.1"
                     /db_xref="InterPro:IPR003733"
                     /translation="MADKRQVQELFNTGLYGITAEEYSLGRSNYAVIKAMINAGIKVI
                     QYREKEKKLREKYQECLDIRKLTQQAGVTFIVNDHIDLALMVGADGVHIGQDDLPPEK
                     VRQLVGEKMIIGLSTHSPLQAQAALAAGVDYIGVGPIFATRTKKDVCQPVGLEYLEYV
                     VKNIPLPFVAIGGIKEHNLSEVSKRGAQCAALVTEIVGAKDIVEKVHSLRKRINI"
     gene            83197..84078
                     /locus_tag="Dred_0077"
     CDS             83197..84078
                     /locus_tag="Dred_0077"
                     /EC_number="2.1.1.-"
                     /note="KEGG: mta:Moth_0052 dimethyladenosine transferase;
                     TIGRFAM: dimethyladenosine transferase;
                     PFAM: ribosomal RNA adenine methylase transferase"
                     /codon_start=1
                     /transl_table=11
                     /product="dimethyladenosine transferase"
                     /protein_id="ABO48627.1"
                     /db_xref="InterPro:IPR001737"
                     /db_xref="InterPro:IPR011530"
                     /translation="MRELTSPSVVKDIINTYGFRVRKALGQNFLMDANIIDKIVNAAE
                     LTPGDLVFEIGPGLGVLTQRLARSAGKVIAVEIDKNLLPILTETLTDFDNAQVVHADA
                     LKVDFDRLAAEHTEGGFGKGAKSFKLVANLPYYITTPILMHLLTSGFNFDCLVVMMQK
                     EVAERLQASPGGKDYGSLSIAVQYYTVPEIVTRVPKTVFFPAPDVESAVIQLTRRKRP
                     PVTLESEEVFFKVVRAAFGQRRKTLLNSLTGSGLAEKETWIKILEEAAIDPTRRGETL
                     TIEDFANLANTYHRYQE"
     gene            84109..84579
                     /locus_tag="Dred_0078"
     CDS             84109..84579
                     /locus_tag="Dred_0078"
                     /note="PFAM: protein of unknown function DUF458;
                     KEGG: chy:CHY_2615 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF458"
                     /protein_id="ABO48628.1"
                     /db_xref="InterPro:IPR007405"
                     /translation="MNFISPTKGNMNFEEMLQDIVDYIKNLPCSSYKILVGTDSQVRR
                     ETCFVTAVIVHRRGKGARYYYCKNMQKKIISLRQKIFYETTMSLELGAKITSLLAEGG
                     MEHLNVEIHIDVGNQGETKELIREVVGMVTGSGFEAKIKPDSFAASSVADRHTK"
     gene            84823..85734
                     /locus_tag="Dred_0079"
     CDS             84823..85734
                     /locus_tag="Dred_0079"
                     /note="PFAM: peptidase U57, YabG;
                     KEGG: chy:CHY_2611 YabG peptidase,U57 family"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase U57, YabG"
                     /protein_id="ABO48629.1"
                     /db_xref="InterPro:IPR008764"
                     /translation="MAKIQEGDIVARRSYGNDVFFKVTSVYRGADGKDYAVLKGLDIR
                     LFASSLVDDLIKVDAKEVAKYWTQTMKKNTEVMDRVMKRRMSERGERLKRCTDGICMR
                     RSDQADKGDPNDVEGFDVPGTVLHLDGDKDYLDLCMTTYRNLSIPAFGYAIDEEDQPK
                     KVLALLEKHYPDILVLTGHDGVIKGAKDLTDVNNYHNTKYFIEAVKIARTFEKSRDDL
                     VIFAGACQSCYEAVLSAGANFASSPKRVLIHAFDPVFVVEKIAYTSIHDPIAIRDIIK
                     STITGFDGIGGVETRGKHRLGVPRTEY"
     gene            85802..86812
                     /locus_tag="Dred_0080"
     CDS             85802..86812
                     /locus_tag="Dred_0080"
                     /note="KEGG: mta:Moth_0200 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABO48630.1"
                     /translation="MVNFLKTVEKAKWRIMGIKNVVGVGVGYKHVGMERTQQKAIIIF
                     VTKKEDLGNLSREELVPFKINGLETDVIEVGDIRFLEEDRKKHVRPAQPGMSVGHYRV
                     TAGTFGAMVRDRSTGEPLILSNNHILANGTDGKDGRSAPGDLIFQPGEYDGGTKADRI
                     ATLIRFIPIQKGEAPASCPIANGVARIANMLVHTIRPNYDLKFFKREGVANHVDCAVA
                     RPLSPDLISDEILGIGKVQGIIDAKPGMKVKKSGRTTGITSGVVTAIGTTMQVKMDDN
                     NNAYFSNQVICDMKSQGGDSGSLVLTEGNKAVGLLFAGSEKVTVFNPIQTVLDKLNVE
                     LL"
     gene            87136..88101
                     /locus_tag="Dred_0081"
     CDS             87136..88101
                     /locus_tag="Dred_0081"
                     /note="PFAM: Allergen V5/Tpx-1 family protein;
                     KEGG: gka:GK1442 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Allergen V5/Tpx-1 family protein"
                     /protein_id="ABO48631.1"
                     /db_xref="InterPro:IPR001283"
                     /translation="MQYRLKKVSVFLATLFLFAIMLPFMASPVALAATGDDQEMVRLV
                     NEARQKAGITTLTYDQDLSVQASKNLEYYQRTGQSPSSSMLLNIAKSGGYSTIGQTIV
                     RSNDVAGMVQKQLKYYGSRSILNTKYNRIGLAIVDTNYGKLCVQLLAYKPITEPVEQP
                     KQPAPEPVPQPEPQPQPTPQPEPPAPQEPASFMNDFQKQVVDLVNAERAKYGLKPVVA
                     KEDLTKVAQVKAQDMYQSRYFSHYSPNYGSPFDLMRKFGISYTAAGENIAMGQKTAAQ
                     VMQDWMNSSGHRANILNANYNEIGVGVYQSYNGYGYIWVQEFARR"
     sig_peptide     87136..87234
                     /locus_tag="Dred_0081"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.996 at
                     residue 33"
     gene            88299..90002
                     /locus_tag="Dred_0082"
     CDS             88299..90002
                     /locus_tag="Dred_0082"
                     /note="PFAM: Peptidoglycan-binding LysM;
                     KEGG: ctc:CTC00280 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Peptidoglycan-binding LysM"
                     /protein_id="ABO48632.1"
                     /db_xref="InterPro:IPR002482"
                     /translation="MVMRKRPKLKFRQNNDENENQQFETERIRVKQLIGENTEQTVIR
                     DTVKLPYGYPDIEEILSIDTKVKLKKAEIIPNKVIVEGKLRFKVLYTAFEKDQSVHAF
                     DEEIEFTDFIEVEGARPGMDAEIEFVVEDFSLKLSRSCEYDLTAVLQITAKITEDREV
                     DAIIECPMGYNCETERMSLEQVVGSNTKQILIDDEFELPDERDFLVSDVLKCMCDVEI
                     TKVRVIKNKILFDGEVDMECLYAVERRADKGKHGHGEWHADKKGHGFEDPKEDKFGVH
                     SFERTFKFSNFIEVEGAEQGMEAYVDAMVESCSLDITDVSDCKFSPLIVLKIKARVVE
                     DREVDVVTDIEGADVDTVTLDMESLVAEECKQVIIRDAKETPAGKPDVDKVREITVGD
                     VVIKDVDVIQDKVLIKGTVEFEILYIAMNERKSLHTIHRKVDFKTFIDVPGARPENEA
                     DIDVEVEWANVKLEKDCELLIEAVLKVCARVTETVEQDVVIGFTPRPTVPPTTLPPTT
                     TCVPGTTFNYTIAKGDTLSKLAQRYGTTVQAIQAANPEITNPNMLNVGDVIKIPCVAK
                     G"
     gene            90038..91162
                     /locus_tag="Dred_0083"
     CDS             90038..91162
                     /locus_tag="Dred_0083"
                     /note="KEGG: sth:STH2583 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABO48633.1"
                     /translation="MPNGFTGCVLVKLPIVIADVTDSITVDNTTCLDELAKKVDHIDV
                     VVRDLEADPVFGRTIAPVHLPGFRQNVITPGQYPGYVQNYCNSPKATVHAFEVECGPR
                     ELKSITVSGTIHKQIYYVNKHDDVRHLGEDIPFTKTVKLEPPLPVMNPGNIDIEFKDV
                     DVDVAFDIPRPTRINQSATVSFVIKITEDHQIFIQTCIPDQDLVGQQVLANTGFEAFS
                     GCVLDVWQTANVVPGQPGRNGGFSVGLAGPAPSECLPTVPNTASLVQSIPSEVIRPGL
                     KYEFCFYIQDVVPTGIVENYTVEAKISFYDATGQVINSSAVTTVDENAVTGTWKQVCV
                     TSNAAPEGAVSGNVSIVYTRGTGDNGSFVRIDDATLTVRS"
     gene            91299..92030
                     /locus_tag="Dred_0084"
     CDS             91299..92030
                     /locus_tag="Dred_0084"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABO48634.1"
                     /translation="MRKAKFLNKGGEELNNTHEMNGQEQNTQTLKTADEVLYQGLEGA
                     MFKLLNFQAQQGADQNSTMIMLALMNLLGVVNCMNRILPEGQRVRGTTDLAGQIAGML
                     GGVAPPTANSQGVPGQSQPSGIDPGMIAALASMLGGPSRPEGAGEAGSRPGLDPAMMA
                     ALASMLSGPGGGGGANTAALMALLANMLGPKRPMEGTKPPEQPVKTDKVVKTEEKPKQ
                     TKEQGPAPKGILKWDSRFGAPSSSF"
     gene            92046..92348
                     /locus_tag="Dred_0085"
     CDS             92046..92348
                     /locus_tag="Dred_0085"
                     /note="PFAM: conserved hypothetical protein 103;
                     KEGG: mta:Moth_0028 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein 103"
                     /protein_id="ABO48635.1"
                     /db_xref="InterPro:IPR004401"
                     /translation="MFGNLGGMLSQVQNMQESLKQIIIEVTVGEGNVAVTMNGSQNLV
                     NVKVSPEAIQEDVAKLEDLIVEGIKLAQQESRTKVQEEVAKITGINIGNFMNMFKG"
     gene            92362..92661
                     /locus_tag="Dred_0086"
     CDS             92362..92661
                     /locus_tag="Dred_0086"
                     /note="PFAM: conserved hypothetical protein 103;
                     KEGG: chy:CHY_2674 conserved hypothetical protein
                     TIGR00103"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein 103"
                     /protein_id="ABO48636.1"
                     /db_xref="InterPro:IPR004401"
                     /translation="MFGNMAKVVGQIQNIQQFLKDMTVEGTAGDGLVKVIINGQQSIL
                     AVRFDPDRISAVEPEALGQMITEAYNQAQLESKEKAKEEVTKATGLNLSNLPGIF"
     gene            complement(92834..94069)
                     /locus_tag="Dred_0087"
     CDS             complement(92834..94069)
                     /locus_tag="Dred_0087"
                     /note="PFAM: transposase, IS111A/IS1328/IS1533;
                     transposase IS116/IS110/IS902 family protein;
                     KEGG: dsy:DSY4536 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS116/IS110/IS902 family protein"
                     /protein_id="ABO48637.1"
                     /db_xref="InterPro:IPR002525"
                     /db_xref="InterPro:IPR003346"
                     /translation="MSQMLVGIDVSLQSHHVQFMDGDGGALASFSIHNNRQGADTLIQ
                     KIVDTSDRIKSQSLRIGMEATSNLGWHLAHYLQEQLQTTCPQKDTQIYVLNARKVARF
                     KKGYDTLPKNDRIDAWVIADHLRFGRLPHAMKDIIQYEALQRLTRTRFHLMQNITRDK
                     TYFLNQVFLKFSGLRQDNPFSNLFGSTCLAVIQELEPEQIVAMSMEELVDFLKDKGKN
                     RFDNPEEIALYLQKIARSSYRLNKAMADPVNISLATMLNVIKHMESEVKKLDKEIAKI
                     MKGLPQTLTSVKGIGDVFTAGIMAETGDIQRFKDHNALAKYAGLTWNQHQSGEFEAED
                     TSRTRTGNKYLRYYLIQAADSVRKHVPEYKDFYQKKYDEVPKHKHKRALVLTARKLVR
                     LVFSLLNTRQLYTSPERRG"
     gene            95453..95992
                     /locus_tag="Dred_0088"
     CDS             95453..95992
                     /locus_tag="Dred_0088"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABO48638.1"
                     /translation="MEEKSSNRLASNLEQLVSRMESIHFQRSSELDQVSGVLGNMDKL
                     VDVLSRVELQRQAEHQLIDQVNRLNEVVESLSGQETVSKREVPVEDTLRKVIKGVKVT
                     GKVMDIVAGSLGVMFDSIVATVKVPERQNTTRSSKEQVDLASVLAPLGGILQGLLGTE
                     SVENSQSNRQAKPDEKKEE"
     gene            96023..97129
                     /locus_tag="Dred_0089"
     CDS             96023..97129
                     /locus_tag="Dred_0089"
                     /note="PFAM: peptidase S8 and S53, subtilisin, kexin,
                     sedolisin;
                     KEGG: mta:Moth_2027 peptidase S8 and S53, subtilisin,
                     kexin, sedolisin"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase S8 and S53, subtilisin, kexin,
                     sedolisin"
                     /protein_id="ABO48639.1"
                     /db_xref="InterPro:IPR000209"
                     /translation="MGGRNTRVRIILFKDQLHRGDLTPPHMGLINWMGAQNVRALPNV
                     NGVICTLSPKITDQEILSTGGVVAVEENCKISLVPWAPIKFKPFSEQIIPWGVHYIGS
                     DVCWSETRGQGVRIAVIDSGIDNNHANLRNNLRGGKNFIAPEASYHDDNGHGTHVAGI
                     IAAADIGKGVLGVAPEAEIYALKVLDQWGDGTILNAINAINWCLQKNIHIANMSFGTD
                     KYSRALEEAVRVACSRGLLIVAAAGNDGGPGTVDYPAVFKETLSVAALDTKGNLADFS
                     SSGSEVDLLAPGSNILSTYRWGTYVRLSGSSMAAAHTAGAAALLRAKYPYEDIHMIAR
                     RLMAGAMKIKEKDGQLTGAGVVRVDVSLKSYPGA"
     gene            97257..97499
                     /locus_tag="Dred_0090"
     CDS             97257..97499
                     /locus_tag="Dred_0090"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABO48640.1"
                     /db_xref="InterPro:IPR006121"
                     /translation="MTGPNIQDHQNISKTFKIGGLQGSQHDKQEIETYLSQIDGVDNV
                     KVNLEDGSVTVDFDPGAIHTDYLRGTLKSLGHNILA"
     gene            97675..98121
                     /locus_tag="Dred_0091"
     CDS             97675..98121
                     /locus_tag="Dred_0091"
                     /note="PFAM: protein of unknown function DUF606;
                     KEGG: mta:Moth_0102 protein of unknown function DUF606"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF606"
                     /protein_id="ABO48641.1"
                     /db_xref="InterPro:IPR006750"
                     /translation="MDAKLLALIIAAISGLTMALQGTMNSALGKVVGLWETTFIVHAV
                     GTVVVGILVFVCRLGACDLDKWVSAPWYTYLGGLLSVVIIYMVARSMPVVGVAPATTA
                     IIVGQVLTAAAIDHLGLFGFEQIPFSWYQVAGTFLMAGGAFLLLKK"
     sig_peptide     97675..97764
                     /locus_tag="Dred_0091"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.982) with cleavage site probability 0.981 at
                     residue 30"
     gene            complement(98298..99665)
                     /locus_tag="Dred_0092"
     CDS             complement(98298..99665)
                     /locus_tag="Dred_0092"
                     /note="TIGRFAM: amino acid carrier protein;
                     PFAM: sodium:alanine symporter;
                     KEGG: mmp:MMP1511 sodium:alanine symporter"
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid carrier protein"
                     /protein_id="ABO48642.1"
                     /db_xref="InterPro:IPR001463"
                     /translation="MDFATLVSDINGFVWGPYMLALLVGTGIFLTLRLGFLQVRTLPY
                     ALKLAFSPNKQDHKSEGDISHFHALMTALAATIGTGNIAGVATAVFTGGPGAVFWMWV
                     TAFFGMATKYSEAILAVKYRIVDEKGEMAGGPMYYIERGLKMKWLGWLFAFFGAFASF
                     GIGNMTQTNSVALAMNGTFGVSPIITGIILAILTGAVILGGIQSIGRVTGLVVPFMAI
                     FYVLGGLAIIAMNLDKLVPAVSLILNDAFSGQAVAGGALGTVIRYGVARGVFSNEAGL
                     GSAPIAAAAAKTDHPGRQALVSMTGTFLDTIIVCSITGIVLTMSGLYSGEVSGAELTI
                     AAFDSFLPGMGKYIVSIGLIFFAYSTVLGWSYYGEKCFQYIFSRKAVKYYRYAFVVAA
                     FVGCTLELDLVWNIADTLNGAMAIPNLIGLLGLSGVIAAETKDFMALRARELEAERFG
                     KDLGA"
     gene            complement(99932..100510)
                     /locus_tag="Dred_0093"
     CDS             complement(99932..100510)
                     /locus_tag="Dred_0093"
                     /note="PFAM: Peptidoglycan-binding LysM;
                     ErfK/YbiS/YcfS/YnhG family protein;
                     KEGG: mta:Moth_0101 ErfK/YbiS/YcfS/YnhG"
                     /codon_start=1
                     /transl_table=11
                     /product="ErfK/YbiS/YcfS/YnhG family protein"
                     /protein_id="ABO48643.1"
                     /db_xref="InterPro:IPR002482"
                     /db_xref="InterPro:IPR005490"
                     /translation="MTERMMYRAGIELLIDPQSRQINVYIGKQLSKSYPVGVGKATTP
                     TPAGNYQVVNKVTHPGGILGTRWLGLNIPGGNYGIHGTSNPSSIGKLVSAGCIRMYNE
                     NVEELFPMIPVGTPVEIKAVPGYNQKGSIVTSSPGSGPPLDHSSYLVQPGDSLWKIAK
                     KYQISLEELLAVNNIGDPHMLEVGQIINLPNL"
     gene            100737..101585
                     /locus_tag="Dred_0094"
     CDS             100737..101585
                     /locus_tag="Dred_0094"
                     /EC_number="2.7.1.148"
                     /note="TIGRFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol
                     kinase;
                     PFAM: GHMP kinase; GHMP kinase, C terminal domain protein;
                     KEGG: gka:GK0039
                     4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
                     (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol
                     kinase)"
                     /codon_start=1
                     /transl_table=11
                     /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
                     kinase"
                     /protein_id="ABO48644.1"
                     /db_xref="InterPro:IPR000870"
                     /db_xref="InterPro:IPR004424"
                     /db_xref="InterPro:IPR006204"
                     /db_xref="InterPro:IPR013750"
                     /translation="MGIRLKAHGKINLTLDVLDRRPDGYHEVEMIMQSISLHDVLEIE
                     EQSKEISLTVSGISVTAEEDNLVLKAARLLQQVAGTGAGAKIHLQKNIPVAAGLAGGS
                     TDAAATLKGLNALWGLGLSQEQLRQLATQLGADVPFCLAGGTAIARGIGEKLTTLEPA
                     PPFGIILVKPSFGVSTAEVYQGLRLEHLGKRPNTEAMVKALKERDLGQVARELANVLE
                     SVTLRMHPKLEQIKEILRQIGCTGVLMSGSGPTVFGLTENREKAAELISGLPQAGCHV
                     LAAWMV"
     gene            101669..102361
                     /locus_tag="Dred_0095"
     CDS             101669..102361
                     /locus_tag="Dred_0095"
                     /note="PFAM: regulatory protein GntR, HTH; GntR domain
                     protein;
                     KEGG: chy:CHY_0189 transcriptional regulator, GntR family"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, GntR family"
                     /protein_id="ABO48645.1"
                     /db_xref="InterPro:IPR000485"
                     /db_xref="InterPro:IPR000524"
                     /db_xref="InterPro:IPR011711"
                     /translation="MSEPKLAPIKLDAYKPLREIVFETLREAIISGKLEPGERLMEIQ
                     LAEEMGVSRTPVREAIRKLELEGFVVMIPRKGAYVAGISLKDVTDVFEVRAALEALAA
                     GLAAERATDKEIDQLERSLLAYSEQTSTQDINKIVETDTDFHELLYKASRNERLLSII
                     THLREVIQRVRTVSLSQPGRSKDAIEEHRQIVDAIADRNVELAQTLAREHIYSAENIM
                     LNSLKGAQKENG"
     gene            102354..103136
                     /locus_tag="Dred_0096"
     CDS             102354..103136
                     /locus_tag="Dred_0096"
                     /note="KEGG: mta:Moth_0074 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABO48646.1"
                     /translation="MVDALVLAGSKNNGPLRNVSQESCEALIKIGPSPMLMYVVDALK
                     QCREVDKIVVVGPTEVKKVIPPEIYWLQSGENIMENIQRGNALMQGHYLVASSDIPLL
                     NAEGVSGFLALCREVKADFYFPLISKDAIEKEFPGAKRTYIPFKEGVFTGGNLFLVNP
                     WVVEQCLKVGQELVDLRKKPVALARRVGLLLFIKFLLRVLSLQEVQEKASHLLGIEGK
                     AIICPYPEVGMDIDKPSDLEMVRQFLGHDKYKVIKDELCRSQ"
     gene            103178..104395
                     /locus_tag="Dred_0097"
     CDS             103178..104395
                     /locus_tag="Dred_0097"
                     /EC_number="4.3.1.19"
                     /note="TIGRFAM: threonine dehydratase;
                     PFAM: Pyridoxal-5'-phosphate-dependent enzyme, beta
                     subunit; amino acid-binding ACT domain protein;
                     KEGG: chy:CHY_0191 threonine dehydratase"
                     /codon_start=1
                     /transl_table=11
                     /product="L-threonine ammonia-lyase"
                     /protein_id="ABO48647.1"
                     /db_xref="InterPro:IPR000634"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="InterPro:IPR002912"
                     /db_xref="InterPro:IPR005789"
                     /translation="MDKSIVTLQNILEARERLKGVSRFTPLEPSEAFSKMTGANVFLK
                     LENLQKTGSFKLRGAYNKVAALAKEAARGVVAASAGNHAQGVAFASSQAGIPATIVMP
                     EGAPITKVERTKAYGAEVVLSGQGYDDAFRKAQEVQQEKGAVFVHAFDDPLVIAGQGT
                     IGLEILEELPDLDAVVVPIGGGGLIAGVACAIKEQRPGVQIIGVQAADAPSMLEAWKI
                     GKVQELKSAQTIADGIAVRRPGDLTFEMVRRYVDQIVTVDDEEIARAILMLLESSKLM
                     VEGAGAVGIAALLHKKCDLSGKKVAVILSGGNIDVNVMSMIIERGLIKAGRYLRFKTI
                     LTDRPGSLQKLLSNLAQSGANVISIVHDRIKPNVPLKQAEVEISLETRNAEHIAQIVE
                     SLGKMGYELDILR"
     gene            104513..104767
                     /locus_tag="Dred_0098"
     CDS             104513..104767
                     /locus_tag="Dred_0098"
                     /note="PFAM: SpoVG family protein;
                     KEGG: dsy:DSY0151 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="SpoVG family protein"
                     /protein_id="ABO48648.1"
                     /db_xref="InterPro:IPR007170"
                     /translation="MHVTDVRVRKVLMEGKMKAIVSVTLDDAFVIHDVKVVEGQNGLF
                     VAMPSRKTPDGEFRDIAHPINSSAREIIQNAVLQAYQEVI"
     gene            104946..106316
                     /locus_tag="Dred_0099"
     CDS             104946..106316
                     /locus_tag="Dred_0099"
                     /EC_number="2.7.7.23"
                     /note="KEGG: chy:CHY_0192 UDP-N-acetylglucosamine
                     pyrophosphorylase;
                     TIGRFAM: UDP-N-acetylglucosamine pyrophosphorylase;
                     PFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol synthase;
                     transferase hexapeptide repeat containing protein;
                     Nucleotidyl transferase"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylglucosamine pyrophosphorylase"
                     /protein_id="ABO48649.1"
                     /db_xref="InterPro:IPR001228"
                     /db_xref="InterPro:IPR001451"
                     /db_xref="InterPro:IPR005835"
                     /db_xref="InterPro:IPR005882"
                     /translation="MELAAVILAAGKGTRMKSNLPKVLHQLCGRPMLSHVLNSVVAAG
                     VDKTVVVAGFGAEQVTDFVGEKARVVLQREQLGTAHALLQAEGELTDYPGHLLVVCGD
                     TPLLRAETLAKLADYHCESGAVATLLTAEMADPTGYGRVIRTTEGNVSHIVEQKDASP
                     EELNVHEINTGVYCFKVPGLFNALKEISPANVQGEYYLTDIIQIFVQRGLTVKAVTLE
                     DAREVQGINDRIQLSRAEVVLRHRVLEELMVQGVTIMDPENTYVDQGVKVGNDTVILP
                     FTFLQGKTEIGSQCVLGPGSKINNCIIGDRNEIQYSVLVESKIGNDATIGPYAYLRPG
                     TVLADHVKVGDFVEIKKSTIGHGSKIPHLSYVGDATIGEKVNVGAGTITCNYDGKKKY
                     QTTLEDGAFIGSNTNLVAPVKVGQGAVIAAGSTITKDVPDNALGVARGRQTNLADWPK
                     KQRKNS"
     gene            106339..107289
                     /locus_tag="Dred_0100"
     CDS             106339..107289
                     /locus_tag="Dred_0100"
                     /EC_number="2.7.6.1"
                     /note="KEGG: chy:CHY_0193 ribose-phosphate
                     pyrophosphokinase;
                     TIGRFAM: ribose-phosphate pyrophosphokinase;
                     PFAM: phosphoribosyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="ribose-phosphate pyrophosphokinase"
                     /protein_id="ABO48650.1"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="InterPro:IPR000842"
                     /db_xref="InterPro:IPR002375"
                     /db_xref="InterPro:IPR005946"
                     /translation="MSSNSKRLKIFSGNANPELAQEICQYLGVTMGSSQVTHFSDGEI
                     RVKVDESVRGSDAFIIQPTSTPVNENLMELLIMADALRRASARRITAVIPYYGYARQD
                     RKTRARDPITAKLVANIISASGCRRVITMDLHAGQIQGFFDIPVDHLPAVPILAEYFQ
                     QTLNKENVVVVSPDIGGVTRARDLAERIGSPLAIIDKRRPEPNVAEVTNVIGNIKGKT
                     VIMIDDIIDTAGTITKGAAALMDRGAKEIYVCCTHAVLSGPAIQRLEESVIKEVIITN
                     TIPLPAEKMIDKIKVLSVAPLLGEAIIRIHEDLSVSKLFS"
     gene            107912..109111
                     /locus_tag="Dred_0101"
     CDS             107912..109111
                     /locus_tag="Dred_0101"
                     /note="PFAM: protein of unknown function DUF39;
                     KEGG: swo:Swol_1441 conserved hypothetical cytosolic
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF39"
                     /protein_id="ABO48651.1"
                     /db_xref="InterPro:IPR002708"
                     /translation="MSVERTYAEINARIKAGKAVVLTAEEVIGKVKEQGLTKTAAEVD
                     VVTTGTFGPMCSSGAFLNFGHSSPRMRMTKVSLNNVPAYTGIAAVDAYIGATEVPEDD
                     PANSNHPGEFRYGGGHVIEDLVAGKTVKLKALSYGTDCYPRREIETNITLNDLNEATL
                     FNPRNAYQNYNCAVNASDRVIHTYMGTLKPRFGNANYSTSGQLSPLMKDPNFATIGIG
                     TRIFLGGGIGYVVWNGTQHFPGWLKDQEGNVVGSAGGTLSVLGDLKQMKPQWLRGTRF
                     QGYGATLTVGLGVPIPILNEEILRFAALSDEELHAPVVDYSDAYPNRVGGNLGVVSYA
                     QLKSGKIILDGKEIPTAPLSSYPKAREIAGQLKNWIEKGDFLLGEPVQLLPGPMAGLT
                     GKPLEIK"
     gene            109131..109532
                     /locus_tag="Dred_0102"
     CDS             109131..109532
                     /locus_tag="Dred_0102"
                     /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
                     protein;
                     KEGG: sat:SYN_00800 ferridoxin"
                     /codon_start=1
                     /transl_table=11
                     /product="4Fe-4S ferredoxin, iron-sulfur binding domain
                     protein"
                     /protein_id="ABO48652.1"
                     /db_xref="InterPro:IPR001450"
                     /translation="MAPHKIVLRFTSSTSDQPIIYHLVKDYDLVVNILKAQINPHLEG
                     TLVLDLRGEKYEEGIEYLRNQGISVHPLTQEVVRNNDRCTSCGACTGHCPAGALAMER
                     PSMEVQFDSDKCVVCLQCLKVCPVGAMEVRI"
     gene            109533..110276
                     /locus_tag="Dred_0103"
     CDS             109533..110276
                     /locus_tag="Dred_0103"
                     /note="PFAM: protein of unknown function DUF375;
                     KEGG: swo:Swol_1439 conserved hypothetical cytosolic
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF375"
                     /protein_id="ABO48653.1"
                     /db_xref="InterPro:IPR007183"
                     /translation="MDYTQRTYRALHHQGDLIHFQVSVEETDLDIGVRRKCFTPEMVS
                     WVEDSIKEQRSLLEEYIQKDPVFKTTLEPCGILPGAPDIVVNMAEAAKLAGVGPMAAV
                     AGAFSQVIGKALSRRSRDVIVENGGDIFIKGSRPRRVGIFAGTSPFSHKIAMEIQPWQ
                     TPVGICTSSGTVGHSLSFGNSDAVIVLAPSVPLADAVATAGGNLVQSEMDVQRAVDFA
                     ASVKGVIGAVAIKGEKLAAWGQIKLVPMG"
     gene            110490..110909
                     /locus_tag="Dred_0104"
     CDS             110490..110909
                     /locus_tag="Dred_0104"
                     /note="PFAM: Rubrerythrin;
                     KEGG: swo:Swol_1783 conserved hypothetical cytosolic
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Rubrerythrin"
                     /protein_id="ABO48654.1"
                     /db_xref="InterPro:IPR003251"
                     /translation="MHLTMNDVLDVAIKSEESSYHFYKDMAVKAQNSETKKVLEKLAQ
                     DEKDHLEYLLWLKSGEPINDEVYFDGFEEAGELKPEMTPKEVLTIAIQREDAAAKMYS
                     QMADIFKGQPEKKFIFERMAREEGHHGQAVTQMMDQF"
     gene            complement(110962..111996)
                     /locus_tag="Dred_0105"
     CDS             complement(110962..111996)
                     /locus_tag="Dred_0105"
                     /EC_number="4.1.2.5"
                     /note="PFAM: aminotransferase, class V; aromatic amino
                     acid beta-eliminating lyase/threonine aldolase;
                     aminotransferase, class I and II;
                     KEGG: sth:STH2403 threonine aldolase"
                     /codon_start=1
                     /transl_table=11
                     /product="L-threonine aldolase"
                     /protein_id="ABO48655.1"
                     /db_xref="InterPro:IPR000192"
                     /db_xref="InterPro:IPR001597"
                     /db_xref="InterPro:IPR004839"
                     /translation="MITIRVVDLRSDTITLPTDEMRKAMATAVVGDDVYKEDPTVNQL
                     EETAASLLGKEAALFVPSGTMGNQIAVLTHTARGEEVLLDSEAHIYYYEVGGPAMLAG
                     VQLRPVSDLLTDHGPEILKGSLRGEDLHFPHTSLICLENTFNRGGGTILSPHTMGRIY
                     SIAQEHNLKVHVDGARIFNAAVSLGVDVRTFSQHCDSLMFCLSKGLAAPVGSLLVGTR
                     QFIERARKYRKALGGGMRQAGILAAAGLVALQNVDRLAEDHANARRLAEGLAKLPGLG
                     VDLAKVQTNIIVVNVNQPRSAADLTMALNNKGIKCSTFGPSTIRMVTHINVSKEDIDY
                     ALGIAKYLLQ"
     gene            112146..112394
                     /locus_tag="Dred_0106"
     CDS             112146..112394
                     /locus_tag="Dred_0106"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABO48656.1"
                     /translation="MNKGKDSAKNHKIGYSTGKTRKKGELSMMFTQRTPSTYPMTKDV
                     MARRMENPNYMLERINEVKKSPKQKPVLEIILEKYPFK"
     gene            complement(112497..113540)
                     /locus_tag="Dred_0107"
     CDS             complement(112497..113540)
                     /locus_tag="Dred_0107"
                     /note="PFAM: PRC-barrel domain protein;
                     KEGG: dsy:DSY0178 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="PRC-barrel domain protein"
                     /protein_id="ABO48657.1"
                     /db_xref="InterPro:IPR007903"
                     /translation="MRKSKKFIGIPVISLAEGQQMGTVKGLVVDPVQQNVAALLIDQK
                     GWFNGQKFVPYNKVRSVGTDAITIDQGAVVEKGTSLPDILKLYKDKVHIIGCKVIVEN
                     GSQLGEVVDFFVDEVSGQLVGLEISGNFLNSLLKGRSFLEITFVKTIGKELVVTSSDA
                     MDNLVKIDGGLQETVKQLKESTNQIWETTVQKTKEIGTITKELSSKTVEDIETKTKDL
                     GESIRDKVKRKVNEETVEDEVKVQDLPPGALKQEGVALTREEPVQDEVLVEELPPGAL
                     PRQEEELLTRLEQLQDSVQIHDLPPGALPREEETESVLDESKVDITKSQEIFSEVPES
                     PVHPDKENPEKRI"
     gene            113676..114308
                     /locus_tag="Dred_0108"
     CDS             113676..114308
                     /locus_tag="Dred_0108"
                     /note="TIGRFAM: ribosomal 5S rRNA E-loop binding protein
                     Ctc/L25/TL5;
                     PFAM: ribosomal protein L25;
                     KEGG: mta:Moth_0078 ribosomal 5S rRNA E-loop binding
                     protein Ctc/L25/TL5"
                     /codon_start=1
                     /transl_table=11
                     /product="LSU ribosomal protein L25P"
                     /protein_id="ABO48658.1"
                     /db_xref="InterPro:IPR001021"
                     /translation="MADTALNANLRKTATKSIVKEIRNNGGIPGVVYGKHVGSMAISV
                     DAKDLKNILGSVTGRNTLINMNINGSKQTVMVKSLQMDPMHQNIRHVDFQQVSENTKI
                     RTVIPVQLVGTPKGVAMGGVIQHDLRSAEIECLPNRIPEAIQVDISGLEIGDTLSVSD
                     LNLPPGVKILDHPHTTVVGLATIKAPEPAGQPEVPPEPAEEAKAKTIEKE"
     gene            114376..114996
                     /locus_tag="Dred_0109"
     CDS             114376..114996
                     /locus_tag="Dred_0109"
                     /EC_number="3.1.1.29"
                     /note="PFAM: peptidyl-tRNA hydrolase;
                     KEGG: swo:Swol_0070 aminoacyl-tRNA hydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-tRNA hydrolase"
                     /protein_id="ABO48659.1"
                     /db_xref="InterPro:IPR001328"
                     /translation="MKLIVGLGNPGTEYAKTRHNIGFMVIDRLADESRVSTEKNQHKA
                     QICQITIGSEKVILAKPQTYMNLSGQSVVALMNWYKLSPDELFVITDDMDLPPGVLRI
                     RKNGSAGGQRGLKNIIELLGTQQFPRMRVGIGRPEHGAVDHVLGKISEAEAELINPAI
                     QTAVEAVKVWVLEGTQAAMNKFNQKNKKKKEKEQPEAATDQLLENK"
     gene            115086..115511
                     /locus_tag="Dred_0110"
     CDS             115086..115511
                     /locus_tag="Dred_0110"
                     /note="KEGG: tte:TTE2566 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABO48660.1"
                     /translation="MINSDPSTIYTVALAATMLAAGTSWVANGWGRNFFGNRGVTYFT
                     PLVEEMSKTLWAVVLNTPLVWTHLGFGLIEALVEIKRRSVKGILAGCTSLIVHGMLGL
                     LTVKIYTTSNLLFALLSSYLAHASWNGAVNYYSKRTDVT"
     gene            115731..119240
                     /locus_tag="Dred_0111"
     CDS             115731..119240
                     /locus_tag="Dred_0111"
                     /note="KEGG: mta:Moth_0081 transcription-repair coupling
                     factor;
                     TIGRFAM: transcription-repair coupling factor;
                     PFAM: helicase domain protein; transcription factor CarD;
                     TRCF domain protein; DEAD/DEAH box helicase domain
                     protein;
                     SMART: DEAD-like helicases-like"
                     /codon_start=1
                     /transl_table=11
                     /product="transcription-repair coupling factor"
                     /protein_id="ABO48661.1"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR003711"
                     /db_xref="InterPro:IPR004576"
                     /db_xref="InterPro:IPR005118"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014021"
                     /translation="MKGLLRPLESTTEYQHLLQGLEKGFRQQMVFGLSGSQRSYLFAG
                     LAHGWQSVLIVTPGETEAGTLADDLATLLPEVSVQPFPVWQLLPYQVLAHSNEVLAQR
                     LRVLEKLSTGKPTVVVTSVDALLRRLTPPEVFRCAKVKLSLGQQVDLEKLRFELVELG
                     YTRVDLVEGRGQFSSRGGILDIYPMSEALPVRIEFFDDEVDSIRHFEVDNQRSLDKLK
                     EINISPCRELVVTPAGWQRCEENYSLEFKNQLKKLQRSGSVDAVHQLSSQGAMLLEQI
                     RRRVPFDGMEQLLYYFYPEPITLLDYFTAAPLLLVDDPIRFKEVAETILKERNETYTD
                     LLGKGKVLPGYFSSYLEWRQLLASIERQQTIFCSFLPRNPQYLRPQNVVNFPAKAMHS
                     FLGHAEVLADEIRHWRRRGYAITLLVSSEERAANLLKTLKDSKIDAFRVKQLDQEVRE
                     GNVVITVGQMANGFELISARLVVITDAEIFGQRKKARKQRSRPDAKMEPLADLKAGDY
                     VVHVNHGIGRYLGVITLDIGALQKDYLQLQYAGEDKLYVPTDQVGMLQKYLGAESDHP
                     KLSRLGGTEWSKAKAKVREAVKDMADELLALYASRQTVRGHAFSKDMPWQAEFEALFP
                     YEETPDQLRAIGEVKQDMEKVRPMDRLLCGDVGYGKTEVALRAAFKAVMDNKQVAVLV
                     PTTILAQQHYNTFRERFANYPIRIEMLSRFRTAKEQRQVLAGLATGEVDIVVGTHRLV
                     QNDIVFKDLGLLVVDEEQRFGVSHKERLKQIRKNVDVLTLSATPIPRTLHMSLVGVRD
                     TSLLETPPEERFPVQTYVLEEDPVLIREAIKRELNRGGQVYFVHNRVMDLDRLAGWLQ
                     NLVPEARIGMAHGQMKEDELEQIMIEFMDGEYDVLVCTTIVETGLDISNVNTLIVKDA
                     DHFGLSQLYQLRGRVGRTNRLAYAYFLFRRDKVLTEISERRLSAIREFTEFGSGYKIA
                     MRDLEIRGAGNILGAQQHGHIAEVGFDLYCRLLEEAVQEARGEKVEEVVETSVEIPVE
                     AYVPDTYVPDGNQKVELYRRLAAMRDLVEISDLEEELVDRYGDLPESVRCLLQVTKLK
                     IMGRGLKVKSISRSQGSFRILFVPEAPLDGEKLVSISEKYKNNVKFHTSSEGFEIKLI
                     TKDKGDVSLRKLEQLESFMGRLK"
     gene            119302..120336
                     /locus_tag="Dred_0112"
     CDS             119302..120336
                     /locus_tag="Dred_0112"
                     /note="PFAM: PpiC-type peptidyl-prolyl cis-trans
                     isomerase;
                     KEGG: chy:CHY_0201 putative peptidyl-prolyl cis-trans
                     isomerase, PpiC-type"
                     /codon_start=1
                     /transl_table=11
                     /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
                     /protein_id="ABO48662.1"
                     /db_xref="InterPro:IPR000297"
                     /translation="MKNKFLQGCIPIFLSLLLLLTGCANNKANVVATVNGKDITRQQL
                     DKQTNQMVERYKQQGFDLTTKENKAMKEQLEQSILDDMITKELLLQEAEKQKLIPAKE
                     AIDKNMAEIKKGFPNEEEYKKALEESKVTEAELREQLILDESSRKLYEKVTADVKKPT
                     DEEITKFYNENKGREPIGTPERLEVKHMLFAINSDQPGVPKRGEKEALEAAKLALAEV
                     TQKGRDFGVVAREKSDDLGTRENGGSYTIDRGANTTDPAFEKAAENLKPGEITKEPVK
                     SAYGFHIIKLEKVTPASTKALTEVKDSIAAQLEGEAKQAKFTQFIDNLRKNAKINNKL
                     APKTEDSSKK"
     sig_peptide     119302..119412
                     /locus_tag="Dred_0112"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.997) with cleavage site probability 0.671 at
                     residue 37"
     gene            120469..121029
                     /locus_tag="Dred_0113"
     CDS             120469..121029
                     /locus_tag="Dred_0113"
                     /note="TIGRFAM: transcriptional regulator, AbrB family;
                     PFAM: SpoVT/AbrB domain protein;
                     KEGG: chy:CHY_0202 stage V sporulation protein T"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, AbrB family"
                     /protein_id="ABO48663.1"
                     /db_xref="InterPro:IPR006339"
                     /db_xref="InterPro:IPR007159"
                     /translation="MKATGIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIFVDREGEV
                     ILKKYSPIGELGDFAKEYADSLYEALGHIACIADRDTIIAVAGAPKKEFINKPIGPNV
                     EKVMEDRKAVVINTPGNDPHCKECGITEDGECKYSSEVIAPIISEGDPIGAVILASKD
                     PDVKMGEMELKLAETAAGFLAKQMEQ"
     gene            121259..122776
                     /locus_tag="Dred_0114"
     CDS             121259..122776
                     /locus_tag="Dred_0114"
                     /note="TIGRFAM: MazG family protein;
                     PFAM: Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
                     methyltransferase; MazG nucleotide pyrophosphohydrolase;
                     KEGG: mta:Moth_0084 MazG family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="MazG family protein"
                     /protein_id="ABO48664.1"
                     /db_xref="InterPro:IPR000878"
                     /db_xref="InterPro:IPR004518"
                     /db_xref="InterPro:IPR011551"
                     /translation="MDKLITVVGLGPGDPGMLPLQVWELLNGGLPVYLRTEVHPTVDW
                     LKQKGVKFSSMDHHYDHATTFEEVYSNIAQEILEVAEQTPVVYGVPGHPMVAEDSVRR
                     VLELAAARGIPTRVIPAMSFIDALSATLGIDPCKGLHIVDALRLDVQQPDPLVGTIVT
                     QIYDRMTAGETKLSIMDHYPDEHMITVVRAAGVPKEERVQRIPLYELDRLDWIDHLTS
                     LYIEPLTKGSEHQKFNQPEIQNTEGSFPLDPLIEVMVTLREENGCPWDREQTHKSLKP
                     YLIEETYEVLEALEQGQMYKICEELGDLLLQIVFHAQIASENKQFNMNDVVQSITEKM
                     IRRHPHVFGSTRVEDSQEVLVNWDKIKTQEQGAQANEQPYLSGVPRALPALLRAQKVQ
                     SKAARIGFDWPDYTGAVDKVKEELQEVLQEIGTGCTEALSEEVGDLLFAVVNLARLLK
                     IEAEDALSLTTNKFIQRFYYIEQKASDAGKKLTELTLEQMDLWWEEAKILKKQEK"
     gene            122866..123153
                     /locus_tag="Dred_0115"
     CDS             122866..123153
                     /locus_tag="Dred_0115"
                     /note="PFAM: histone family protein DNA-binding protein;
                     KEGG: mta:Moth_0085 histone-like DNA-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="bacterial nucleoid protein Hbs"
                     /protein_id="ABO48665.1"
                     /db_xref="InterPro:IPR000119"
                     /translation="MNKAELISAVAEKTELSKKDAEKAVSAVLGSIEEALAKGDKIQL
                     VGFGTFESKPRKAREGRNPQTGDTIQIPATRVPVFKAGKVLKDAVANLPVE"
     gene            123170..123412
                     /locus_tag="Dred_0116"
     CDS             123170..123412
                     /locus_tag="Dred_0116"
                     /note="PFAM: RNA-binding S4 domain protein;
                     KEGG: sth:STH3229 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA-binding S4 domain protein"
                     /protein_id="ABO48666.1"
                     /db_xref="InterPro:IPR002942"
                     /translation="MRLDKFLKVSRVIKRRTLAKEVCDGGHVQVNNRAAKAGLEVKPG
                     DKVEINFGSRKLSFKILEVKETVPVKEAASLYEIIE"
     gene            123552..124505
                     /locus_tag="Dred_0117"
     CDS             123552..124505
                     /locus_tag="Dred_0117"
                     /note="TIGRFAM: SpoIID/LytB domain;
                     PFAM: Stage II sporulation D domain protein;
                     KEGG: chy:CHY_0206 SpoIID/LytB domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="SpoIID/LytB domain protein"
                     /protein_id="ABO48667.1"
                     /db_xref="InterPro:IPR013486"
                     /db_xref="InterPro:IPR013693"
                     /translation="MRKQSLLIFTLILLVTMFAGGCKQAAKKPQAPTPERFKEEPTIS
                     LYNNETGQKQQIKLEKYVTGVVAAEMDPQWPVDALAAQAILARTFTMENIKSSRVKGL
                     HGTDVSTSVEESQAYDPSRINENVRQAVAKTRGQVITYQGNYIKAWFSASNGGKTASA
                     AEGLAYHKTPTPYIKANINDPMSVQNTLPDIKQWTATIPGYKVREAVKSVSGTDPGPL
                     TSASIAEKGSSGRAIKIKINQTIIGGPAFRLAVGSTEVRSMFLTNVAVQNGSLVLTGK
                     GYGHGVGMSQWGAKNMAEQGTSPQDIIKFYFKDIKINKLYD"
     sig_peptide     123552..123647
                     /locus_tag="Dred_0117"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.994) with cleavage site probability 0.535 at
                     residue 32"
     gene            124667..124951
                     /locus_tag="Dred_0118"
     CDS             124667..124951
                     /locus_tag="Dred_0118"
                     /note="PFAM: YabP family protein;
                     KEGG: sth:STH3228 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="YabP family protein"
                     /protein_id="ABO48668.1"
                     /db_xref="InterPro:IPR012504"
                     /translation="MEEYEKHILSIEGRKKLKLAGVQHVGSFDEQEITLDTNMGVLQL
                     KGEGMHITHLNLDEGSLVVEGYINGLEYIEGKSTKANKARGKSFINRILK"
     gene            124980..125540
                     /locus_tag="Dred_0119"
     CDS             124980..125540
                     /locus_tag="Dred_0119"
                     /note="KEGG: mta:Moth_0089 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABO48669.1"
                     /translation="MVPLQDQFYYFILTILIGMVAGFCYDLYKVTRGTLRLRKIGTAL
                     GDIFFWLILTGVVFILLLLGNWGEVRLYVLLGLLLGAVLYLNVFSHLTTTMIHKIFKT
                     LRQIWIGILKTLSFLWKMICLPFKGLYLLVALPLGFIVHLMGKTVTVSKRIMAKLFGG
                     PMKKLKGGFWKRLVSIFPVFEYKNKK"
     gene            125718..125951
                     /locus_tag="Dred_0120"
     CDS             125718..125951
                     /locus_tag="Dred_0120"
                     /note="KEGG: chy:CHY_0209 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
                     /protein_id="ABO48670.1"
                     /db_xref="InterPro:IPR000792"
                     /translation="MQLEIRGAEKLSFRERQVVALKEMGYSTDKIAAKLNLSPSSVAT
                     LFNRAKSKGYQVVIVISGDSLGLFGPEEEEIDK"
     gene            125948..126397
                     /locus_tag="Dred_0121"
     CDS             125948..126397
                     /locus_tag="Dred_0121"
                     /note="PFAM: Septum formation initiator;
                     KEGG: cpe:CPE2475 cell division protein FtsB"
                     /codon_start=1
                     /transl_table=11
                     /product="Septum formation initiator"
                     /protein_id="ABO48671.1"
                     /db_xref="InterPro:IPR007060"
                     /translation="MISTGKGKVTELRLHSDNRDPEKTVRRGKKSGNFMLLLTVACVC
                     YMVFSLYNQFTRMNTMQSSMKTLQTQVEELKNRNEALRTEIKQIKSEAYIEQAAREQL
                     GLVKPGETLVVPTQPKQTSTASEQKKSSKSEEAGAEAFDIKYKNIYD"
     gene            126494..126874
                     /locus_tag="Dred_0122"
     CDS             126494..126874
                     /locus_tag="Dred_0122"
                     /note="PFAM: RNA binding S1 domain protein;
                     KEGG: mta:Moth_0092 RNA binding S1"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA binding S1 domain protein"
                     /protein_id="ABO48672.1"
                     /db_xref="InterPro:IPR003029"
                     /translation="MSLEQGSIVEGIVTGITNFGAFVELPGGQTGLVHISEVAEVYVK
                     DINEFLKVNDKVKVRIISVDPKGKIGLSIKQANPSANRGNRKPKFQPSFEDKLAKFMK
                     ESDERLSDLKRQTDSKRGGRGSKF"
     gene            126944..127834
                     /locus_tag="Dred_0123"
     CDS             126944..127834
                     /locus_tag="Dred_0123"
                     /note="PFAM: Ppx/GppA phosphatase;
                     KEGG: chy:CHY_0211 Ppx/GppA phosphatase"
                     /codon_start=1
                     /transl_table=11
                     /product="Ppx/GppA phosphatase"
                     /protein_id="ABO48673.1"
                     /db_xref="InterPro:IPR003695"
                     /translation="MRLASIDVGTNSTRFLLAEVNKNQLSVKKSGLITTRLGQGINEG
                     RLLPEAMERTVLAIETFLEEMATFKPQAIMTAATSAVRDACNRDEFLQLVYARTGLKV
                     KIYTGEAEAAASYAGVLSGLPIEESATVVMDVGGGSTEFIWQDPKGIHYISLPVGAVR
                     MTEGAHSEEQIEQIMAETLNKVKARQGEEFSLVAVGGTATTLAAMSLELVQYRSELVH
                     GFFISRAEILSLLKRLKEAGPEGRKKIVGLQPQRADIITAGVSIVRNVVEALDLPGLT
                     VSESDILHGLILELYHKMSK"
     gene            127923..130397
                     /locus_tag="Dred_0124"
     CDS             127923..130397
                     /locus_tag="Dred_0124"
                     /EC_number="3.1.3.16"
                     /note="KEGG: swo:Swol_0093 phosphoprotein phosphatase;
                     PFAM: Stage II sporulation E family protein;
                     SMART: protein phosphatase 2C domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Phosphoprotein phosphatase"
                     /protein_id="ABO48674.1"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR010822"
                     /translation="MLERTDIYTYQRSGRGSDKKKETKFRKGAVKAKKLENGAKGFSL
                     AFIGRALTKEKVLLYVLGFFLGRAVLLGELSPFGSSFVCATVWCFGPLPLVPLSVIGG
                     LLTVSAGSQFWSLSIIVVAIFFILLSIKPQVNRPKIVLPGVVVVTTLTVKSILISFQG
                     PALYPYITASFESIFAGVLTFMYLQALAPFARGTMTHRTMGGETVFCFLLLLAGVIAG
                     TGDLAYDCLTLRGILSRVVILLGAFLGGAGIGAATGAVTGVIPGLAFVVTPAIVGAYS
                     FAGVVAGTVRGFGKLAVAVGFLLGNIVLAVYVSNYGDLRGVITETAIASVIFVLFPLR
                     LQERIMEHLPKARQEAVPTRPVQDSRLRELTVDRIRNWGAIFTELSRSFEQVSSNVQK
                     SQEEHGLQQLFTEVSKKVCEGCALYRTCWERDFYRTYQNMLDMLSTVELQGKITMEDL
                     SDDLKKRCARLKEMSITLTCLYETYKVNKYWHQRLLESRELVAEQLKGISQIMESMSS
                     ELEFDVELDGEIDEALTNQFAKIGVPVQDVYTLHKEDGLMEVGVVKRACRGEMECRFT
                     IAPIVSKVLGRGFYVASTNCQLQGDNDSCSFKLYPALKYSLDIGVAKVGKDGNAVCGD
                     SHSILQLKEGRMALVLSDGMGTGPKAAKESGTIISLLEHLLESGFSQDLAVKTVNSIM
                     MLRTAEETFSTVDMAVVDLYNGNGTFLKIGAVPSYIIRGRRVAIIKTSALPVGVVENL
                     QFVSVSKGLEEGDLLVMLSDGVLDAYRGTDADQDQWITGILQNLGKIGAQEASEVIME
                     LAQSTAGGRIPDDMTVIVARVLPSET"
     gene            130694..132112
                     /locus_tag="Dred_0125"
     CDS             130694..132112
                     /locus_tag="Dred_0125"
                     /note="TIGRFAM: tRNA(Ile)-lysidine synthetase;
                     PFAM: PP-loop domain protein; tRNA(Ile)-lysidine
                     synthetase domain protein;
                     KEGG: cno:NT01CX_1038 cell cycle protein MesJ, putative"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA(Ile)-lysidine synthetase"
                     /protein_id="ABO48675.1"
                     /db_xref="InterPro:IPR011063"
                     /db_xref="InterPro:IPR012795"
                     /db_xref="InterPro:IPR012796"
                     /translation="MEVLERVYNEMTRHRMVKKGQLVLVGVSGGLDSVVLLHILNCLK
                     EELGISLHVAHLNHMFRGEEATEDALFVQELCSNWGIPCTVEKRNVPAYAQARGLSSE
                     LAAREVRYQFYDDVREETGGHKIALAHHANDQAESVLMNMLRGSGLKGISGIAPVRDN
                     LYIRPLLKLLRSEIEQYGQRKGLTFRIDSSNLEVVYRRNKLRHQLIPLLEKEYSPGLI
                     TILSRMSEQLREEDEYMEELARRGYQKVLLMTDGPVLDRKSLMNQPLVLLRRIMRIAY
                     QEVKSTKQGITFAHVENLISHIMRDGPERIIEMPGAVKVRLTPDLLIFESGGDIEHHR
                     SKEIYTLEVPGSATLEEGIKITCQIVRRDEIPMDLKELASTMAAIDFDSISMPLEVRF
                     RQEGDAFVPYGLGKKVKLKKFMIDRKIPRHIRNKIPLVVEKKTGRIIWVCGIRLADHI
                     GITSLTKKVILLSLENGNDSIR"
     gene            132169..134016
                     /locus_tag="Dred_0126"
     CDS             132169..134016
                     /locus_tag="Dred_0126"
                     /EC_number="3.4.24.-"
                     /note="KEGG: chy:CHY_0214 cell division protein FtsH;
                     TIGRFAM: ATP-dependent metalloprotease FtsH;
                     PFAM: peptidase M41; AAA ATPase, central domain protein;
                     peptidase M41, FtsH extracellular; ATPase associated with
                     various cellular activities, AAA_5;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protease FtsH catalytic subunit"
                     /protein_id="ABO48676.1"
                     /db_xref="InterPro:IPR000642"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005936"
                     /db_xref="InterPro:IPR011546"
                     /db_xref="InterPro:IPR011704"
                     /translation="MQGGVTFLNKVLKNLSIYLLIVLVIIFLIQFTGDKKTAVVTLRY
                     DQFITALEQNKVQSVEMTTDKSTNIIIGKLKDGRDFETNGPILDDTIIPMLREKDVQY
                     KQALPPEPSWWTGLLTTLLPILVFVMLFFFMMQQSQGGGNRVMSFGKSKAKLHTDEKR
                     KVTFEDVAGADEVKEELAEIVDFLKSPKKFNEIGAKIPKGVLLFGPPGTGKTLLARAV
                     AGEAGVPFFSISGSDFVEMFVGVGASRVRDLFEQAKKNAPCIVFIDEIDAVGRQRGAG
                     LGGGHDEREQTLNQLLVEMDGFNPNEGIIIVAATNRPDILDPALLRPGRFDRQVVVDS
                     PDVKGREEILKVHSKGKPLEENVDLEVLARRTPGFTGADLANLMNEAALLSARSGKKT
                     VGMNELEDSIERVIAGPEKKSKVISEKEKRLVSYHEAGHALVGYLLPNTDPVHKVSII
                     PRGRAGGYTLLLPKEDRYYMTRSMLLDQVVMLLGGRVAEDVVLKEISTGAQNDLERAT
                     SIIRRMIMEYGMSDELGPLTLGHKQDTPFLGRDINRDRNYSEEVAFAIDREVRKMIDQ
                     AYGKAKKLLTEHSDTLDKIAKVLMDKETIEAEEFARIMKESGLDKPAQL"
     gene            134129..134578
                     /locus_tag="Dred_0127"
     CDS             134129..134578
                     /locus_tag="Dred_0127"
                     /EC_number="2.7.4.6"
                     /note="PFAM: nucleoside diphosphate kinase;
                     KEGG: chy:CHY_0215 nucleoside diphosphate kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside diphosphate kinase"
                     /protein_id="ABO48677.1"
                     /db_xref="InterPro:IPR001564"
                     /translation="MERTYLMVKPDGVQRGLIGQIISKFEQKGYKIVGLKMMQISREV
                     AERHYGEHAGKPFFNGLVDFITSGPVVAMVIEGKDVVTTAREMMGATNPLKAAPGTIR
                     ATFGVDVGRNIIHGSDSLESAQREIGIFFKSEELIDYDRAIDTWIYE"
     gene            134678..135067
                     /locus_tag="Dred_0128"
     CDS             134678..135067
                     /locus_tag="Dred_0128"
                     /note="KEGG: sth:STH3036 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Thioesterase superfamily"
                     /protein_id="ABO48678.1"
                     /translation="MELKTGLIHETSIMVEESNTAIAYGSGGVRVFATPAMIGLMEKA
                     ALELADQYLPEGETTVGTLVNIKHTAATPVGMKVVARAELIQIEGKKLSFVVEARDET
                     GPVGAGKHERFIVNQEKFLQRAESKLD"
     gene            135083..136786
                     /locus_tag="Dred_0129"
     CDS             135083..136786
                     /locus_tag="Dred_0129"
                     /EC_number="6.3.4.3"
                     /note="PFAM: formate-tetrahydrofolate ligase, FTHFS;
                     KEGG: mta:Moth_0109 formate--tetrahydrofolate ligase"
                     /codon_start=1
                     /transl_table=11
                     /product="Formate-tetrahydrofolate ligase"
                     /protein_id="ABO48679.1"
                     /db_xref="InterPro:IPR000559"
                     /translation="MKKVPSDLEIAQAHEMIPIAEIAKNIGLGEDDIDLYGKYKAKIS
                     LDVLRKFNDRAMGKLIDITAITPTPLGEGKTVTTIGLCQGLGKIGKKVITTLRQPSMG
                     PVFGIKGGAAGGGYSQVVPMEDINIHFTGDIHAVEAANNLLAAMIDTSILLGNPLNID
                     PMTVMWNRVLDTNDRALRDIVVGLGGKENGYPRQTSFDMAVASEVMAILALAENLHDL
                     RQRLGRIIVAYTYDGKPVTAEDLKAAGAMTVIMKEALKPNLVQTLEGQACIMHAGPFA
                     NIAHGNNSVLADKIALNLADYVVTESGFGSDLGMEKFMDIKCRQSGLRPSCVVITCTI
                     RALKMHGGLGNVVAGKPLPEELTRENLPALEKGCANLAHHIKVASYYGVPVVVSINRF
                     TPDTDAEVDLVRKKALEAGALGAYPITVWAEGGEGAIELAEAVVAACEKTADFQLLYP
                     DNLSIKEKIEVLATKVYNADGVVFEPLAERKIKQFEDLGLGHLPICMAKTHLSISHDP
                     AMKGLPKNYIFPIRDIRASVGAGFLYPLAGAMRTMPGLGSKPAAHNVDIDEYGRTVGL
                     F"
     gene            137162..137785
                     /locus_tag="Dred_0130"
     CDS             137162..137785
                     /locus_tag="Dred_0130"
                     /note="PFAM: glycerol-3-phosphate responsive
                     antiterminator;
                     KEGG: chy:CHY_1843 glycerol uptake operon antiterminator
                     regulatory protein"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate responsive antiterminator"
                     /protein_id="ABO48680.1"
                     /db_xref="InterPro:IPR006699"
                     /translation="MKNILIIDLFLVVRGKDMEFLTKVMGQSHIGAAIRRVEDLEEAI
                     RHPRVHAIFLLGGDINYLPGMIKKVRASEKMLLTHIDLVEGIGKDRAGLHLIKRMGVQ
                     GIVTTKSNLAKFAKEEGLWVVQRLFIVDSESVKTAVRVAENIKPHAVEVLPATIPQYV
                     IQDIKKSLRLPVLGGGLLKTESDVKETIGKGIDAITTSLRHLWNVAL"
     gene            138176..138937
                     /locus_tag="Dred_0131"
     CDS             138176..138937
                     /locus_tag="Dred_0131"
                     /note="PFAM: regulatory protein GntR, HTH; regulatory
                     protein, DeoR; regulatory protein, ArsR; Helix-turn-helix,
                     type 11 domain protein;
                     KEGG: sth:STH793 DeoR-family transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, DeoR family"
                     /protein_id="ABO48681.1"
                     /db_xref="InterPro:IPR000524"
                     /db_xref="InterPro:IPR001034"
                     /db_xref="InterPro:IPR001845"
                     /db_xref="InterPro:IPR013196"
                     /translation="MGSERQEKIQSLLREHGNLTVAELAQRFDVSEMTIRRDLKALAA
                     LGLIQREHGRALFLQTAPDDRFFARLGEAEQEKIAIGRLAADLIAEGETIILDAGTTT
                     LAVAQEINKSCVVITNSLPIASTLANHGDEMTVLITGGEVRGTTQALVGPMARGGFTG
                     FNADKVFLAATGINIERGLSTDNMLESEVKQAMLDAARQVILVAHSKKFGQVYYHTFA
                     HWNRVHTVITDAGLPENTRRELENLGVQVMIAENR"
     gene            139014..140039
                     /locus_tag="Dred_0132"
     CDS             139014..140039
                     /locus_tag="Dred_0132"
                     /EC_number="1.2.1.12"
                     /note="KEGG: chy:CHY_0280 glyceraldehyde-3-phosphate
                     dehydrogenase, type I;
                     TIGRFAM: glyceraldehyde-3-phosphate dehydrogenase, type I;
                     PFAM: glyceraldehyde 3-phosphate dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="glyceraldehyde-3-phosphate dehydrogenase"
                     /protein_id="ABO48682.1"
                     /db_xref="InterPro:IPR000173"
                     /db_xref="InterPro:IPR006424"
                     /translation="MTVKISINGFGRIGRNVLRAMLKKDLVRAGSPVEIVAVNDLTDP
                     QTLAHLLKYDSVHGELAAEVACTEDTLLVNNVEIKVCAETDPAKLPWGKLGVDIVIES
                     TGRFTKGPDAAKHIQAGAKKVIISAPGKEVDATIVMGVNDHTYDPANHHVISNASCTT
                     NCLAPFAKVLHDKFGIVKGLMTTVHSYTNDQRILDLPHKDLRRARAAGQSIIPTTTGA
                     AKAVALVLPELKGKLNGFAMRVPTPNVSVVDLVVELAQPTTAEEINAALKEAAEGTMK
                     GILAFNALPLVSRDFNGNPNSSIIDGLSTMVMEGNMAKVVSWYDNEWGYSNRVLDLAL
                     MLAQKGL"
     gene            140043..141224
                     /locus_tag="Dred_0133"
     CDS             140043..141224
                     /locus_tag="Dred_0133"
                     /EC_number="2.7.2.3"
                     /note="PFAM: phosphoglycerate kinase;
                     KEGG: mta:Moth_0263 phosphoglycerate kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglycerate kinase"
                     /protein_id="ABO48683.1"
                     /db_xref="InterPro:IPR001576"
                     /translation="MNKKTLREIAVKGKRVFVRVDFNVPLDGDKITDDTRIQKALPTI
                     QYLVEQGARVILASHLGRPKGEVVEKYRLTPVAQRLSELLGKQVLKVNDSVGQEVLQV
                     VAGMDEGDVVLLENVRFYAAETKNDEQYARQLAELADIYVNDAFGAAHRAHASTAGIA
                     RFLPAVAGFLMEKELSMLGQAVTTPQRPFVAIIGGAKVSDKIGVIENLLNKVDVLIIG
                     GGMANTFLMAQGYRIGNSLVEADKVKLAAELIERAKARQVQLLLPTDVLVAQTMEPEV
                     EQQVVPVTGIPEQWMALDIGPETAANFAAAVKSAATVVWNGPMGVFEMEAFAKGTEAV
                     AKALAEAPATSIVGGGDSVAAINKIGLAHKISHISTGGGASLEFLEGKELPGVAALLD
                     Q"
     gene            141264..142016
                     /locus_tag="Dred_0134"
     CDS             141264..142016
                     /locus_tag="Dred_0134"
                     /EC_number="5.3.1.1"
                     /note="PFAM: triosephosphate isomerase;
                     KEGG: chy:CHY_0282 triosephosphate isomerase"
                     /codon_start=1
                     /transl_table=11
                     /product="triosephosphate isomerase"
                     /protein_id="ABO48684.1"
                     /db_xref="InterPro:IPR000652"
                     /translation="MRQLIIVGNWKMHKTVTETLEFLVELKEKLSNTAVEVVVSPPFT
                     ALAAAAEVLKGSPIALAAQNMHWKKQGAFTGEISSAMLKELGCKYVILGHSERRQYFS
                     ETDDHVNKKVKSALESELIPIVCVGESLEQRETGATEATVEKQINGALAGLSPEQAAG
                     IVIAYEPVWAIGTGKTASDEDAQQVNGYIRKVIACRFGNTVAEAVRIQYGGSVKPANA
                     QGLMAQPDIDGALVGGASLKMHDFVGIIQNVL"
     gene            142077..143627
                     /locus_tag="Dred_0135"
     CDS             142077..143627
                     /locus_tag="Dred_0135"
                     /EC_number="5.4.2.1"
                     /note="KEGG: chy:CHY_0283 phosphoglycerate mutase,
                     2,3-bisphosphoglycerate-independent;
                     TIGRFAM: phosphoglycerate mutase,
                     2,3-bisphosphoglycerate-independent;
                     PFAM: metalloenzyme domain protein; BPG-independent PGAM
                     domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglycerate mutase"
                     /protein_id="ABO48685.1"
                     /db_xref="InterPro:IPR005995"
                     /db_xref="InterPro:IPR006124"
                     /db_xref="InterPro:IPR011258"
                     /translation="MQHQYHPLALIILDGWGLHRDEKGNAIACANIPYVKGLLKRYPS
                     TSLACSGEAVGLPAGQMGNSEVGHLNMGAGRVVYQELTRITKAIKDGDFFQNQELLRV
                     IQGAKKSNSALHIMGLLSDGGVHSHIRHIFAALELAARQGLSKVYVHAFLDGRDVPPS
                     SAKGYMNALLAKMKELGVGQVATVSGRYYAMDRDSRWERTELAYRAMVFAEGLQANSP
                     VEAIDVGYQRGETDEFIKPTVITDDCKQPIARVADGDSIIFMNFRPDRARQITRSFVD
                     DDFSGFQRGTGGPKVHFVCLTVYDKTIKTPVAFPPTQLVHTLGEWLDKQGLKQLRLAE
                     TEKYAHVTFFFNGGVEAPNPNEERVLIPSPKVATYDQKPEMSAQEVAEAFIKKFNTAQ
                     YDVYITNFANPDMVGHTGNMAATRIAVETVDKCVGKIVSTVLEKAGTVIITADHGNAE
                     KMLDENGGAYTAHTTNPVPFILVGDRYEGGKLKECGSLQDIAPTMLEILGLPKPPEMT
                     GESLLPKG"
     gene            143775..145058
                     /locus_tag="Dred_0136"
     CDS             143775..145058
                     /locus_tag="Dred_0136"
                     /EC_number="4.2.1.11"
                     /note="PFAM: enolase;
                     KEGG: tte:TTE1759 enolase"
                     /codon_start=1
                     /transl_table=11
                     /product="enolase"
                     /protein_id="ABO48686.1"
                     /db_xref="InterPro:IPR000941"
                     /translation="MTIISDIFAREILDSRGNPTLEAEVWLEDGTVGRAAVPSGASTG
                     AYEAVELRDGDKGRYLGKGVLKAVNHVNEILGPELIGMDVTDQIGIDQRMIELDGTPN
                     KGKLGANAILGVSLAVAKAAANFLGMPLYQYIGGVNAKELPVPMMNILNGGAHADNNV
                     DIQEFMVLPVGADSFSEGLRMGAEIFHNLKAVLKARGLNTAVGDEGGFAPNLKSNEEA
                     LAVIIEAIEKAGYKPGQDVFLGLDVAATELYKGGNYVLEGEGVTYTSEQMIEFYQRMV
                     EKFPIITIEDGLSEEDWEGWAKLTQALGKKVQLVGDDLFVTNTERLDKGIKSAVANSI
                     LIKLNQIGTLTETLDAIEMAKRAGYTAVVSHRSGETADTTIADLAVATNAGQIKTGAP
                     SRTDRVAKYNQLLRIEEELSTMAKYRGKDVFYNLR"
     gene            145760..148792
                     /locus_tag="Dred_0137"
     CDS             145760..148792
                     /locus_tag="Dred_0137"
                     /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
                     oxidoreductase; 4Fe-4S ferredoxin, iron-sulfur binding
                     domain protein;
                     KEGG: sfu:Sfum_1977 4Fe-4S ferredoxin, iron-sulfur binding
                     domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="4Fe-4S ferredoxin, iron-sulfur binding domain
                     protein"
                     /protein_id="ABO48687.1"
                     /db_xref="InterPro:IPR000103"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR001450"
                     /db_xref="InterPro:IPR013027"
                     /translation="MTTTNKVGAVLVVGSGIAGIQASLDLAESGYYVYLVEREPAIGG
                     TMPMLDKTFPTNDCSMCILSPKLVDCGRHLNVNSMTNSEVVGLEGEPGNFKVTIRTKA
                     RYIDVNKCTGCGSCAEACPVKVDDAFNQGLNKRKAIYKLYAQAFPNAYAIDSSKCLKF
                     KNLSNDKLCGKCIKACQAGAINHHMQDEETQIEVGSIVLVPGFEAFDPTQLELYQYGK
                     LKNVVTSLEFERILSASGPFGGHLIRPSDHKEPQKVAWIQCVGSRNCRIGNGYCSSVC
                     CMYAIKQAVIAKEHTPYDLGASIFYMDMRTYGKDFEKYYERSKAQYGVNFVRSRVYSL
                     DLGENDNVKIRYALEDGTVITEEYDMVVLSVGLEPHKAAVELAKTLGVELNQYNFVDV
                     PELSGVATNKPGVYVAGAFSGPRDIPETVMQASAAAGEVQKLLAEAKGTLTKTKEYPA
                     PKDVSGEIVRTGVFVCHCGINIGGVVDVPSVAEYAKTLPGVVYATEKLYACSQDASAQ
                     IKEAIEEHGLNRIVVASCSPRTHEPMFQETLKEAGLNPHLFEMTNIRDHCSWVHQNEP
                     EKATEKAKDLVKMAVKKAALLEPVHPITLPMNHDVLVIGGGVSGLTSALNLADQGYQV
                     YIVEKAEELGGIAKRIKYGMGGEDVPAYLNELIGKVNSHTKIKVYTSVEIADVQGFMG
                     NYQTKLTNGEEIKHGVVIIATGAAEYQPTEYLYGHNTRVRTLLEVEGMLADGKLQNAN
                     NYVFIQCVGSRDDERPYCSRICCTKSIKLALKVKEAKPSANVYILYRDIRTYGYFEDL
                     YTEARRKGVVFVRYSVDAKPVVEGTSFGTKVTFTDHVLNRPVEIYADIIGLATAIVPN
                     DNTSLSKLFKVPINAEGFFLEAHMKLRPVDFGTDGVFMCGLAHGPKNLEENISQAKAA
                     AGRAVTALAKENIETDGKAAYVDKRKCMACGVCVEVCPAKAATLVTDERGNTVADINP
                     ALCKGCGACSSSCRCGAINVKGCSNEQLMAMVQAVAWQ"
     gene            149115..149537
                     /locus_tag="Dred_0138"
                     /pseudo
     gene            149549..150493
                     /locus_tag="Dred_0139"
     CDS             149549..150493
                     /locus_tag="Dred_0139"
                     /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
                     protein;
                     KEGG: sfu:Sfum_1972 4Fe-4S ferredoxin, iron-sulfur binding
                     domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="4Fe-4S ferredoxin, iron-sulfur binding domain
                     protein"
                     /protein_id="ABO48688.1"
                     /db_xref="InterPro:IPR001450"
                     /translation="MNKTESIRETAKKLLAEKKVDLVVGFAQGSLPLRSTPYFARTPE
                     EAEKLIWSATCENNLANFVRKRTEKVAVIAKGCDVRAIVGLIKEGQVNRENLTIIGVP
                     CEGMVDRKQICQAVGCKEILEATDTGAELVLKGKDFEKTVAKAEVMFGSCKTCQYNNP
                     VIFDELIGEQVEVKEANYADIEAFEALSDEERAAFIAKEMEKCIRCYACRQACPMCYC
                     SECFVDCGAPAWIGKSAANVDDNALFQAVRVLHLAGRCVDCGACERACPMGIKLSLLN
                     RKMVKDVKELFGAEAGVNLEDPPALNTHKFEDNEDFML"
     gene            150511..151515
                     /locus_tag="Dred_0140"
     CDS             150511..151515
                     /locus_tag="Dred_0140"
                     /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
                     protein;
                     KEGG: mta:Moth_0815 4Fe-4S ferredoxin, iron-sulfur
                     binding"
                     /codon_start=1
                     /transl_table=11
                     /product="4Fe-4S ferredoxin, iron-sulfur binding domain
                     protein"
                     /protein_id="ABO48689.1"
                     /db_xref="InterPro:IPR001450"
                     /translation="MILNKSETASLLDKLANEYRVIAPVEKEGLVQFAAIQKGEEAKL
                     DYMNAKKPGKEILFPQSEELYSYTVDAEGVRMQDNVDPKATIVFGMRPCDVKSMVLLD
                     NVFKNDQYEDVYYLTRRANTLIVGLGCNEPSATCFCSSMSCGPFAKEGSDIFLTDIGE
                     AYVVEGISEKGKELLAKLGLAEASAEAKGQAAKLQEETKADGSVNIEGLAEKLGGMFE
                     HPYWDSLYEKCLGCGACTYLCPTCHCFDIADEATDCNGCRVRNWDACMFPLFTLHGSG
                     HNPRPGGKARWRQRLMHKFNYFVERYNATACVGCGRCIKNCPVNLDIRQVLADVRALD
                     "
     gene            151537..152364
                     /locus_tag="Dred_0141"
     CDS             151537..152364
                     /locus_tag="Dred_0141"
                     /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
                     protein; Oxidoreductase FAD-binding domain protein;
                     KEGG: sfu:Sfum_1970 oxidoreductase FAD/NAD(P)-binding
                     domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase FAD/NAD(P)-binding domain
                     protein"
                     /protein_id="ABO48690.1"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001709"
                     /db_xref="InterPro:IPR001834"
                     /db_xref="InterPro:IPR008333"
                     /translation="MRNPYLPLPMKLVKNFTETSDKLIHTFTLEFQNEQDAASFQYEP
                     GQFAELMVYGKGEAPFGIASSPTEKGILKFSVAKVGVVSTALHMLEEGAIVGVRGPLG
                     NSYPLEQLKGKSLTIIGGGFAFTTLRSTIQYILANRGDYGDLTVIYGARNPGLLLYKD
                     ELAEWEARSDINLITTIDREVEGWNGRVGFIPTVTKDVAPKTDYAIICGPPVMIKFTM
                     PVLVECGFTPDRIIMSLENRMKCGIGMCGRCNVGSKYVCKDGPVFTKEQLDKLPNEY"
     gene            152407..153663
                     /locus_tag="Dred_0142"
     CDS             152407..153663
                     /locus_tag="Dred_0142"
                     /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
                     protein; protein of unknown function DUF224, cysteine-rich
                     region domain protein;
                     KEGG: mta:Moth_1452 protein of unknown function DUF224,
                     cysteine-rich region"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF224,
                     cysteine-rich region domain protein"
                     /protein_id="ABO48691.1"
                     /db_xref="InterPro:IPR001450"
                     /db_xref="InterPro:IPR004017"
                     /translation="MSENAKVQEPEVINFSNMDPKFRDEVMEKLKNIDWTQCLACGMC
                     TAGCPYADVHGNNDPRKFLRKLVLGLREEALKDPFIWNCTVCERCTVECPMGINFGII
                     TRGMRGQFGIPTPGFMDKVVNEHIHSGNQMDVPQDEYQETIEWIEEELQEELGDPNYK
                     VNVGKKGAEFIFGLNAREIKYYSHELQEILKVFYYAKADYTLGEHRWDCTNLALFSGK
                     NDDFCEIQRPFFEEAVRLGVKKIVVTECGHAYKSTRLFDEKFWDGPKLPILSVLEVYD
                     EWIKNGTLKVDPSRNPEPCTVHDPCNLVRKSGVLDANRNVMNAICSDFREMYPNRQYN
                     YCCGAGGGALAVPEQKSMRMEKARRKIEQIDATGATTVAIPCHNCMDQFTDMNKEYKK
                     GWKCTHITPLLAKAIILPDWAKKEEE"
     gene            153798..156830
                     /locus_tag="Dred_0143"
     CDS             153798..156830
                     /locus_tag="Dred_0143"
                     /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
                     oxidoreductase; 4Fe-4S ferredoxin, iron-sulfur binding
                     domain protein;
                     KEGG: sfu:Sfum_1977 4Fe-4S ferredoxin, iron-sulfur binding
                     domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="tungsten-dependent benzoyl-CoA reductase-related
                     protein bamE"
                     /protein_id="ABO48692.1"
                     /db_xref="InterPro:IPR000103"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR001450"
                     /db_xref="InterPro:IPR013027"
                     /translation="MTTTNKVGAVLVVGSGIAGIQASLDLAESGYYVYLVEREPAIGG
                     TMPMLDKTFPTNDCSMCILSPKLVDCGRHLNVNSMTNSEVVGLEGEPGNFKVTIRTKA
                     RYIDVNKCTGCGSCAEACPVKVDDAFNQGLNKRKAIYKLYAQAFPNAYAIDSSKCLKF
                     KNLSNDKLCGKCIKACQAGAINHHMQDEETQIEVGSIVLVPGFEAFDPTQLELYQYGK
                     LKNVVTSLEFERILSASGPFGGHLIRPSDHKEPQKVAWIQCVGSRNCRIGNGYCSSVC
                     CMYAIKQAVIAKEHTPYDLGASIFYMDMRTYGKDFEKYYERSKAQYGVNFVRSRVYSL
                     DLGENDNVKIRYALEDGTVITEEYDMVVLSVGLEPHKAAVELAKTLGVELNQYNFVDV
                     PELSGVATNKPGVYVAGAFSGPRDIPETVMQASAAAGEVQKLLAEAKGTLTKTKEYPA
                     PKDVSGEIVRTGVFVCHCGINIGGVVDVPSVAEYAKTLPGVVYATEKLYACSQDASAQ
                     IKEAIEEHGLNRIVVASCSPRTHEPMFQETLKEAGLNPHLFEMTNIRDHCSWVHQNEP
                     EKATEKAKDLVKMAVKKAALLEPVHPITLPMNHDVLVIGGGVSGLTSALNLADQGYQV
                     YIVEKAEELGGIAKRIKYGMGGEDVPAYLNELIGKVNSHTKIKVYTSVEIADVQGFMG
                     NYQTKLTNGEEIKHGVVIIATGAAEYQPTEYLYGHNTRVRTLLEVEGMLADGKLQNAN
                     NYVFIQCVGSRDDERPYCSRICCTKSIKLALKVKEAKPSANVYILYRDIRTYGYFEDL
                     YTEARRKGVVFVRYSVDAKPVVEGTSFGTKVTFTDHVLNRPVEIYADIIGLATAIVPN
                     DNTSLSKLFKVPINAEGFFLEAHMKLRPVDFGTDGVFMCGLAHGPKNLEENISQAKAA
                     AGRAVTALAKENIETDGKAAYVDKRKCMACGVCVEVCPAKAATLVTDERGNTAADINP
                     ALCKGCGACSSSCRCGAINVKGCSNEQLMAMVQAVAWQ"
     gene            157153..157353
                     /locus_tag="Dred_0144"
     CDS             157153..157353
                     /locus_tag="Dred_0144"
                     /note="PFAM: methyl-viologen-reducing hydrogenase, delta
                     subunit;
                     KEGG: sfu:Sfum_1973 methyl-viologen-reducing hydrogenase,
                     delta subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-viologen-reducing hydrogenase, delta
                     subunit"
                     /protein_id="ABO48693.1"
                     /db_xref="InterPro:IPR003813"
                     /translation="MAEREPKIVAFLCNWCSYAGADLAGVGRLQYPPNIRVVRVPCSG
                     RINPLFIMGALRSGADAILTSG"
     gene            157390..157575
                     /locus_tag="Dred_0145"
     CDS             157390..157575
                     /locus_tag="Dred_0145"
                     /note="KEGG: gsu:GSU0089 heterodisulfide reductase
                     subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="heterodisulfide reductase subunit"
                     /protein_id="ABO48694.1"
                     /translation="MARRKFALMKNLLNYMGVEKDRVNFTWVSASEGARFADLITDLT
                     GKVKEMGPNKGLFRKVE"
     gene            157587..158531
                     /locus_tag="Dred_0146"
     CDS             157587..158531
                     /locus_tag="Dred_0146"
                     /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
                     protein;
                     KEGG: sfu:Sfum_1972 4Fe-4S ferredoxin, iron-sulfur binding
                     domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="4Fe-4S ferredoxin, iron-sulfur binding domain
                     protein"
                     /protein_id="ABO48695.1"
                     /db_xref="InterPro:IPR001450"
                     /translation="MNKTESIRETAKKLLAEKKVDLVVGFAQGSLPLRSTPYFARTPE
                     EAEKLIWSATCENNLANFVRKRTEKVAVIAKGCDVRAIVGLIKEGQVNRENLTIIGVP
                     CEGMVDRKQICQAVGCKEILEATDTGAELVLKGKDFEKTVAKAEVMFGSCKTCQYNNP
                     VIFDELIGEQVEVKEANYADIEAFEALSDEERAAFIAKEMEKCIRCYACRQACPMCYC
                     SECFVDCGAPAWIGKSAANVDDNALFQAVRVLHLAGRCVDCGACERACPMGIKLSLLN
                     RKMVKDVKELFGAEAGVNLEDPPALNTHKFEDNEDFML"
     gene            158549..159553
                     /locus_tag="Dred_0147"
     CDS             158549..159553
                     /locus_tag="Dred_0147"
                     /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
                     protein;
                     KEGG: mta:Moth_0815 4Fe-4S ferredoxin, iron-sulfur
                     binding"
                     /codon_start=1
                     /transl_table=11
                     /product="4Fe-4S ferredoxin, iron-sulfur binding domain
                     protein"
                     /protein_id="ABO48696.1"
                     /db_xref="InterPro:IPR001450"
                     /translation="MILNKSETASLLDKLANEYRVIAPVEKEGLVQFAAIQKGEEAKL
                     DYMNAKKPGKEILFPQSEELYSYTVDAEGVRMQDNVDPKATIVFGMRPCDVKSMVLLD
                     NVFKNDQYEDVYYLTRRANTLIVGLGCNEPSATCFCSSMSCGPFAKEGSDIFLTDIGE
                     AYVVEGISEKGKELLAKLGLAEASAEAKGQAAKLQEETKADGSVNIEGLAEKLGGMFE
                     HPYWDSLYEKCLGCGACTYLCPTCHCFDIADEATDCNGCRVRNWDACMFPLFTLHGSG
                     HNPRPGGKARWRQRLMHKFNYFVERYNATACVGCGRCIKNCPVNLDIRQVLADVRALD
                     "
     gene            159575..160402
                     /locus_tag="Dred_0148"
     CDS             159575..160402
                     /locus_tag="Dred_0148"
                     /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
                     protein; Oxidoreductase FAD-binding domain protein;
                     KEGG: sfu:Sfum_1970 oxidoreductase FAD/NAD(P)-binding
                     domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase FAD/NAD(P)-binding domain
                     protein"
                     /protein_id="ABO48697.1"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001709"
                     /db_xref="InterPro:IPR001834"
                     /db_xref="InterPro:IPR008333"
                     /translation="MRNPYLPLPMKLVKNFTETSDKLIHTFTLEFQNEQDAASFQYEP
                     GQFAELMVYGKGEAPFGIASSPTEKGILKFSVAKVGVVSTALHMLEEGAIVGVRGPLG
                     NSYPLEQLKGKSLTIIGGGFAFTTLRSTIQYILANRGDYGDLTVIYGARNPGLLLYKD
                     ELAEWEARSDINLITTIDREVEGWNGRVGFIPTVTKDVAPKTDYAIICGPPVMIKFTM
                     PVLVECGFTPDRIIMSLENRMKCGIGMCGRCNVGSKYVCKDGPVFTKEQLDKLPNEY"
     gene            160584..161342
                     /locus_tag="Dred_0149"
     CDS             160584..161342
                     /locus_tag="Dred_0149"
                     /note="KEGG: chy:CHY_1282 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABO48698.1"
                     /db_xref="InterPro:IPR000031"
                     /translation="MGPEELRKLLESVRTRDTSIEEAINKLKMLPYDDLGYAKIDYHR
                     HLRKGFPEVIFCQGKTVEQVAEIFKRLSRASDTNIIGTRASEEMFQAVKKHVPGAEYD
                     AMSKMLMRRFSNTAKRGKVCVCSAGTADLPVAEEAALTCELMGNHVERIYDTGVAGIH
                     RLLDQVDKISQANVIIVVAGMEGALPSVVGGLVDKPVIAVPTSVGYGASFHGLAALLG
                     MLNSCASGVTVVNIDNGFGAGYAASLINKLAGDQ"
     gene            161342..162148
                     /locus_tag="Dred_0150"
     CDS             161342..162148
                     /locus_tag="Dred_0150"
                     /note="PFAM: protein of unknown function DUF111;
                     KEGG: chy:CHY_1283 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF111"
                     /protein_id="ABO48699.1"
                     /db_xref="InterPro:IPR002822"
                     /translation="MRVAYLDCFAGISGDMFLGALVDLGVELPELKQELLKLGVENFD
                     MIARKVTRKGISGVKVDVKVTGDQPHRHLDDIVNLLSNSELEDTIKQDAQEIFGMLAT
                     AEGKIHGCPPEKVHFHEVGAVDAIVDIVGTLVGLKKLGIEAVYCSPLNVGRGTVKCAH
                     GIMPVPAPATAELLVNVPLYTAGPAIELVTPTGAVLAKYLAKEFGLLPAMTLKAVGYG
                     AGDRETDIPNLLRIMLGERDHHIFTFSHWQQPHEHSHNHGHGQSHSHSHQ"
     gene            162186..162998
                     /locus_tag="Dred_0151"
     CDS             162186..162998
                     /locus_tag="Dred_0151"
                     /note="PFAM: ExsB family protein; PP-loop domain protein;
                     KEGG: chy:CHY_1281 conserved hypothetical protein
                     TIGR00268"
                     /codon_start=1
                     /transl_table=11
                     /product="PP-loop domain protein"
                     /protein_id="ABO48700.1"
                     /db_xref="InterPro:IPR004479"
                     /db_xref="InterPro:IPR005232"
                     /db_xref="InterPro:IPR011063"
                     /translation="MLLQKKYQKLRQLLGECGKVLVAYSGGTDSAFLLAVAVQELGDN
                     VLAVTAISPTSTKAEVAEAQQLAKELGVHHRIIHSKEMDLRDFVGNTAERCYICKYSR
                     YFDLQEIAKQKKIPWVLDGSNMDDLDDYRPGNRAIKELGLRSPMQEVTLTKSEIRQLS
                     RQMGLPTWNKPSSPCLASRIPYGQEITEEKLRRVEKAEEYLTKRGFSPLRVRHYPAEA
                     RIEISPEQFSKLIEKSKDITKGLRELGFPKVTLDLDGFYSGSLNKNLPDKGE"
     gene            163003..163407
                     /locus_tag="Dred_0152"
     CDS             163003..163407
                     /locus_tag="Dred_0152"
                     /note="TIGRFAM: uncharacterized domain 1;
                     PFAM: thioesterase superfamily protein;
                     KEGG: mta:Moth_1795 phenylacetic acid degradation-related
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="thioesterase superfamily protein"
                     /protein_id="ABO48701.1"
                     /db_xref="InterPro:IPR003246"
                     /db_xref="InterPro:IPR003736"
                     /db_xref="InterPro:IPR006683"
                     /translation="MDELRQQLFQFTKENPFNKMMNLEVTELKPGESCIEITVNTNHL
                     NPRGKLHGGVISALADTAMGVAIRTLGKAGVTVNLNTNFIAPGNPGDRVVARGKVVHE
                     GSTLISAECTLTRGEDILARSTGVWFIVQDTN"
     gene            163467..163991
                     /locus_tag="Dred_0153"
     CDS             163467..163991
                     /locus_tag="Dred_0153"
                     /note="PFAM: nitroreductase;
                     KEGG: afu:AF0226 NADH oxidase (NoxC)"
                     /codon_start=1
                     /transl_table=11
                     /product="nitroreductase"
                     /protein_id="ABO48702.1"
                     /db_xref="InterPro:IPR000415"
                     /translation="MLTKDVIAAIEQRCSVHSFTGEPIPEATVGRLVEAALRAPSAGN
                     LQPWKLVVVFKDEVKRDLAGACERESFIADAPVNIVVCLEKGKSEQVYGPEGQVYQYQ
                     DIGAAIENMLLAATGYGYGTCWVAAFQEDKVSQILQLGGDLRPVAIVAVGNTDEKQEP
                     VARRNAEDVVRIIH"
     gene            164123..165322
                     /locus_tag="Dred_0154"
     CDS             164123..165322
                     /locus_tag="Dred_0154"
                     /EC_number="2.5.1.15"
                     /note="KEGG: mta:Moth_0110 dihydropteroate synthase;
                     TIGRFAM: dihydropteroate synthase;
                     PFAM: dihydropteroate synthase, DHPS"
                     /codon_start=1
                     /transl_table=11
                     /product="Dihydropteroate synthase"
                     /protein_id="ABO48703.1"
                     /db_xref="InterPro:IPR000489"
                     /db_xref="InterPro:IPR006390"
                     /translation="MSIEIGVKFIDNLEQARLEIQDVGSDQGGWQRMAPKAVHRVIKL
                     TDVSPTQANIIKQEILARGGEAAVARGVVNHSVEKTDVLLMASLKQYRGFVDKLRMQP
                     FGLAKLAERLAEALGNLEGVKVRKLNCRGKVLELGQRTRVMGILNITPDSFSDGGRYM
                     EVESALEHALRMMEEGADIIDLGGVSTRPGYSEVTEDEEKRRVVPVLEKLLQAVPVPI
                     SLDTWRAGVAKEALEAGVHIINDQWSLRGDPGLAAVVAKYQAPIIMMHNGYNTNYGDI
                     MMEVLHFLRVGIDIAEESGISRQNIIVDPGIGFAKTYEQNLEVLRRMKELTVLGCPIL
                     LGTSRKSVIAKTLNLPVDQRVEGTGATVALGIACGADIVRVHDVKAMVRVAKMSDAIL
                     RGVNCEG"
     gene            165285..165680
                     /locus_tag="Dred_0155"
     CDS             165285..165680
                     /locus_tag="Dred_0155"
                     /EC_number="4.1.2.25"
                     /note="TIGRFAM: dihydroneopterin aldolase;
                     KEGG: mta:Moth_0407 dihydroneopterin aldolase"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroneopterin aldolase"
                     /protein_id="ABO48704.1"
                     /db_xref="InterPro:IPR006156"
                     /db_xref="InterPro:IPR006157"
                     /translation="MMPYYGGLTVKDKIILRGMNFFGYHGVFEEERRLGQPFQVDLEL
                     SMDLQPAGQGDDLNLSVSYAEVFEIVEQVLTGEPYKLLEAVAERISQRVLEQYEKVEE
                     IKVTLKKPNAPIQGNFQYMAVEITRGRKH"
     gene            165684..166166
                     /locus_tag="Dred_0156"
     CDS             165684..166166
                     /locus_tag="Dred_0156"
                     /EC_number="2.7.6.3"
                     /note="KEGG: chy:CHY_2381
                     2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
                     pyrophosphokinase;
                     TIGRFAM: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
                     pyrophosphokinase;
                     PFAM: 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase,
                     HPPK"
                     /codon_start=1
                     /transl_table=11
                     /product="2-amino-4-hydroxy-6-
                     hydroxymethyldihydropteridine pyrophosphokinase"
                     /protein_id="ABO48705.1"
                     /db_xref="InterPro:IPR000486"
                     /db_xref="InterPro:IPR000550"
                     /translation="MTVAYIGLGSNMGDKKAYIQSALKKLDHYTGIHLLRVASLYESA
                     PWGYLEQDWFVNTVAEVETTLSPEKILQVLFDIERSLNRTRDIHWGPRTVDLDLLLYG
                     SQTICFPHLQVPHPRMHERAFVLVPLAELCPNMILTQGTVMELAEKTLAEQAIRKIES
                     "
     gene            complement(166197..166442)
                     /locus_tag="Dred_0157"
     CDS             complement(166197..166442)
                     /locus_tag="Dred_0157"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABO48706.1"
                     /translation="MYTMPTIRVEGFNEAPDYMVEKVLMDNTPNLGDATGKAFIQNFE
                     QAISECQKTLEKGYRLTDFWANPDTGVEFIFKKIKDT"
     gene            complement(166455..167873)
                     /locus_tag="Dred_0158"
     CDS             complement(166455..167873)
                     /locus_tag="Dred_0158"
                     /note="PFAM: Polynucleotide adenylyltransferase region;
                     metal-dependent phosphohydrolase, HD sub domain;
                     SMART: metal-dependent phosphohydrolase, HD region;
                     KEGG: tte:TTE0109 tRNA nucleotidyltransferase/poly(A)
                     polymerase"
                     /codon_start=1
                     /transl_table=11
                     /product="metal dependent phosphohydrolase"
                     /protein_id="ABO48707.1"
                     /db_xref="InterPro:IPR002646"
                     /db_xref="InterPro:IPR003607"
                     /db_xref="InterPro:IPR006674"
                     /translation="MSTISMLSQQLSIQTYLVGGAVRDLFLNKIPVDLDFCVTAKVFA
                     LAQTLTQQYQGSLVTLDDQREMLRVVTNSWHLDFSPLRDEILEKDLFARDFTLNAMAL
                     PVSMGINKYNWQNQIQDPTGGKGDLKKGLLRAASSSSIQQDPLRSLRGIRFAATYNLA
                     IIPETMVLLRQGTRRIEQIAGERLWHELAILFKLPITSFWINYMDQELHFWQYLLPGQ
                     LRMAQTKQNHYHVENVWRHCLRTYECLEVILQELSTIPSEGEPLLIHFNQHLSGGRSR
                     CQVLKLAALIHDVGKPDTAVIREDGRISFHGHAEAGVPYAEALATRLKLSRLERHYLV
                     NLVLLHMLPLNLYNSGDRSDLSVYRLFRSLENYILDVLILSLADVTATLTAGERISEL
                     EAYRTFILNLLGKFIVEKDRFHPVPYLSGAALLELGIPEGPEVGLILEKLCEEQVTGS
                     ITDTKTALLWVKTKLAGNNKDK"
     gene            168265..169296
                     /locus_tag="Dred_0159"
     CDS             168265..169296
                     /locus_tag="Dred_0159"
                     /note="PFAM: 6-phosphogluconate dehydrogenase,
                     NAD-binding; NAD-dependent glycerol-3-phosphate
                     dehydrogenase domain protein;
                     KEGG: mta:Moth_0140 NADP oxidoreductase, coenzyme
                     F420-dependent"
                     /codon_start=1
                     /transl_table=11
                     /product="6-phosphogluconate dehydrogenase, NAD-binding
                     protein"
                     /protein_id="ABO48708.1"
                     /db_xref="InterPro:IPR006115"
                     /db_xref="InterPro:IPR011128"
                     /translation="MNCKPSFAIIGAGKVGSAIGVLLKERGYAPVGVYSRSKTSARRL
                     ADQLHSKLYKNAVDAAKAADLVFITTTDREIGTTAAIIARKGGCKPGQIVIHTSGALA
                     SDVMEPVREQGAWAVSVHPLQSFASIESAKENLPGSSFALEGDEQALPLAEKMVKDLQ
                     GRYFIIKAADKPLYHAAAVIASNYLVSLMHLSASIYRQLGLDEEQARDALFPLIQGTL
                     NNIAKVGPAQALTGPVARGDASTVKGHISALSRMNWRTQEVYRSLGLYTVGLALENGS
                     ITTNEGAALSNIFLEVENCEQKGNYCRLSAHETGSQTNSHVNRLRLSDGYVGRCFWYR
                     RHPGWGFPR"
     gene            169148..169981
                     /locus_tag="Dred_0160"
     CDS             169148..169981
                     /locus_tag="Dred_0160"
                     /EC_number="2.1.2.11"
                     /note="KEGG: swo:Swol_0101 3-methyl-2-oxobutanoate
                     hydroxymethyltransferase;
                     TIGRFAM: 3-methyl-2-oxobutanoate hydroxymethyltransferase;
                     PFAM: Ketopantoate hydroxymethyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="ketopantoate hydroxymethyltransferase"
                     /protein_id="ABO48709.1"
                     /db_xref="InterPro:IPR003700"
                     /translation="MNKKVTTADFRRMKQEAKPIAMLTAYDYPTAMLVDASGIDGILV
                     GDSLGNVVLGYDSTVPVTMDDMIHHLRAVTRGAKRALVVGDMPFLSYHISREESVRNA
                     GRLMQEGLAQAVKLEGGREVADTVKAITEAGIPVMGHLGLTPQSVHQMGGYKVQGKDG
                     EAARRLLEDAKALEAAGVFAIVLECIPQQLAKVVTEAVKVPTIGIGAGSDCDGQILVT
                     HDLLGMFSDFTPKFVKKYANLKEQIIKACEDYQQEVRDKAFPGPGHVFNMADEELKKI
                     Y"
     gene            169992..170837
                     /locus_tag="Dred_0161"
     CDS             169992..170837
                     /locus_tag="Dred_0161"
                     /EC_number="6.3.2.1"
                     /note="KEGG: chy:CHY_2376 pantoate--beta-alanine ligase;
                     TIGRFAM: pantoate--beta-alanine ligase;
                     cytidyltransferase-related domain;
                     PFAM: Pantoate-beta-alanine ligase"
                     /codon_start=1
                     /transl_table=11
                     /product="pantothenate synthetase"
                     /protein_id="ABO48710.1"
                     /db_xref="InterPro:IPR003721"
                     /db_xref="InterPro:IPR004821"
                     /translation="MRLFKTVDEVRSFINSVRREGKTVGLVPTMGYLHQGHLSLVHEA
                     KRSCDVVIVSIFVNPTQFDPNEDYQTYPRDLQRDVALVADAGVEAIFAPEAEEMYSQG
                     FSSFVDVTGVSECLCGASRPGHFRGVATVVTKLFNIVLPDAAFFGQKDFQQVMVIKRM
                     VADLNMSVQIIDVPIVREEDGLALSSRNVYLSQEERKAALVLHRSLHLAKEQVNEGER
                     SAQQIKERIIKEIQAEPLANIDYVEILSVPDLKPIEIIKGNVLLALAVRFGKTRLIDN
                     SILEA"
     gene            170841..171224
                     /locus_tag="Dred_0162"
     CDS             170841..171224
                     /locus_tag="Dred_0162"
                     /EC_number="4.1.1.11"
                     /note="KEGG: chy:CHY_2375 aspartate 1-decarboxylase
                     precursor;
                     TIGRFAM: aspartate 1-decarboxylase;
                     PFAM: aspartate decarboxylase"
                     /codon_start=1
                     /transl_table=11
                     /product="L-aspartate 1-decarboxylase"
                     /protein_id="ABO48711.1"
                     /db_xref="InterPro:IPR003190"
                     /translation="MLLFMFKSKIHRATVTEANLNYMGSITIDQELMKAAGILPNEKV
                     QVVNNNNGARLETYVIEGEPGSGVICLNGAAARLVQPGDTVIIIAYTMIGEQEARDFK
                     PKVVMVDEKNKITEVIDQECHGVCG"
     gene            171383..172306
                     /locus_tag="Dred_0163"
     CDS             171383..172306
                     /locus_tag="Dred_0163"
                     /note="TIGRFAM: quinolinate synthetase complex, A subunit;
                     PFAM: Quinolinate synthetase A;
                     KEGG: chy:CHY_2374 quinolinate synthetase"
                     /codon_start=1
                     /transl_table=11
                     /product="quinolinate synthetase A"
                     /protein_id="ABO48712.1"
                     /db_xref="InterPro:IPR003473"
                     /translation="MSIEDKISQLTEDIKRLKKERNAIILAHVYQRPEVQEVADIIGD
                     SLELSRRAATTDADVIVFCGVHFMAESAAILSPDKVILLPEENAGCPMADMVTAEELF
                     IKKKEMPEAIVVAYVNTSAEVKAESDICCTSANAVKIVQSIPEDKPIIFIPDKNLGAY
                     VANKTARPMTLWEGWCNTHDWVTTEEVMKAKETYPEALVLIHPECRPEVVALADYVSS
                     TTGLIKFAKESSAKKFIIGTEAGILHQLYKQCPGKEFYLATKRLVCPNMKATTLDKVK
                     EALDNMQPQITVAADIREKALACLDRMLAVQ"
     gene            172354..173940
                     /locus_tag="Dred_0164"
     CDS             172354..173940
                     /locus_tag="Dred_0164"
                     /EC_number="1.4.3.16"
                     /note="KEGG: swo:Swol_0105 L-aspartate oxidase;
                     TIGRFAM: L-aspartate oxidase;
                     PFAM: fumarate reductase/succinate dehydrogenase
                     flavoprotein domain protein; FAD dependent oxidoreductase"
                     /codon_start=1
                     /transl_table=11
                     /product="L-aspartate oxidase"
                     /protein_id="ABO48713.1"
                     /db_xref="InterPro:IPR003953"
                     /db_xref="InterPro:IPR004112"
                     /db_xref="InterPro:IPR005288"
                     /db_xref="InterPro:IPR006076"
                     /translation="MTNRYLVNFDSRELPQQEAEYLIIGGGIAGLFTAWAAAKSGAQI
                     TLLTKRTVAESNTDRAQGGIAAALGQHDSPALHMQDTLIAGAGLCDEDAVRILVNEGP
                     ERVKELIKMGASFDRTGEDLCFTREGCHSQHRILHAQGDATGAEILRALYQNVSSLSS
                     VEIIENQYVVDLLVKNNVCYGALAMDQITGQFRVFRGKIVVLATGGSGRLYNYTTNPE
                     VATADGIALAYRAGAEVMDMEFIQFHPTSLVLPDAPRFLISEAVRGEGALLRNSWGER
                     FMAQYHGMAELAPRDIVSRAILSEMARTRANSVFLDLTHLDPDKIKERFPTITQTCSK
                     YGVDIAREFIPVAPAAHYMMGGVKTDLWGETSIQRLFACGEASCMAVHGANRLASNSL
                     LDGLVWGGRIVARANHVLEERLPEETEFFCQDLLTTPEEDFIDLRKEIQHIMGDKVGP
                     LRTAQRLAQALAFFERWSYLTKHEVRDTAKMEVRNMLEVGALIAEAAMMRSESRGGHF
                     RLDYPETSERWQKHIILKGN"
     gene            173955..174812
                     /locus_tag="Dred_0165"
     CDS             173955..174812
                     /locus_tag="Dred_0165"
                     /EC_number="2.4.2.19"
                     /note="KEGG: swo:Swol_0107 nicotinate-nucleotide
                     diphosphorylase (carboxylating);
                     TIGRFAM: nicotinate-nucleotide pyrophosphorylase;
                     PFAM: Quinolinate phosphoribosyl transferase"
                     /codon_start=1
                     /transl_table=11
                     /product="nicotinate-nucleotide pyrophosphorylase
                     (carboxylating)"
                     /protein_id="ABO48714.1"
                     /db_xref="InterPro:IPR002638"
                     /db_xref="InterPro:IPR004393"
                     /translation="MDLNFMELRKLIETSLAEDIGTGDITTNSIVPAECKTKGIIFVK
                     ETGIVAGISVAEAVFRYLSPEIGFIAHAKDGDQLEAGQTIAKVEGDARAILTGERLAL
                     NFLQRMSGIATRTASLVEKVKLYPVRVVDTRKTTPGLRMLEKYAVRIAGGFNHRFGLN
                     DAVLIKDNHIKVAGGITQAILAARHNVPHTIKIEVEVESLAGVIEALDAKADIIMLDN
                     MDHATMREAVKLIDGRALVEASGGVNEETIVSVAKTGVDLISVGALTHSIKSLDISLD
                     IGEIKVRNN"
     gene            174953..175825
                     /locus_tag="Dred_0166"
     CDS             174953..175825
                     /locus_tag="Dred_0166"
                     /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
                     protein;
                     KEGG: tte:TTE1096 polyferredoxin"
                     /codon_start=1
                     /transl_table=11
                     /product="4Fe-4S ferredoxin, iron-sulfur binding domain
                     protein"
                     /protein_id="ABO48715.1"
                     /db_xref="InterPro:IPR001450"
                     /translation="MTYVAWAHQFFGGGPNGRPPIDAFCPFGGLESLYGFIAYGEFIK
                     RTNLSNVILLVGTILTAIVVGRAFCGWICPLGTLQEWLNRLGQRIMGKNFSPPEKIDR
                     YLRSLKYLFLLLIIALTWHTGTLVFRDLDPWVAYAHIFGGWEKLTERPIGLILLVVTL
                     VGAIFIDRLWCKYLCPLGAFLGLFHKFSLVKLGVDQQQCVQCGKCERKCTMQVSILQD
                     HVQGSECIACGECVNHCVKPGTLAMRFGKKTISILMVGIITIGLFMGTYLAAKSTGLW
                     ITKGNAQIHMEEER"
     gene            175945..176235
                     /locus_tag="Dred_0167"
     CDS             175945..176235
                     /locus_tag="Dred_0167"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABO48716.1"
                     /translation="MANCPHAKGHYGCNALIDYGFAQNTLVLPENWWKQYCKGKNYRQ
                     CPNLKTAANMQEDCLRQDKSGIAPCNGSSDQKIKLINKVFKTEKKPGPCPWR"
     gene            176428..177429
                     /locus_tag="Dred_0168"
     CDS             176428..177429
                     /locus_tag="Dred_0168"
                     /EC_number="6.3.4.15"
                     /note="KEGG: gme:Gmet_1987 biotin--acetyl-CoA-carboxylase
                     ligase;
                     TIGRFAM: biotin--acetyl-CoA-carboxylase ligase;
                     PFAM: biotin protein ligase domain protein; biotin/lipoate
                     A/B protein ligase; Helix-turn-helix, type 11 domain
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="biotin--acetyl-CoA-carboxylase ligase"
                     /protein_id="ABO48717.1"
                     /db_xref="InterPro:IPR003142"
                     /db_xref="InterPro:IPR004143"
                     /db_xref="InterPro:IPR004408"
                     /db_xref="InterPro:IPR013196"
                     /translation="MPKGGIMNPKQKILELLREEEPGYVSGEYICQQLQVSRTAIWKT
                     IESLRSDGYDIEARPRLGYRLLTSPDILDPAEWQTDIKTHIIGQTVRYYKTTTSTNEV
                     AKDLARQGITEGAIIITEEQSKGRGRLGRTWQCPPRTGLCFSVVLFPRANPMEVPQFT
                     MLAAVAVVKALYRTLGLRAQVKWPNDVYIEGLKICGILAEMAAEADRVKYVVLGIGLN
                     VNQSKEDLVCFGNTATSLRVQLGRTLLRSQILKVLLEELDNLYTLWQQEGFLPLKGLW
                     RDNALWIGNKVQVSGLNSNYQGTMEGIDDGGALLLRLYDGTIKTFYSGEVSLRPANK"
     gene            177539..178102
                     /locus_tag="Dred_0169"
     CDS             177539..178102
                     /locus_tag="Dred_0169"
                     /note="PFAM: BioY protein;
                     KEGG: swo:Swol_0108 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="BioY protein"
                     /protein_id="ABO48718.1"
                     /db_xref="InterPro:IPR003784"
                     /translation="MAALMAAIMVVVTLITRVPFVLALVPFSLQPLIAILAGVLLGAR
                     TGALSMIVYLLLGLIGLPVFATEPFGGPAYVLKPTFGFLLGQVIAAYVAGKILEGHKD
                     KKLIYYLMASVAGMAVIYVVGLPYIYVTLNFYLGKTVSLMGVLKIGFLPFVLWDLLKA
                     VIVAVLARAIHQRLPNSSTKPNQKLPS"
     gene            complement(178120..178776)
                     /locus_tag="Dred_0170"
     CDS             complement(178120..178776)
                     /locus_tag="Dred_0170"
                     /note="PFAM: nitrite/sulfite reductase, hemoprotein
                     beta-component, ferrodoxin domain protein; nitrite and
                     sulphite reductase 4Fe-4S region;
                     KEGG: dps:DP1664 probable assimilatory sulfite reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrite and sulphite reductase 4Fe-4S region"
                     /protein_id="ABO48719.1"
                     /db_xref="InterPro:IPR005117"
                     /db_xref="InterPro:IPR006066"
                     /db_xref="InterPro:IPR006067"
                     /translation="MSESPKNAILQRDNTYAIIPKTGFAGLLNGDSLRKLADVVDKYQ
                     IPVIKMTASQRIALVGIKEEDVNKVWADLGMEAAPATGLCVRSVQSCPGNSLCKYGKQ
                     DSLGLAQRLDELFSGIALPNKFKMGISGCPLNCCEAWTRDFGAFGKPNGFTVVIGGNA
                     GAAPHIGKVLAEGLSIEEVVSLAGRLISYYKENAKNGERMFKFVERLGIEEIQKVTLA
                     "
     gene            179034..179828
                     /locus_tag="Dred_0171"
     CDS             179034..179828
                     /locus_tag="Dred_0171"
                     /EC_number="2.7.1.33"
                     /note="TIGRFAM: putative transcriptional activator, Baf
                     family;
                     PFAM: Bordetella pertussis Bvg accessory factor;
                     KEGG: dsy:DSY0216 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="pantothenate kinase"
                     /protein_id="ABO48720.1"
                     /db_xref="InterPro:IPR004619"
                     /translation="MLLAIDIGNTNIVFGVFQDKNLVDHWRLATDRNRTADEYGVLLK
                     ELFTLSKINMTSVEGVIISSVVPPVNGLLESMIKKYFKLDPILVGPGIKTGIPIKTDN
                     PREVGADRIVNAVAAYSLYGGPLIIVDFGTATTFCCVTAKGEYLGGAIAPGIGISTEA
                     LFARAAKLPRVELVKPLSVIGRNTINAMQAGIVFGFAGQVEMIVKRMKQEIGTDVQVI
                     ATGGLAEIIARETTVIDIINPSLTLMGLYILYERNQATNGGQGLCK"
     gene            179819..180778
                     /locus_tag="Dred_0172"
     CDS             179819..180778
                     /locus_tag="Dred_0172"
                     /note="TIGRFAM: putative TIM-barrel protein, nifR3 family;
                     PFAM: dihydrouridine synthase, DuS; dihydroorotate
                     dehydrogenase;
                     KEGG: chy:CHY_2369 putative TIM-barrel protein, NifR3
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA-U20-dihydrouridine synthase"
                     /protein_id="ABO48721.1"
                     /db_xref="InterPro:IPR001269"
                     /db_xref="InterPro:IPR001295"
                     /db_xref="InterPro:IPR004652"
                     /translation="MQIGSVRLPNQVIAAPMAGVTDRAYRILAREQGCGLAVTEMISD
                     LALLYANPRTYRMLDFRGETVPLSVQIFGSNPESMGKAAAIVVERGATIVDINMGCPT
                     PKIVKNNEGSALMKTPQLAAKIVEAVVKSVPAVPVTVKIRKGWDEQSVNAVEFARLVE
                     AAGASAVAVHGRTRSQFYSGKADWESIRKVKEALKIPVIGNGDIWCARDAAKMLELTG
                     CDGVMVGRGAMGNPWIFREIVYYLKTGMELPCPSAQERVETAIRHLQLMVESKGEEVA
                     VFEMRKHAAWYTKGMRGAARIRETINKSQSKKEIEDILRSLLD"
     gene            180916..181989
                     /locus_tag="Dred_0173"
     CDS             180916..181989
                     /locus_tag="Dred_0173"
                     /note="PFAM: Shikimate/quinate 5-dehydrogenase;
                     KEGG: chy:CHY_2367 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Shikimate/quinate 5-dehydrogenase"
                     /protein_id="ABO48722.1"
                     /db_xref="InterPro:IPR006151"
                     /translation="MKSFAFIVHPLDCSDVARKFNFTRYMPDTLVEQTLKLLPPVQIS
                     SITGIRSPEAETKGAFVSCLLTTKQMITLPQQFVINKVIQAGRLAEKLGANVVGLGAF
                     TKVVGDAGITVAKNLKIPVTTGNSYTVAMALEGAKKAAQLMGHDLKKSRVTVVGATGA
                     IGSVCALFLARDVKNLTLVGRNEAKLHLLADRIMYETGLAAEVNSNIKSVLRKSELVI
                     TVTSSMDTIIQPEDLKPGAVVCDVARPRDVSRRVVEERDDVLVIEGGIVEVPGDVNFN
                     FNFGFPPKTAYACMAETMILALEGKMESYTLGRELTLKQVEEIYQLGKKHGFRLAGFR
                     SFEKPILEEEISLIKQRALIKAS"
     gene            182181..182657
                     /locus_tag="Dred_0174"
     CDS             182181..182657
                     /locus_tag="Dred_0174"
                     /note="TIGRFAM: transcription elongation factor GreA;
                     PFAM: transcription elongation factor GreA/GreB domain
                     protein;
                     KEGG: dsy:DSY0218 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transcription elongation factor GreA"
                     /protein_id="ABO48723.1"
                     /db_xref="InterPro:IPR001437"
                     /db_xref="InterPro:IPR006359"
                     /translation="MKEKDVMLTVTGLKQLEDELEQLKTVKRRQVAERIKQAIEFGDI
                     SENSEYEDAKNEQAFIEGRILTLEKMLRNAKIIDDENLDNEVVSLGSKVILKDLEFGD
                     ELEYSIVGSVEADPDANKISNESPVGRAILGQSKGSVVEVNVPAGILKYEIVDILR"
     gene            182675..184207
                     /locus_tag="Dred_0175"
     CDS             182675..184207
                     /locus_tag="Dred_0175"
                     /EC_number="6.1.1.6"
                     /note="KEGG: chy:CHY_2365 lysyl-tRNA synthetase;
                     TIGRFAM: lysyl-tRNA synthetase;
                     PFAM: tRNA synthetase, class II (D, K and N); nucleic acid
                     binding, OB-fold, tRNA/helicase-type"
                     /codon_start=1
                     /transl_table=11
                     /product="lysyl-tRNA synthetase"
                     /protein_id="ABO48724.1"
                     /db_xref="InterPro:IPR002313"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR006195"
                     /translation="MTDVNENNLVQPSSETPDAGQTMLEDLNELMKVRREKLQELINQ
                     GIQPFGEKFEVTHYTFDITERFEEMEGQTVTIAGRITAKRVMGKASFANIQDSRGNIQ
                     VYARLNDLGAEEYARLEKLDIGDIIGCYGKVFRTRKGEITVHIDSYKLLSKSLRPLPE
                     KWHGLKDVDLRYRQRYVDLIVNPEVKQTFITRSRVVRGIRNYLDQRGFLEVETPMMHP
                     IAGGASARPFITHHNTLDMNLYMRIAPELYLKRLLVGGFDKVYEINRNFRNEGISTRH
                     NPEFTTIELYQAYADYNDMMDLTEDLISQVAQDVLGTTMVEYEGVEISLAKPWRRVPM
                     LEIVKEHSGLDFSQLKDAKEAFEAAKGLGLDVEPSASWGDILNTVFEEKVEDKLIQPT
                     FVIDYPVDISPLAKRQQENPELTYRFELFIYGRELANAFSELNDPIDQKGRFMSQVEK
                     RNAGDEEAQMYDEDFIQALEYGMPPAGGLGIGIDRLVMLLTNSSSIRDVILFPLMRPK
                     ES"
     gene            184639..186250
                     /locus_tag="Dred_R0014"
     rRNA            184639..186250
                     /locus_tag="Dred_R0014"
                     /product="16S ribosomal RNA"
     gene            186329..186405
                     /locus_tag="Dred_R0015"
                     /note="tRNA-Ile2"
     tRNA            186329..186405
                     /locus_tag="Dred_R0015"
                     /product="tRNA-Ile"
     gene            186423..186498
                     /locus_tag="Dred_R0016"
                     /note="tRNA-Ala2"
     tRNA            186423..186498
                     /locus_tag="Dred_R0016"
                     /product="tRNA-Ala"
     gene            186659..190250
                     /locus_tag="Dred_R0017"
     rRNA            186659..190250
                     /locus_tag="Dred_R0017"
                     /product="23S ribosomal RNA"
     gene            188003..188377
                     /locus_tag="Dred_0176"
     CDS             188003..188377
                     /locus_tag="Dred_0176"
                     /note="PFAM: S23 ribosomal protein;
                     KEGG: chy:CHY_0463 intervening sequence, 23S rRNA"
                     /codon_start=1
                     /transl_table=11
                     /product="S23 ribosomal protein"
                     /protein_id="ABO48725.1"
                     /db_xref="InterPro:IPR008815"
                     /translation="MFERKTHMIKDYHDLEVYKRGYKLALQIHKTTKGFPQHELYEIG
                     SQIRRAAVSIPLNIAEGYGRKNYVDDFKRFLINALGSCNEVAVLLDMIKDLGYISDQY
                     EGFKEEYDHLGRQLNKLIQTWK"
     gene            190424..190540
                     /locus_tag="Dred_R0018"
     rRNA            190424..190540
                     /locus_tag="Dred_R0018"
                     /product="5S ribosomal RNA"
     gene            190548..190622
                     /locus_tag="Dred_R0019"
                     /note="tRNA-Asn1"
     tRNA            190548..190622
                     /locus_tag="Dred_R0019"
                     /product="tRNA-Asn"
     gene            190811..190927
                     /locus_tag="Dred_R0020"
     rRNA            190811..190927
                     /locus_tag="Dred_R0020"
                     /product="5S ribosomal RNA"
     gene            190935..191009
                     /locus_tag="Dred_R0021"
                     /note="tRNA-Asn2"
     tRNA            190935..191009
                     /locus_tag="Dred_R0021"
                     /product="tRNA-Asn"
     gene            191306..191770
                     /locus_tag="Dred_0177"
     CDS             191306..191770
                     /locus_tag="Dred_0177"
                     /note="PFAM: Firmicute transcriptional repressor of class
                     III stress genes;
                     KEGG: gka:GK0075 transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="ABO48726.1"
                     /db_xref="InterPro:IPR008463"
                     /translation="MANISELIEKYIKELIQVSPCDYVELQRNELAAQFKCVPSQINY
                     VLATRFSSQNGYIVESRRGGGGFIRVVKIPLDQHNDPAAQIYHLVGDDINQSQAEKII
                     KRLAEEEFITQREALIFKAVIDRNVLRMGLPWRDNLRAQLLRAMLGAIFRER"
     gene            191786..192298
                     /locus_tag="Dred_0178"
     CDS             191786..192298
                     /locus_tag="Dred_0178"
                     /note="PFAM: UvrB/UvrC protein;
                     KEGG: mta:Moth_0160 UvrB/UvrC protein"
                     /codon_start=1
                     /transl_table=11
                     /product="UvrB/UvrC protein"
                     /protein_id="ABO48727.1"
                     /db_xref="InterPro:IPR001943"
                     /translation="MLCDRCQKRPAEVHFTQIINNSKKQMNLCSTCASELQAGSLGFA
                     PQLNLHDFLAGLINHHFTGSSIQTNALPQMRCEKCGSTEAQVAKTGLFGCSECYSQIG
                     ERVRPLLKRIHGSSIHTGKVPKRTGGTALIAKEIRILKNQLQNAIKYEEFEEAASIRD
                     RIKELEQKLQ"
     gene            192311..193384
                     /locus_tag="Dred_0179"
     CDS             192311..193384
                     /locus_tag="Dred_0179"
                     /note="PFAM: ATP:guanido phosphotransferase;
                     KEGG: mta:Moth_0161 ATP:guanido phosphotransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP:guanido phosphotransferase"
                     /protein_id="ABO48728.1"
                     /db_xref="InterPro:IPR000749"
                     /translation="MSLKETVSNPYSKWLEATGPENDVIISSRVRLARNLMGYPFPHV
                     LGHENADKVLYAVQSAVAQKSLQEAVGNLELSRMTELSSIERQILVEKHLISPDMLEQ
                     PEKRGVVLRDDEVISIMVNEEDHLRIQCLLPGLQLKECWDLANTVDDGLEQIIDYAFA
                     KEQGYLTSCPTNIGTGLRASVMLHLPALVMTRQINAVLTTLSKLGLTVRGLYGEGTQA
                     TGNLFQVSNQVTLGLTEEEIIDNLITVALQLVTQERAARRALHKEQLHQIEDKVWRAY
                     GLLKYARTMTSNETMTLLSDMRLGVDLGVITGIPPGIIMELIILSRPAFLSKVKGADL
                     NPYQRDIFRATLIRERLNSLSNE"
     gene            193396..195834
                     /locus_tag="Dred_0180"
     CDS             193396..195834
                     /locus_tag="Dred_0180"
                     /note="PFAM: UvrB/UvrC protein; AAA ATPase, central domain
                     protein; Clp N terminal domain protein; ATPase associated
                     with various cellular activities, AAA_5; ATPase AAA-2
                     domain protein;
                     SMART: AAA ATPase;
                     KEGG: chy:CHY_2348 negative regulator of genetic
                     competence ClpC/MecB"
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase AAA-2 domain protein"
                     /protein_id="ABO48729.1"
                     /db_xref="InterPro:IPR001270"
                     /db_xref="InterPro:IPR001943"
                     /db_xref="InterPro:IPR002078"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR004176"
                     /db_xref="InterPro:IPR011704"
                     /db_xref="InterPro:IPR013093"
                     /translation="MFQRFTQRAQKVLILAQEEARRLKYPYIGTEHILLGLIREGEGI
                     AARALEQMNINADKVKTTVEQIVEIGNEAVSGEIPPTPRAKKVLELAVEESRSMGHNY
                     VGTEHLLLGLVKEGEGVAAQVLVSLGADLGKVRQQVINMLGSGGGQTPGGNGQGCPAG
                     GCKTVSLDQFSRDLTRLAKEEKLDPVVGRAKEIERVIQVLSRRTKNNPVLIGEPGVGK
                     TAIAEGLAQRIIEGNVPEILLNRRVVTLDLAAMVAGTKYRGEFEDRLKKIMEEIRQAG
                     NIIVFIDELHTLIGAGAAEGAIDAANILKPALARGEIQTIGATTLDEYRKYIEKDSAL
                     ERRFQPIQVDEPTVEETLQILKGIRDKYEAHHRVSITDEALEAAAKLSDRYITDRFLP
                     DKAIDLIDESASRVRIKAFTAPPDLKQKEKDLEEIRKEKESAINNQEFEKAAELRDRE
                     QALLTEINQARENWNQTKGGNNLVVSEQDIAHIVASWTGVPVQKIAQEESEKLLNLEE
                     VLHRRVVGQDDAVKAVSRAVRRARAGLKDPKRPVGSFIFLGPTGVGKTELARALAESL
                     FGDEDALVRIDMSEYMEKHAVSRLVGAPPGYVGYDEGGQLTEAVRRKPYSVVLLDEIE
                     KAHPDVFNILLQVLEDGRLTDSRGRVVDFRNTVIIMTSNVGLSTIKSVGKVGFAATAQ
                     DQADYEKMKERVEEGLKRTFRPEFLNRIDETIVFHPLTREHIQQIVDLMLQEVAQRME
                     EHEVYLSFTEGAKEILAQVGYSEEYGARPLRREIQRRVEDHLSEELIKGTFKKGERVV
                     IGAEGGQIIVGKEE"
     gene            195999..197402
                     /locus_tag="Dred_0181"
     CDS             195999..197402
                     /locus_tag="Dred_0181"
                     /note="PFAM: transposase, IS4 family protein;
                     KEGG: mgm:Mmc1_3053 transposase, IS4 family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase, IS4 family"
                     /protein_id="ABO48730.1"
                     /db_xref="InterPro:IPR002559"
                     /translation="MKKIRNKKIKTKNRDDDRLTIFEIEQGDEELTTHSGLALIGALL
                     TNTKIKTRLNNTMSAEQKKPHISNGSVGIAYIGLLCQGKSDFDHIEPFREDNFFAISL
                     NIKETPSSPTLRQRLDMVAKDKQWNNILLEESAGLIKKTNAPLTPVYLGQENRAYLPL
                     DIDVSPFDNSNTKKEGVSRTYKGTDGYAPIFAYLAKEGYCVNTELRQGSEHCQKNTSE
                     FVAESIRYARKITQLPLLLRMDSGNDSASNIEICLNDDTKADFIIKRNLRKETPEGWL
                     LLAKNNKDIYCQEREGKKVYYGSMMKYKKELKREIRVVYKITERTFGKDGQIFLVPQV
                     EAETYWTSLPDPPHVIERLYHEHGTSEQFHSELKTDLDLERLPSGKFDTNNLILHFGV
                     VAYNLLRMIGQSTTRMQHVPLRKQAERRRIRTVIQNLITLASRLVSHARKKKLRFGKH
                     SPWFETFKQAYSVCLAR"
     gene            197727..199076
                     /locus_tag="Dred_0182"
     CDS             197727..199076
                     /locus_tag="Dred_0182"
                     /note="TIGRFAM: DNA repair protein RadA;
                     SMART: AAA ATPase;
                     KEGG: bcl:ABC0122 DNA repair protein RadA"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein RadA"
                     /protein_id="ABO48731.1"
                     /db_xref="InterPro:IPR001553"
                     /db_xref="InterPro:IPR001984"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004504"
                     /translation="MRNKTTYACQNCGHQTARWMGRCPGCGEWNTLVEERTAVESKKL
                     RGISGTGPVPVTEIIITEEERYATGLVELDRVLGGGLVPGSLVLVGGDPGIGKSTLLL
                     QAASAIAAGTRKVLYVSGEESARQIKMRAERIGALHPNLYLMAETDMSVVERVIKETT
                     FSAVVVDSIQTVYQPEISSAPGSVSQVRECTGMLMKLAKGSGVPIFVVGHVTKEGTLA
                     GPRVLEHIVDTVLYFEGDRHQAYRILRTVKNRFGSTNELGIFEMRGAGLVEVSNPSEL
                     FMNQRPENVAGSSIVPSLEGTRPLLVELQALVCASGFGSPRRMTSGVDYNRVALIMAV
                     LERRVGLRLSSYDAYVSAVGGVKLDEPAADLAIALAIASSFKEQPVQEQVVLVGEVGL
                     TGEVRAVAGMEKRLQEAAKLGFKVCIGPKDKQSQSMGIIEYIGVQSLQEAVEAAIER"
     gene            199088..200173
                     /locus_tag="Dred_0183"
     CDS             199088..200173
                     /locus_tag="Dred_0183"
                     /note="PFAM: protein of unknown function DUF147;
                     KEGG: chy:CHY_2346 putative DNA-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF147"
                     /protein_id="ABO48732.1"
                     /db_xref="InterPro:IPR003390"
                     /translation="MVKDEKIEDKLIKLLRLVAPGTPLREGLENILRAKTGALIVIGD
                     IPEVMELAEGGFAINADFTPAGLYELAKMDGAIILSEDAKKIIAANTQLIPDLIIPSS
                     ETGIRHRTAERVAKQCDMPVISISQRRSVITVYKGSIKYFLRDISVILAKANQAVQTL
                     EKYRSVSDRVINELSMMELQEVVTLFDVTKAIQRIEMVLRVKKEIDRYISELGTEGRL
                     IAMQMEELVANVEEEGLLIIQDYATTLGEKTPESILKVIGSWPAEDLLDLVLIARALG
                     YPGSASVLDQSVSPRGYRALRKIPRLPLPVIENLVSTFQYLRTILAASIAELDEVEGI
                     GEVRARSIKDGLTRYGEMLLQDRYKNQ"
     gene            complement(200242..200637)
                     /locus_tag="Dred_0184"
     CDS             complement(200242..200637)
                     /locus_tag="Dred_0184"
                     /note="KEGG: chy:CHY_2345 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABO48733.1"
                     /translation="MKDLLCDQFQNTVSEMTLCHRSILEILSKLQESGVRVQRSVVHS
                     VTSCGCQKITANKKSLPENATFLDLKNLLDSHLSGNLCNNCRDNIESEIGRSLFYMAA
                     LCNLMELNLYDIFIKEHKQLEILREYNLT"
     gene            200828..201304
                     /locus_tag="Dred_0185"
     CDS             200828..201304
                     /locus_tag="Dred_0185"
                     /note="PFAM: transcription factor CarD;
                     KEGG: mta:Moth_2489 transcriptional regulator, CarD
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, CarD family"
                     /protein_id="ABO48734.1"
                     /db_xref="InterPro:IPR003711"
                     /translation="MFKIGDKVVYPMHGAGVIEAIEEKEVLGKKRQYYILRLPIGDMK
                     VMIPISNCDDVGLRGIIDRDEVSTVLEVLEGQTTVMSGNWNRRYRANLEKIKSGDIYE
                     VAEVVRNLLTRDKEKGLSSGERKMLENARQILISELVLAAEMEETKARSLIDEVFA"
     gene            201461..202603
                     /locus_tag="Dred_0186"
     CDS             201461..202603
                     /locus_tag="Dred_0186"
                     /note="PFAM: PilT protein domain protein;
                     deoxyribonuclease/rho motif-related TRAM;
                     SMART: Nucleotide binding protein, PINc;
                     KEGG: mta:Moth_2488 PilT protein-like"
                     /codon_start=1
                     /transl_table=11
                     /product="PilT protein domain protein"
                     /protein_id="ABO48735.1"
                     /db_xref="InterPro:IPR002716"
                     /db_xref="InterPro:IPR002792"
                     /db_xref="InterPro:IPR006596"
                     /translation="MVRKMIYGLLILLFGSMGFWAGLYSISNNLVTVPATLPQLKFGV
                     IALGALLGVLVGVISTPWIIKGGLALTAVVDQYLVKTPTQDLIMGALGLIFGLIIANL
                     LGAILSTMGPIGKAIWLAGTCLLGYLGLSVAVKKREEIVSLFSSLPRFGKEKLGKAET
                     KVNQTKLLDTSVIIDGRISELCQSGFVEGVLLVPVFVVDELRHIADSADLLKRNRGRR
                     GLDILNAMKKSSDIKVQIYENTKGLDDIPEVDAKLVKLGQKLGAKIVTNDYNLNKVAE
                     LQGVKVLNINELANAIKPVVLPGEEMTVTVVKDGKEMGQGVAYLDDGTMIVVDGGKRY
                     IGQTISVLVTSVLQTAAGRMIFAKPKGLDKRSEATGQVISGVNAIG"
     sig_peptide     201461..201538
                     /locus_tag="Dred_0186"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.665) with cleavage site probability 0.309 at
                     residue 26"
     gene            202596..203300
                     /locus_tag="Dred_0187"
     CDS             202596..203300
                     /locus_tag="Dred_0187"
                     /EC_number="2.7.7.60"
                     /note="TIGRFAM: 2-C-methyl-D-erythritol 4-phosphate
                     cytidylyltransferase;
                     PFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol synthase;
                     KEGG: tte:TTE2322 4-diphosphocytidyl-2-methyl-D-erithritol
                     synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="2-C-methyl-D-erythritol 4-phosphate
                     cytidylyltransferase"
                     /protein_id="ABO48736.1"
                     /db_xref="InterPro:IPR001228"
                     /translation="MGNIVAVIPAAGMGSRMGTEVKKQYLKLQDRPILAHTIDALEQV
                     PDITGIVLVVSPGEETLCQELILKGNLFNKIMAVVPGGDHRQTSVYHGLCSLPGDTEL
                     VVIHDGARPLVQRAEISHIIKEARRVGAAALAVPVKDTVKLVNDQGYVIATPNREKLW
                     AVQTPQVFNYELILKAHQDAREKGVYATDDCALVEALGQPVKLVQGSYENIKITTPED
                     MVMAQAFLKRRNCWCE"
     gene            203291..203764
                     /locus_tag="Dred_0188"
     CDS             203291..203764
                     /locus_tag="Dred_0188"
                     /EC_number="4.6.1.12"
                     /note="KEGG: cpf:CPF_2616 2C-methyl-D-erythritol
                     2,4-cyclodiphosphate synthase;
                     TIGRFAM: 2C-methyl-D-erythritol 2,4-cyclodiphosphate
                     synthase;
                     PFAM: MECDP-synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="2-C-methyl-D-erythritol 2,4-cyclodiphosphate
                     synthase"
                     /protein_id="ABO48737.1"
                     /db_xref="InterPro:IPR003526"
                     /translation="MRVGIGYDVHKLVAERQLVLGGVVIPYEFGLLGHSDADVLIHAI
                     MDALLGAAALGDIGRHFPDNEPRYKGISSMKLLEEVREKLAVKGYSVNNLDAVVVAQA
                     PKLAPYIQAMQQNIARTLQVDLDSVNIKATTTEHLGFAGRGEGIGAYAVCTLQQG"
     gene            203954..205639
                     /locus_tag="Dred_0189"
     CDS             203954..205639
                     /locus_tag="Dred_0189"
                     /EC_number="6.1.1.18"
                     /note="KEGG: swo:Swol_2459 glutamine--tRNA ligase;
                     TIGRFAM: glutaminyl-tRNA synthetase;
                     PFAM: glutamyl-tRNA synthetase, class Ic"
                     /codon_start=1
                     /transl_table=11
                     /product="glutaminyl-tRNA synthetase"
                     /protein_id="ABO48738.1"
                     /db_xref="InterPro:IPR000924"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR004514"
                     /translation="MNKKLTSFIHDIIDKDLEEGKNGSKVHTRFPPEPNGYLHIGHAK
                     SICLNFGIAKEYSGLCNLRFDDTNPSKEDVEYVDSIQEDVKWLGFSWEDRMFYASNYF
                     DQLYEFAVQLIKAGKAYVDDLSAEEIREYRGTLTQPGKDSPYRNRSVGENLELFEQMK
                     AGNFPDGSRVVRAKIDMSSPNINMRDPVLYRIQKTKHHRTGDKWSIYPMYDYAHPLSD
                     AIEGITHSICTCEFEDHRPLYHWVVENVSAIAGLKSKPQQIEFARLNLSHTVMSKRKL
                     RQLVEEGHVKGWDDPRMPTISGLRRRGYTPEAIRDFCERIGVAKAVSTVDIAMLEHCI
                     REDLSSKAPRIMGVLRPVKVVIDNYPEGQVEWLEAEYHQENPELGGRKIPFSRVLYIE
                     QDDFMEDPPKKFFRLAPGKEVRLKYAYIIKCEQVVKDEQTGEIVEIHCTYDPDTKSGT
                     NNEVRKVKGTLHWVSVEHAIRAEVRLYDHLFTKANPEEERDTDFKQNLNPNSLEVLKN
                     SFLEPSLADAKPGDKYQFQRQGYFSVDPDSKEDRKVFNRVVSLKDSWAKMQKK"
     gene            complement(205712..206050)
                     /locus_tag="Dred_0190"
     CDS             complement(205712..206050)
                     /locus_tag="Dred_0190"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABO48739.1"
                     /translation="MTTPKLADLIDEYNEIKGQISFRPDYKKLADKNLARVIFCEKTV
                     GSSHFSLIRNEDFEIIFTHRIGKKTHQATLDLNTFDPRYDNNLLLTWCPDYCELRWDY
                     QHSCCLDSFL"
     gene            206293..207741
                     /locus_tag="Dred_0191"
     CDS             206293..207741
                     /locus_tag="Dred_0191"
                     /EC_number="6.1.1.24"
                     /note="TIGRFAM: glutamyl-tRNA synthetase;
                     PFAM: glutamyl-tRNA synthetase, class Ic;
                     KEGG: chy:CHY_2340 glutamyl-tRNA synthetase"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate--tRNA(Gln) ligase"
                     /protein_id="ABO48740.1"
                     /db_xref="InterPro:IPR000924"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR004527"
                     /db_xref="InterPro:IPR008262"
                     /translation="MSIRVRFAPSPTGPLHIGGARSALFNWLYARHHGGQFLVRIEDT
                     DMERSSRESEENILNALRWLGIDWDEGIEVGGPNGPYRQTERLDIYRQLAKELVDAGH
                     AYYCYCSEEELAVEREALMEKGELPRYLGRCRNLCPEDKAKFEAEGKKPVLRFRVPEN
                     QTITINDHVRGQVEFESNGIGDFIIMKSDNIPTYNFAVVVDDHDMGITHVVRAEEHLS
                     NTPRQILIYEALGWQKPEFAHISLILGKDRSKMSKRHGATSIEQYHNLGYLPEALVNF
                     LALLGWSPGGEEEIFTLKEIKEQFTLDRVAKNPAVFDIDKLNWLNGHYIRQASVERLT
                     KLAVPYLQGAGYLKEEISTEKMAWLEQVVAIARNYISYMQEITQHVDVFFRDNVEITE
                     EDAKQVQGWEQMPVVMKAAHELFSAANELTEESVKAIIKAIGKQTGLKGKFIFQPLRV
                     GITGQTHGPELHQIIPVIGKERTLARLEAALK"
     gene            207836..208525
                     /locus_tag="Dred_0192"
     CDS             207836..208525
                     /locus_tag="Dred_0192"
                     /EC_number="2.3.1.30"
                     /note="TIGRFAM: serine O-acetyltransferase;
                     KEGG: chy:CHY_2339 serine acetyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="serine O-acetyltransferase"
                     /protein_id="ABO48741.1"
                     /db_xref="InterPro:IPR001451"
                     /db_xref="InterPro:IPR005881"
                     /translation="MFGRIKKEINAVFERDPAAKGVIEVLLCYPGLHAILLHRVAHKL
                     YQKKFYVVARFLSQFSRFLTGIEIHPGAKIGEGLFIDHGSGVVIGETAEVGDNVTIYQ
                     GVTLGGTGKEKGKRHPTIGNNVVISSGAKVLGSFTVGDNVKIGAGSVVLKSVPSDCTV
                     VGVPGRIVIRDGQKIDSAYVPDLRHDQLPDPIADMLSQMQDQIASMERKMRELEQQYC
                     QRREKAEGAEG"
     gene            208527..209987
                     /locus_tag="Dred_0193"
     CDS             208527..209987
                     /locus_tag="Dred_0193"
                     /EC_number="6.1.1.16"
                     /note="KEGG: chy:CHY_2338 cysteinyl-tRNA synthetase;
                     TIGRFAM: cysteinyl-tRNA synthetase;
                     PFAM: cysteinyl-tRNA synthetase, class Ia"
                     /codon_start=1
                     /transl_table=11
                     /product="cysteinyl-tRNA synthetase"
                     /protein_id="ABO48742.1"
                     /db_xref="InterPro:IPR002308"
                     /translation="MQIYNTLARAKEEFIPRDKGHVSMYVCGPTTYNFIHLGNARPLV
                     FFDTVRRYFLYKGYKVDYVQNFTDVDDKIINRAAEEKIDPLELAQKYIQEFFVDADAL
                     NVMRADTHPKVSEHIEEIIDLIKRLEDQGHAYVVDGDVYFAVRSFAEYGKLSGRSLED
                     MQAGARVEVDPRKKDPMDFALWKAAKPGEPSWDSPWGSGRPGWHIECSAMAEKYLGNG
                     FDIHGGGFDLIFPHHENEIAQSEAACKAPFARYWMHNGFITINQEKMSKSLGNFFLVR
                     EILAKFPPDVVRWYLLSTHYRSPLDFDDEKLVMSGKGLERIKTALRLLYEAMDLPVYE
                     GEDIQGAENFEETLQRIRLEFEKAMDDDFNTALAISYFFDLAKEVNIYVGKLNSKVTL
                     EMRKILDQAHTLIKDFNRVLGILKEDKMTGKLLIEMAGADDTLTEGLVQLIIKIRQEA
                     RSKKDWSTADAIRDGLKELGVVLEDTPQGVRWKKQG"
     gene            209969..210403
                     /locus_tag="Dred_0194"
     CDS             209969..210403
                     /locus_tag="Dred_0194"
                     /note="PFAM: ribonuclease III;
                     KEGG: gka:GK0086 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease III"
                     /protein_id="ABO48743.1"
                     /db_xref="InterPro:IPR000999"
                     /translation="MEKAGVNLFNDICLQHKNIKPTELPSLVLAYIGDAVYELAVRRY
                     LVTQGSVKVNQLHKGAVRYVRAGAQARALFALEEKLTEEETAVVRRGRNAKSATLPKN
                     ADIMEYRQATALEALIGYLYLQGQQERMMEIINVVIEAINRN"
     gene            210438..211178
                     /locus_tag="Dred_0195"
     CDS             210438..211178
                     /locus_tag="Dred_0195"
                     /EC_number="2.1.1.148"
                     /note="KEGG: gme:Gmet_0378 thymidylate synthase;
                     TIGRFAM: thymidylate synthase, flavin-dependent;
                     PFAM: thymidylate synthase complementing protein ThyX"
                     /codon_start=1
                     /transl_table=11
                     /product="thymidylate synthase (FAD)"
                     /protein_id="ABO48744.1"
                     /db_xref="InterPro:IPR003669"
                     /translation="MGKASLKVRLLEHTPNPEKVVAMAARLCYSPSDIDSLAENVSTT
                     DQHSFIKKLMDLGHYSTIEHVTFTFGIEGVSRSLLAQITRHRIASFSVQSQRYVGETR
                     SQNNEGTFGYIIPETILGLGPEAVAEFEEQMAQIQAWYDRWVEKLGSGRGAYEDARFV
                     LPNAAETKIVVTMNARELRHFFSLRCCQRAQWEIRALADEMLRLAKEVAPLLFADAGP
                     ECLVGPCPEGKMSCGKRMEIRKKYGVDS"
     gene            211382..212113
                     /locus_tag="Dred_0196"
     CDS             211382..212113
                     /locus_tag="Dred_0196"
                     /note="TIGRFAM: RNA methyltransferase, TrmH family, group
                     3;
                     PFAM: tRNA/rRNA methyltransferase (SpoU); RNA 2-O ribose
                     methyltransferase, substrate binding;
                     KEGG: sth:STH3115 rRNA methyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA methyltransferase, TrmH family, group 3"
                     /protein_id="ABO48745.1"
                     /db_xref="InterPro:IPR001537"
                     /db_xref="InterPro:IPR004441"
                     /db_xref="InterPro:IPR013123"
                     /translation="MNEMIAGRNPVREALRAGRPINKVVMAKGAGTGPLAEIVKLAKQ
                     NNIPLQMVERSHLDKMNPGVPHQGVIAYAAAKQYVELEELLEIARAKGQDPFIIMLDE
                     INDPHNLGAIMRTADAAGAHGVIIPQRRSVALTSTVAKASAGAVEYVPVARVTNLDQT
                     IRQLKDEGLWVVGADMDGSEIYWDAKLTGPLLLVIGGEGKGLGRLIKERCDMLVRLPM
                     AGRVGSLNASVAAALLVYEVVRQRR"
     gene            212121..212633
                     /locus_tag="Dred_0197"
     CDS             212121..212633
                     /locus_tag="Dred_0197"
                     /note="PFAM: protein of unknown function DUF901;
                     KEGG: mta:Moth_2480 protein of unknown function DUF901"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF901"
                     /protein_id="ABO48746.1"
                     /db_xref="InterPro:IPR010298"
                     /translation="MRDFYVVDGYNIIHAWPEYENMIGTGLDHCRDRLIDILANFAGL
                     DGSSVTVVFDAHLVKSGMGHHEIIHGIEVYYTQEGETADSLIERIVGDLGKQGNVYVV
                     TSDWDEQKVIFGRGAYRLTPKEFRTQVLKTNKRGREDYNKPNPTEGYLEDKLPNDIRI
                     ILEKWRRRKN"
     gene            212832..213476
                     /locus_tag="Dred_0198"
     CDS             212832..213476
                     /locus_tag="Dred_0198"
                     /note="PFAM: sigma-70 region 2 domain protein; Sigma-70,
                     region 4 type 2;
                     KEGG: mta:Moth_2479 sigma-24 (FecI-like)"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase, sigma 30 subunit, SigH"
                     /protein_id="ABO48747.1"
                     /db_xref="InterPro:IPR000792"
                     /db_xref="InterPro:IPR000943"
                     /db_xref="InterPro:IPR007627"
                     /db_xref="InterPro:IPR013249"
                     /translation="MNPNAQREVSGGYEIMVDEDVVEFAREGDNAALEYLINKYKNFV
                     RAKARSYFLIGADREDIIQEGMIGLYKAIRDFRLDKLSSFRAFAELCITRQIITAIKT
                     ATRQKHIPLNSYVSLNKPIYDEDSDRTLLDVISGSKITDPEELIISREEFDDIEEKMG
                     EILSSLEWKVLMSYLEGKSYQEIAEDLNRHVKSIDNALQRVKRKLERYLEKREV"
     gene            213648..213723
                     /locus_tag="Dred_R0022"
                     /note="tRNA-Thr1"
     tRNA            213648..213723
                     /locus_tag="Dred_R0022"
                     /product="tRNA-Thr"
     gene            213733..213818
                     /locus_tag="Dred_R0023"
                     /note="tRNA-Tyr1"
     tRNA            213733..213818
                     /locus_tag="Dred_R0023"
                     /product="tRNA-Tyr"
     gene            213886..213961
                     /locus_tag="Dred_R0024"
                     /note="tRNA-Met1"
     tRNA            213886..213961
                     /locus_tag="Dred_R0024"
                     /product="tRNA-Met"
     gene            213965..214040
                     /locus_tag="Dred_R0025"
                     /note="tRNA-Thr2"
     tRNA            213965..214040
                     /locus_tag="Dred_R0025"
                     /product="tRNA-Thr"
     gene            214049..214125
                     /locus_tag="Dred_R0026"
                     /note="tRNA-Met2"
     tRNA            214049..214125
                     /locus_tag="Dred_R0026"
                     /product="tRNA-Met"
     gene            214459..215661
                     /locus_tag="Dred_0199"
     CDS             214459..215661
                     /locus_tag="Dred_0199"
                     /note="TIGRFAM: translation elongation factor Tu; small
                     GTP-binding protein;
                     PFAM: protein synthesis factor, GTP-binding; elongation
                     factor Tu domain protein domain protein; elongation factor
                     Tu, domain 2 protein;
                     KEGG: chy:CHY_2327 translation elongation factor Tu"
                     /codon_start=1
                     /transl_table=11
                     /product="translation elongation factor Tu"
                     /protein_id="ABO48748.1"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004160"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR004541"
                     /db_xref="InterPro:IPR005225"
                     /translation="MAKAKYERTKPHVNIGTIGHVDHGKTTLTAAITVVLSTSGGASV
                     KRYDEIDNAPEERERGITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGA
                     ILVVSAADGPMPQTREHILLSRQVGVPYIVVFLNKSDMVDDEELLELVDMEVRELLNS
                     YEFPGDDTPIVAGSGLKALECGCGKRECEWCGKIWELMDNVDAYIPTPERAVDKPFLM
                     PVEDVFSITGRGTVATGRVERGQVKVQDEVEIVGLNEKPRKTVVTGVEMFRKLLDFAQ
                     AGDNIGALLRGVDRKEIERGQVLAKPGSINPHTKYSAEVYVLTKEEGGRHTPFFNGYR
                     PQFYFRTTDVTGIVQLPEGVEMVMPGDNIKVDVDLITPIAIEEGLRFAIREGGRTVGA
                     GVVTGIRE"
     gene            216054..216203
                     /locus_tag="Dred_0200"
     CDS             216054..216203
                     /locus_tag="Dred_0200"
                     /note="PFAM: ribosomal protein L33;
                     KEGG: cpr:CPR_2415 ribosomal protein L33"
                     /codon_start=1
                     /transl_table=11
                     /product="LSU ribosomal protein L33P"
                     /protein_id="ABO48749.1"
                     /db_xref="InterPro:IPR001705"
                     /translation="MRVGVTLACTECKRRNYTTAKNKKNDPNRIELKKYCKWCHTHTV
                     HKETR"
     gene            216298..216666
                     /locus_tag="Dred_0201"
     CDS             216298..216666
                     /locus_tag="Dred_0201"
                     /note="TIGRFAM: preprotein translocase, SecE subunit;
                     PFAM: protein secE/sec61-gamma protein;
                     KEGG: dsy:DSY0453 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="protein translocase subunit secE/sec61 gamma"
                     /protein_id="ABO48750.1"
                     /db_xref="InterPro:IPR001901"
                     /db_xref="InterPro:IPR005807"
                     /translation="MWRFSMAVQKKDFKKASAAKERTATKEASGAENKKDAAPKDAAK
                     AVAKKESAKVQKPSVSERAGSVSKYLRGVQNELKKVHWPTRKEVVTYTAVVLASVAVV
                     AAVIWVLDSLLSLGVSAILS"
     gene            216720..217247
                     /locus_tag="Dred_0202"
     CDS             216720..217247
                     /locus_tag="Dred_0202"
                     /note="KEGG: mta:Moth_2473 NusG antitermination factor;
                     TIGRFAM: transcription termination/antitermination factor
                     NusG;
                     PFAM: transcription antitermination protein NusG; KOW
                     domain protein;
                     SMART: NGN domain protein; KOW (Kyrpides, Ouzounis, Woese)
                     domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transcription antitermination protein nusG"
                     /protein_id="ABO48751.1"
                     /db_xref="InterPro:IPR001062"
                     /db_xref="InterPro:IPR005824"
                     /db_xref="InterPro:IPR006645"
                     /db_xref="InterPro:IPR006646"
                     /translation="MSKQWYVVHTYSGYENKVKANLERRIESMNMEDKIFRILVPMED
                     EVEIKNGKKKVSKKKVFPGYVLVEMIMTDDSWYVVRNTPGVTGFVGTGSKPIPLDEEE
                     AKTIIKQMGIEEPKAKIDVVLGENVKVTDGPFENFVGVIEEIYPDKGKVKVMVSMFGR
                     ETPIELDFTQIEKLS"
     gene            217278..217706
                     /locus_tag="Dred_0203"
     CDS             217278..217706
                     /locus_tag="Dred_0203"
                     /note="PFAM: ribosomal protein L11;
                     KEGG: mta:Moth_2472 ribosomal protein L11"
                     /codon_start=1
                     /transl_table=11
                     /product="LSU ribosomal protein L11P"
                     /protein_id="ABO48752.1"
                     /db_xref="InterPro:IPR000911"
                     /db_xref="InterPro:IPR006519"
                     /translation="MAKKVAAIIKLQIPAGKATPAPPVGPALGQHGVNIMGFVKQYNE
                     VTAAQAGLIIPVEITVYEDRSFTFVTKTPPAAVLLKKALGIETASGEPNKKKVGKLDR
                     SKVREIAELKMPDLNAASVEAAMRMVEGTARSMGIEIVEG"
     gene            217760..218449
                     /locus_tag="Dred_0204"
     CDS             217760..218449
                     /locus_tag="Dred_0204"
                     /note="PFAM: ribosomal protein L1;
                     KEGG: dsy:DSY0456 50S ribosomal protein L1"
                     /codon_start=1
                     /transl_table=11
                     /product="LSU ribosomal protein L1P"
                     /protein_id="ABO48753.1"
                     /db_xref="InterPro:IPR002143"
                     /db_xref="InterPro:IPR005878"
                     /translation="MPKEGKKLQEARKQFDKNTLYEPLEALEMVKKTATAKFDETVEV
                     AFRLGVDPRHADQQLRGAVVLPHGTGKTKTVLVFAKGDKAKEAEAAGADFVGAEDMLE
                     KIQGGWLGFDVAIATPDMMGTVGRLGRVLGPRGLMPNPKTGTVTFEVGDAVRDAKGGK
                     ITYRTDKVGIIHAPIGKASFDTQKLAENFKTLADTLVRIKPASAKGTYMKTITVSSTM
                     GPGVRINPNKL"
     gene            218639..219184
                     /locus_tag="Dred_0205"
     CDS             218639..219184
                     /locus_tag="Dred_0205"
                     /note="PFAM: ribosomal protein L10;
                     KEGG: chy:CHY_2321 ribosomal protein L10"
                     /codon_start=1
                     /transl_table=11
                     /product="LSU ribosomal protein L10P"
                     /protein_id="ABO48754.1"
                     /db_xref="InterPro:IPR001790"
                     /translation="MYLLPTTKAQKTVMLGEVKEKMSNAQVTILADFRGVPVAKITDL
                     RARLRKAGSEMKVAKNTIAGIAAKEIGIEGLEPYLEGPTVFAFGIEDPVTPAKILSDF
                     AKEIKQGVDIKAGILEGKVIDAAGVKALADLPSREVLLAKVLGGMQAPMYGFAGVLAA
                     NLRNLVYVLDQVRQQKEGQAS"
     gene            219240..219614
                     /locus_tag="Dred_0206"
     CDS             219240..219614
                     /locus_tag="Dred_0206"
                     /note="TIGRFAM: ribosomal protein L7/L12;
                     PFAM: Ribosomal protein L7/L12-like;
                     KEGG: dsy:DSY0458 50S ribosomal protein L7/L12"
                     /codon_start=1
                     /transl_table=11
                     /product="LSU ribosomal protein L12P"
                     /protein_id="ABO48755.1"
                     /db_xref="InterPro:IPR000206"
                     /db_xref="InterPro:IPR013823"
                     /translation="MSKVAEVLEIVKGLTVLELAELVKAFEEEFGVSAAAPVAVAAAP
                     AAGAAAAEEEKTEFDVILTSAGDKKINVIKVVREITGLGLKEAKELVDGAPKPVKEKI
                     AKEEAESIKAKLTEAGATVDVK"
     gene            219996..223433
                     /locus_tag="Dred_0207"
     CDS             219996..223433
                     /locus_tag="Dred_0207"
                     /EC_number="2.7.7.6"
                     /note="KEGG: chy:CHY_2318 DNA-directed RNA polymerase,
                     beta subunit;
                     TIGRFAM: DNA-directed RNA polymerase, beta subunit;
                     PFAM: RNA polymerase Rpb2, domain 6; RNA polymerase Rpb2,
                     domain 7; RNA polymerase Rpb2, domain 2; RNA polymerase
                     beta subunit; RNA polymerase Rpb2, domain 3"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta"
                     /protein_id="ABO48756.1"
                     /db_xref="InterPro:IPR007120"
                     /db_xref="InterPro:IPR007121"
                     /db_xref="InterPro:IPR007641"
                     /db_xref="InterPro:IPR007642"
                     /db_xref="InterPro:IPR007644"
                     /db_xref="InterPro:IPR007645"
                     /db_xref="InterPro:IPR010243"
                     /translation="MAYPEKVGNRVRWNYGKLREVLDLPNLIEVQRNSYEWFLQEGLR
                     EVFHDISPIQDFTGNLILEFLDYTLGEPKYSVEECKERDVTYAAPLRVKVRLINKETG
                     EVKEQEVFMGDFPLMTSKGTFIINGAERVIVSQLVRSPGVYFADQIDPSGKRLFATTM
                     IPNRGAWLEFETDVNDHIFVRIDRTRKIPATVLIRALGYGSNALIMELFENDKFVQET
                     LTRDNTDTEEEALVEIYKRLRPGEPPTVESARSLLNTLFFDPKRYDLAHVGRYKLQKK
                     LKHGILYRYPNGEEGPKEWDRLLNKEVPVDREFIRELTKEDIIATFRYLLNLMQGEGI
                     VDDIDHLGNRRLRSVGELLQNQFRIGLSRMERVVRERMTIQDVDVITPQVLINIRPVV
                     ASIKEFFGSSQLSQFMDQTNPLAELTHKRRLSALGPGGLSRERAGFEVRDVHHSHYGR
                     MCPIETPEGPNIGLIGSLSTYARINSFGFMEAPYRKVDKENKRVTDEIVYLTADEEED
                     HIIAQANAPLDENGYFVEERVNARRGHDTLLVPTDRVEYMDVSPKQVFSVATSLIPFL
                     EHDDANRALMGANMQRQAVPLLRCQAPVVGTGIEHRAAKDSGVCIVAERGGEVVRVTA
                     TEVAVRTDEGRTDTYKLLKFTRSNQGTCINQKPIVNKGDRVEEGQILADGPATEQGEL
                     ALGRNILVAFMTWEGNNYEDAILISEKAVKEDFFTSIHIEEYECDARDTKLGPEEITR
                     DIPNVGEDILKDLDERGIIRVGAEVRPGDILVGKVTPKGETELTAEERLLRAIFGEKA
                     REVRDTSLRVPHGEAGKIVDVKVFSRENGDELPPGVNHLVRCYIAQKRKISEGDKMAG
                     RHGNKGVVARILPEEDMPFMADGTPVQIVLNPLGVPSRMNIGQVLETHLGWAAKTLGF
                     NVATPVFNGASEESIWETLRRAELPEDGKTVLYDGRTGEPFDNRVTVGYIYMIKLHHL
                     VDDKIHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTVKSD
                     DVVGRVKTYEAIVKGENVPEPGVPESFKVLIKELQSLGLDVKVLAEDEKEIEIKEIEE
                     DITETAKELGIELPEERRVSSSKEEIEEEEEVEDNSDEFDETFLEEAEDDFSLDDED"
     gene            223489..227046
                     /locus_tag="Dred_0208"
     CDS             223489..227046
                     /locus_tag="Dred_0208"
                     /EC_number="2.7.7.6"
                     /note="KEGG: dsy:DSY0464 hypothetical protein;
                     TIGRFAM: DNA-directed RNA polymerase, beta' subunit;
                     PFAM: RNA polymerase, alpha subunit; RNA polymerase Rpb1,
                     domain 3; RNA polymerase Rpb1, domain 1; RNA polymerase
                     Rpb1, domain 5; RNA polymerase Rpb1, domain 4;
                     SMART: RNA polymerase I subunit A domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta'"
                     /protein_id="ABO48757.1"
                     /db_xref="InterPro:IPR000722"
                     /db_xref="InterPro:IPR006592"
                     /db_xref="InterPro:IPR007066"
                     /db_xref="InterPro:IPR007080"
                     /db_xref="InterPro:IPR007081"
                     /db_xref="InterPro:IPR007083"
                     /db_xref="InterPro:IPR012754"
                     /translation="MLELNNFDSIRIGLASPDKIRQWSSGEVKKPETINYRTLKPERD
                     GLFCERIFGPTRDWECHCGKYKRVRYKGVVCDRCGVEVTRSKVRRERLGHIELAAPVS
                     HIWYFKGIPSRMGLLLDMSPRALEKVLYFVSYIVIEPGDTPLLKKQLLTETEYREYRD
                     KFGNNFKAGMGAEAIKVLLVEINLEELARELRQELKEVSGQRKIRAIRRLEVVEAFKK
                     SGNRPEWMIMDVVPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGA
                     PDIIVRNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGK
                     RVDYSGRSVIVVGPRLKMHQCGLPKEMALELFKPFVMKKLVNDGHAHNIKSAKRMVER
                     VRPEVWDVLEDVIKEHPVMLNRAPTLHRLGIQAFEPVLVEGRAIKIHPMVCTAYNADF
                     DGDQMAVHVPLSAEAQAEARLLMLAANNILNPKDGKPVASPTQDMVLGSYYLTMDRDG
                     DLGEGLIFKDEQEAMLAYDNKQVSLQAKITVRRKNGERLQTTVGRIIFNEVIPEELGY
                     INKVCDKKTLSKIVADCYRRLGNAHTAELLDGIKELGYKYSTRAGITIGVPDITIPEA
                     KKEILAKAEEQVNKIETQFRRGLITEDERYRKVIGIWNDATDKVTKALMATLDKFNNV
                     YMMATSGARGNIQQIRQLAGMRGLMADPSGRIIDLPIKANFREGLTVLEYFISTHGAR
                     KGLADTALRTADSGYLTRRLVDVAQDVIVREDDCGTTEGIEVREIRDGTEGIEKLHER
                     LEGRVPMEVVVHPETGEVLISQEQVDNHQVMTEEQAQAIEDAGIEKVKIRSVITCKTR
                     YGVCKHCYGKNLATGGNIDIGEAVGIIAAQSIGEPGTQLTMRTFHTGGVAGDDITQGL
                     PRVEELFEARRPKGQAIVAEEDGSIAIREVKGRREIEITKDNGEKNVYAVPFGARIKV
                     KEGQRIEAGDELTEGSVNPHDLLKIKGPAGVQVYLLQEVQRVYRLQGVEINDKHIEVM
                     IRQMLRKVKIEEAGDTELLPGGLIDIFEFEEENRKAVEQGGEPAVAKPVLLGITKASL
                     ATDSFLSAASFQETTRVLTEAAIKGKMDPLLGLKENVIIGKLVPAGTGMSRYRNIEVL
                     EEGQPFLEEDRDILLPERDRDYNFLSDEEKIDFDLTLEK"
     gene            227137..227388
                     /locus_tag="Dred_0209"
     CDS             227137..227388
                     /locus_tag="Dred_0209"
                     /note="KEGG: chy:CHY_2316 ribosomal protein L7ae family
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="LSU ribosomal protein L7AE"
                     /protein_id="ABO48758.1"
                     /db_xref="InterPro:IPR000948"
                     /db_xref="InterPro:IPR004038"
                     /translation="MSLESLKVARRKTIGAKQTLKAVEKALAKEVYWASDAESRVVDP
                     ILRACFSQNIPTVKVETMKDLGRACNIEVGCAIAAITEH"
     gene            227441..227815
                     /locus_tag="Dred_0210"
     CDS             227441..227815
                     /locus_tag="Dred_0210"
                     /note="TIGRFAM: ribosomal protein S12;
                     PFAM: ribosomal protein S12/S23;
                     KEGG: chy:CHY_2315 ribosomal protein S12"
                     /codon_start=1
                     /transl_table=11
                     /product="SSU ribosomal protein S12P"
                     /protein_id="ABO48759.1"
                     /db_xref="InterPro:IPR005679"
                     /db_xref="InterPro:IPR006032"
                     /translation="MPTINQLIRKGREQVVYKSTAPALKECPQKRGVCTRVYTTTPKK
                     PNSALRKVARVRLTNGIEVTSYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGAL
                     DSAGVQNRNRGRSKYGTKRPKK"
     gene            227864..228334
                     /locus_tag="Dred_0211"
     CDS             227864..228334
                     /locus_tag="Dred_0211"
                     /note="PFAM: ribosomal protein S7;
                     KEGG: mta:Moth_2464 ribosomal protein S7"
                     /codon_start=1
                     /transl_table=11
                     /product="SSU ribosomal protein S7P"
                     /protein_id="ABO48760.1"
                     /db_xref="InterPro:IPR000235"
                     /db_xref="InterPro:IPR005717"
                     /translation="MPRRGGIPKRDVLPDPIYGSKIATKLVNQMMLDGKRGVAEKIIY
                     DAFEIIKEKTGKSPLEVFDAAMKNVMPVLEVKARRVGGANYQVPVEVRAERRQTLGIR
                     WMVLFTRKRAGKSMAEKLAAEIMDAANNTGATVKKREDTHKMAEANKAFAHYRW"
     gene            228347..230425
                     /locus_tag="Dred_0212"
     CDS             228347..230425
                     /locus_tag="Dred_0212"
                     /note="TIGRFAM: translation elongation factor G; small
                     GTP-binding protein;
                     PFAM: elongation factor G domain protein; protein
                     synthesis factor, GTP-binding; elongation factor Tu,
                     domain 2 protein; elongation factor G, domain IV;
                     KEGG: dsy:DSY0468 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="translation elongation factor 2 (EF-2/EF-G)"
                     /protein_id="ABO48761.1"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR004540"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR005517"
                     /translation="MARQFPLERTRNIGIMAHIDAGKTTTTERILFYTGRVHKIGEVH
                     DGAATMDWMVQEQERGITITSAATTAQWNGHRVNIIDTPGHVDFTVEVERSLRVLDGA
                     VAVFCSVGGVEPQSETVWRQADKYGVPRLAYINKMDRVGADFFNGMDMIKNRLGANPV
                     AIQLPIGSEDRFKGIVDLVTKKAIVYIDDLGTNSETTDIPADMVDQVEEYREKLLEAV
                     AESDEELMMKYLEGEELTEEEIKVAIRKATLAVKITPVICGSSFKNKGVQSLLDAIVD
                     YLPAPTDVPPIQGVNPDTGTEDQRISSDNEPFAALAFKIMTDPYVGKLSYFRVYSGTL
                     KSGSYVLNSTKGKKERVGRILQMHANHREEIPEVYAGDIAAAVGLKDTTTGDTLCDEK
                     SLIILESMEFPDPVIHVAIEPKTKADQDKMGVALSKLSEEDPTFKVRTDEETGQTIIA
                     GMGELHLEIIVDRLLREFKVQANVGRPQVAYKETIRKAVKAEGKFVRQSGGKGQYGHV
                     WIELEPLEAGGPGYEFVNKIVGGVVPREYIAPVDNGIKEAMENGILAGYQMVDIKATL
                     YDGSYHEVDSSEMAFKIAGSMAFKNGAQKANPVLLEPIFKVEVTVPEEYMGDVIGDLN
                     SRRGRIEEMGQRGNARIVSAFVPLAEMFGYATDLRSKTQGRGTYSMQHDHYEEVPKNI
                     AEGIIAKRKG"
     gene            230469..231671
                     /locus_tag="Dred_0213"
     CDS             230469..231671
                     /locus_tag="Dred_0213"
                     /note="TIGRFAM: translation elongation factor Tu; small
                     GTP-binding protein;
                     PFAM: protein synthesis factor, GTP-binding; elongation
                     factor Tu domain protein domain protein; elongation factor
                     Tu, domain 2 protein;
                     KEGG: chy:CHY_2327 translation elongation factor Tu"
                     /codon_start=1
                     /transl_table=11
                     /product="translation elongation factor 1A (EF-1A/EF-Tu)"
                     /protein_id="ABO48762.1"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004160"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR004541"
                     /db_xref="InterPro:IPR005225"
                     /translation="MAKAKYERTKPHVNIGTIGHVDHGKTTLTAAITVVLSTSGGASV
                     KRYDEIDNAPEERERGITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGA
                     ILVVSAADGPMPQTREHILLSRQVGVPYIVVFLNKSDMVDDEELLELVDMEVRELLNS
                     YEFPGDDTPIVAGSGLKALECGCGKRECEWCGKIWELMDNVDAYIPTPERAVDKPFLM
                     PVEDVFSITGRGTVATGRVERGQVKVQDEVEIVGLNEKPRKTVVTGVEMFRKLLDFAQ
                     AGDNIGALLRGVDRKEIERGQVLAKPGSINPHTKYSAEVYVLTKEEGGRHTPFFNGYR
                     PQFYFRTTDVTGIVQLPEGVEMVMPGDNIKVDVDLITPIAIEEGLRFAIREGGRTVGA
                     GVVTGIRE"
     gene            231782..232090
                     /locus_tag="Dred_0214"
     CDS             231782..232090
                     /locus_tag="Dred_0214"
                     /note="PFAM: ribosomal protein S10;
                     KEGG: dsy:DSY0470 30S ribosomal protein S10"
                     /codon_start=1
                     /transl_table=11
                     /product="SSU ribosomal protein S10P"
                     /protein_id="ABO48763.1"
                     /db_xref="InterPro:IPR001848"
                     /db_xref="InterPro:IPR005731"
                     /translation="MKNQKIRIRLKAFDHQMLDQSATKIVDTAKRTGAQVAGPVPLPT
                     EKSIYTILRSPHVNKDSREQFEMRVHKRLIDILEPTPKTVDALMRLDLPAGVDIEIKL
                     "
     gene            232169..232798
                     /locus_tag="Dred_0215"
     CDS             232169..232798
                     /locus_tag="Dred_0215"
                     /note="PFAM: ribosomal protein L3;
                     KEGG: chy:CHY_2309 50S ribosomal protein L3"
                     /codon_start=1
                     /transl_table=11
                     /product="LSU ribosomal protein L3P"
                     /protein_id="ABO48764.1"
                     /db_xref="InterPro:IPR000597"
                     /translation="MPKGILGKKIGMTQIFNEAGVAIPVTVVEAGPCLVVQKRTPEND
                     GYSAIQLGFGVKRENLLNKPTKGHLNKAGVRPVRFLRELKVDDLEAFQVGQEIKADIF
                     AEGEKVDVVGTSKGKGFAGGIKRHNFHRGPMAHGSKYHRRPGSSAAKGPARTFKGRKL
                     PGHYGVERVTVQNLQVVKVDPERNLLAIKGAVPGPRGGLLLVKNSVKVK"
     gene            232831..233451
                     /locus_tag="Dred_0216"
     CDS             232831..233451
                     /locus_tag="Dred_0216"
                     /note="PFAM: ribosomal protein L4/L1e;
                     KEGG: swo:Swol_2332 ribosomal protein L4/L1e"
                     /codon_start=1
                     /transl_table=11
                     /product="LSU ribosomal protein L4P"
                     /protein_id="ABO48765.1"
                     /db_xref="InterPro:IPR002136"
                     /translation="MPKVALYNINGEQVGEVELKDEVFGIEPHEHVMHEAVNMQLANQ
                     RQGTHDTKTRAEVRGGGRKPWRQKGTGRARAGSSRSPIWRKGGIVFGPHPRDYAISLP
                     KKVRRLALKSALSSKVLDQNIIVLDSLTMDAPKTKDMVRILGNLKADKALVVTATRDL
                     NVEKSARNIEGVKPLKADGVNVYDLLKYTKLVITKDAVAKIEEVLA"
     gene            233451..233738
                     /locus_tag="Dred_0217"
     CDS             233451..233738
                     /locus_tag="Dred_0217"
                     /note="PFAM: Ribosomal protein L25/L23;
                     KEGG: chy:CHY_2307 ribosomal protein L23"
                     /codon_start=1
                     /transl_table=11
                     /product="LSU ribosomal protein L23P"
                     /protein_id="ABO48766.1"
                     /db_xref="InterPro:IPR001014"
                     /db_xref="InterPro:IPR013025"
                     /translation="MKNPRDILIKPVVTEKSTGLLAENKYTFIVDLNANKTEVKKAVE
                     EIFKVKVEKVNTMRVKGKLKRVRQFTGKTPDRKKAIVTLKEGDKIEIFEGL"
     gene            233753..234580
                     /locus_tag="Dred_0218"
     CDS             233753..234580
                     /locus_tag="Dred_0218"
                     /note="PFAM: ribosomal protein L2;
                     KEGG: chy:CHY_2306 50S ribosomal protein L2"
                     /codon_start=1
                     /transl_table=11
                     /product="LSU ribosomal protein L2P"
                     /protein_id="ABO48767.1"
                     /db_xref="InterPro:IPR002171"
                     /db_xref="InterPro:IPR005880"
                     /translation="MAVKNYKPTSPGRRFVTFSDFSEITKVEPEKSLLEPIKKTGGRN
                     AQGRLTVRHQGGGHKRMFRIIDFKRNKDGIPAKVASIEYDPNRSARIALLNYADGEKR
                     YILAPVGLEVGVIVESGPDADIKVGNCLPLRNIPVGTMVHNIELYPGAGAQMVRSAGA
                     AAQLMAKEGKYANLRLPSGEMRLVLQECRATIGQVGNLEHENVTIGKAGRSRHLGIRP
                     TVRGKVMNPVDHPHGGGEGRNPIGRNPSTPWGKLAMGVKTRGNKKSDRLIVKRRNKK"
     gene            234649..234933
                     /locus_tag="Dred_0219"
     CDS             234649..234933
                     /locus_tag="Dred_0219"
                     /note="TIGRFAM: ribosomal protein S19;
                     PFAM: ribosomal protein S19/S15;
                     KEGG: chy:CHY_2305 ribosomal protein S19"
                     /codon_start=1
                     /transl_table=11
                     /product="SSU ribosomal protein S19P"
                     /protein_id="ABO48768.1"
                     /db_xref="InterPro:IPR002222"
                     /db_xref="InterPro:IPR005732"
                     /translation="MARSLKKGPFIDDHLLKKVDEMNEKGEKKVFKTWSRRSTIFPQM
                     IGHTIAVYDGRKHIPVYITEDMVGHKLGEFAPTRTYRGHADKSERSTGLK"
     gene            234946..235287
                     /locus_tag="Dred_0220"
     CDS             234946..235287
                     /locus_tag="Dred_0220"
                     /note="TIGRFAM: ribosomal protein L22;
                     PFAM: ribosomal protein L22/L17;
                     KEGG: chy:CHY_2304 ribosomal protein L22"
                     /codon_start=1
                     /transl_table=11
                     /product="LSU ribosomal protein L22P"
                     /protein_id="ABO48769.1"
                     /db_xref="InterPro:IPR001063"
                     /db_xref="InterPro:IPR005727"
                     /translation="MEAKAIAKFIRVSPRKARMVVDLIRGKKVEEALAILRYTPNKAA
                     AAVTKVVKSAAANAEHNNDMDKEELVVSQIFVDQGPSLKRMMPRAMGRADIIKRRTSH
                     ITVVVSDKKEG"
     gene            235292..235957
                     /locus_tag="Dred_0221"
     CDS             235292..235957
                     /locus_tag="Dred_0221"
                     /note="KEGG: chy:CHY_2303 30S ribosomal protein S3;
                     TIGRFAM: ribosomal protein S3;
                     PFAM: ribosomal protein S3-C-terminal domain protein; KH,
                     type 2 domain protein; Ribosomal protein S3, N-terminal
                     domain;
                     SMART: KH domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="SSU ribosomal protein S3P"
                     /protein_id="ABO48770.1"
                     /db_xref="InterPro:IPR001351"
                     /db_xref="InterPro:IPR004044"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR005704"
                     /db_xref="InterPro:IPR008282"
                     /translation="MGQKVNPKGLRVGIIKDWEGKWFADKRNYSNLLIEDVKIREYIK
                     RKLYQAGISRIQIERAANRVKVSIHTAKPGIVIGRGGAEVEALRKELEKMTAKQVHVN
                     IVEVKTPEVDAQLVAENIASQLEKRIAFRRAMKQTVQRSLRMGAKGIKIACSGRLAGA
                     EIARTEWYSEGKVPLHTLRADIDYGFAEANTTYGKIGVKVWIYKGEVLPEAKKPAAGQ
                     GGE"
     gene            235961..236395
                     /locus_tag="Dred_0222"
     CDS             235961..236395
                     /locus_tag="Dred_0222"
                     /note="PFAM: ribosomal protein L16;
                     KEGG: dsy:DSY0478 50S ribosomal protein L16"
                     /codon_start=1
                     /transl_table=11
                     /product="LSU ribosomal protein L16P"
                     /protein_id="ABO48771.1"
                     /db_xref="InterPro:IPR000114"
                     /translation="MLIPKRVKYRKQHRPRGNGGVSKGGREVSFGEYGIQALEAGWIT
                     NRQIEAARIAMTRYIKRGGKVWIRIFPDKPITQKPAETRMGSGKGAPEHWVAVVKPGR
                     VMFEVAGVPEATAREAMRLAMHKLPVKCKFVVRGEVGEANES"
     gene            236385..236582
                     /locus_tag="Dred_0223"
     CDS             236385..236582
                     /locus_tag="Dred_0223"
                     /note="PFAM: ribosomal protein L29;
                     KEGG: tte:TTE2284 ribosomal protein L29"
                     /codon_start=1
                     /transl_table=11
                     /product="LSU ribosomal protein L29P"
                     /protein_id="ABO48772.1"
                     /db_xref="InterPro:IPR001854"
                     /translation="MKVKELRDLTDAELAKKIDDSKDELFKLRFQLATGQLDNPMKIK
                     DVKRNIARLKTIETERKLGIR"
     gene            236624..236890
                     /locus_tag="Dred_0224"
     CDS             236624..236890
                     /locus_tag="Dred_0224"
                     /note="PFAM: ribosomal protein S17;
                     KEGG: mta:Moth_2451 ribosomal protein S17"
                     /codon_start=1
                     /transl_table=11
                     /product="SSU ribosomal protein S17P"
                     /protein_id="ABO48773.1"
                     /db_xref="InterPro:IPR000266"
                     /translation="MEQVRNMRKTRQGKVVSDKMDKTIVVAVEDRVRHPLYNRTIRKT
                     TKFKAHDEENSCRIGDTVRIMETRPLSKDKRWRVIDILERAEQL"
     gene            236927..237295
                     /locus_tag="Dred_0225"
     CDS             236927..237295
                     /locus_tag="Dred_0225"
                     /note="TIGRFAM: ribosomal protein L14;
                     PFAM: ribosomal protein L14b/L23e;
                     KEGG: chy:CHY_2299 ribosomal protein L14"
                     /codon_start=1
                     /transl_table=11
                     /product="LSU ribosomal protein L14P"
                     /protein_id="ABO48774.1"
                     /db_xref="InterPro:IPR000218"
                     /db_xref="InterPro:IPR005745"
                     /translation="MIQVQTILKAADNTGARKLMCIRVMGGSLRRYASVGDIIVASVK
                     EATPGGVVKKGDVVKCVVVRTSKEVRRPDGSYIKFDENAAVVIKDDKTPRGTRIFGPV
                     ARELREKDFMKIVSLAPEVI"
     gene            237393..237713
                     /locus_tag="Dred_0226"
     CDS             237393..237713
                     /locus_tag="Dred_0226"
                     /note="KEGG: mta:Moth_2449 ribosomal protein L24;
                     TIGRFAM: ribosomal protein L24;
                     PFAM: KOW domain protein;
                     SMART: KOW (Kyrpides, Ouzounis, Woese) domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="LSU ribosomal protein L24P"
                     /protein_id="ABO48775.1"
                     /db_xref="InterPro:IPR003256"
                     /db_xref="InterPro:IPR005824"
                     /db_xref="InterPro:IPR005825"
                     /db_xref="InterPro:IPR006646"
                     /translation="MPKVHVRKGDTVMVITGKDAGKKGKVVTVEPAKNRVIVEGVNIV
                     KRHRKATPQMPQGGIVEKEAPIHSSNVMLFCNKCNKATRIQKKVLDNGNKERICKHCG
                     ETLS"
     gene            237740..238285
                     /locus_tag="Dred_0227"
     CDS             237740..238285
                     /locus_tag="Dred_0227"
                     /note="PFAM: ribosomal protein L5;
                     KEGG: dsy:DSY0483 50S ribosomal protein L5"
                     /codon_start=1
                     /transl_table=11
                     /product="LSU ribosomal protein L5P"
                     /protein_id="ABO48776.1"
                     /db_xref="InterPro:IPR002132"
                     /db_xref="InterPro:IPR003236"
                     /translation="MARLKDKYLNEVQPNLMQKFGYKNIMQVPKLEKVIINIGLGEAV
                     QNSKAVDAAVGDLMAITGQRPITTKAKKSIAAFKLRAGMTIGTKVTLRGERMYEFVDR
                     LFNVALPRVRDFRGISDKSFDGRGNYTMGLKEQLIFPEIEYDKIDKVRGMDITFVTTA
                     KTDEEARELLKLMGIPFVKVS"
     gene            238309..238494
                     /locus_tag="Dred_0228"
     CDS             238309..238494
                     /locus_tag="Dred_0228"
                     /note="PFAM: ribosomal protein S14;
                     KEGG: dsy:DSY0484 30S ribosomal protein S14"
                     /codon_start=1
                     /transl_table=11
                     /product="SSU ribosomal protein S14P"
                     /protein_id="ABO48777.1"
                     /db_xref="InterPro:IPR001209"
                     /translation="MAKKSMINKANAPQKFTVRGHNRCKLCGRPHGYMRKFGICRICF
                     RELAYRGEIPGVKKASW"
     gene            238516..238914
                     /locus_tag="Dred_0229"
     CDS             238516..238914
                     /locus_tag="Dred_0229"
                     /note="PFAM: ribosomal protein S8;
                     KEGG: chy:CHY_2295 ribosomal protein S8"
                     /codon_start=1
                     /transl_table=11
                     /product="SSU ribosomal protein S8P"
                     /protein_id="ABO48778.1"
                     /db_xref="InterPro:IPR000630"
                     /translation="MVMTDPIADFLTRVRNANTVYHDKVEAPASNVKKAIAEILKQEG
                     YIKDYESVEDGKQGIIRLYLKYGANKQRVITGLKRISKPGLRVYAKKDQIPRVLGGLG
                     IAIVSTSKGIMTDKQARQSGLGGEVICYVW"
     gene            238939..239487
                     /locus_tag="Dred_0230"
     CDS             238939..239487
                     /locus_tag="Dred_0230"
                     /note="PFAM: ribosomal protein L6;
                     KEGG: chy:CHY_2294 ribosomal protein L6"
                     /codon_start=1
                     /transl_table=11
                     /product="LSU ribosomal protein L6P"
                     /protein_id="ABO48779.1"
                     /db_xref="InterPro:IPR000702"
                     /db_xref="InterPro:IPR002358"
                     /translation="MSRIGKKPIPVPQGVDVKINGNVISVKGPKGQLEQEFHQDMNIK
                     LEEGNLVVERPSDAKDHRALHGLTRTLLNNMVEGVTNGFQRNLELVGVGYRAAKQGNK
                     LVLTIGYSHPVEIEPPAGIEIEVPAATKIAIKGSDKQAVGQLAANIRAVREPEPYKGK
                     GIKYENEIIRRKAGKAGGKGKK"
     gene            239506..239874
                     /locus_tag="Dred_0231"
     CDS             239506..239874
                     /locus_tag="Dred_0231"
                     /note="TIGRFAM: ribosomal protein L18;
                     PFAM: ribosomal protein L18P/L5E;
                     KEGG: dsy:DSY0487 50S ribosomal protein L18"
                     /codon_start=1
                     /transl_table=11
                     /product="LSU ribosomal protein L18P"
                     /protein_id="ABO48780.1"
                     /db_xref="InterPro:IPR004389"
                     /db_xref="InterPro:IPR005484"
                     /translation="MLTKPDRKAIRAKRRRRVRNKILGTAARPRLNVFRSLNNMYAQL
                     IDDETGVTVVAASTLSPELKETFKNGGNVEAAKAVGDLVGKLALEKGIKEVVFDRAGY
                     LYHGRVKALAEAAREAGLDF"
     gene            239905..240405
                     /locus_tag="Dred_0232"
     CDS             239905..240405
                     /locus_tag="Dred_0232"
                     /note="TIGRFAM: ribosomal protein S5;
                     PFAM: ribosomal protein S5 domain protein; Ribosomal
                     protein S5-like;
                     KEGG: mta:Moth_2443 ribosomal protein S5"
                     /codon_start=1
                     /transl_table=11
                     /product="SSU ribosomal protein S5P"
                     /protein_id="ABO48781.1"
                     /db_xref="InterPro:IPR005324"
                     /db_xref="InterPro:IPR005712"
                     /db_xref="InterPro:IPR013810"
                     /translation="MARIDASKLELTEKVVYINRVAKVVKGGRRFSFSALVVVGDGNG
                     HVGAGLGKAAEVPEAIRKGIEDAKKNMIKVPLNGTTITHQIQGRFGAGKVLMKPAAKG
                     TGVIAGGPVRAILELAGVRDILTKSLGTNNANNMVNATMEGLKQLKTPEEVARLRGKT
                     VEELLG"
     gene            240417..240596
                     /locus_tag="Dred_0233"
     CDS             240417..240596
                     /locus_tag="Dred_0233"
                     /note="PFAM: ribosomal protein L30;
                     KEGG: lin:lin2763 ribosomal protein L30"
                     /codon_start=1
                     /transl_table=11
                     /product="LSU ribosomal protein L30P"
                     /protein_id="ABO48782.1"
                     /db_xref="InterPro:IPR000517"
                     /db_xref="InterPro:IPR005996"
                     /translation="MAKLKITLVRSLIGRPEAQRKVVRALGLGKTNSMVEQNDSPIIR
                     GMINKVAHLVKVEEA"
     gene            240610..241050
                     /locus_tag="Dred_0234"
     CDS             240610..241050
                     /locus_tag="Dred_0234"
                     /note="PFAM: ribosomal protein L15;
                     KEGG: chy:CHY_2290 ribosomal protein L15"
                     /codon_start=1
                     /transl_table=11
                     /product="LSU ribosomal protein L15P"
                     /protein_id="ABO48783.1"
                     /db_xref="InterPro:IPR001196"
                     /db_xref="InterPro:IPR005749"
                     /translation="MNLSELRPAPGARKKPTRKGQGIGSGLGKTAGKGHKGQNARSGG
                     GVRPGFEGGQMPLQRRFPKRGFTNIFKKQITAINLDELNVFEAGTEVTPELLLEAGLI
                     KKVGDGVKILGDGILEKALTVKVHAFSKSAVEKITAAGGKAEVI"
     gene            241053..242312
                     /locus_tag="Dred_0235"
     CDS             241053..242312
                     /locus_tag="Dred_0235"
                     /note="TIGRFAM: preprotein translocase, SecY subunit;
                     PFAM: SecY protein;
                     KEGG: chy:CHY_2289 preprotein translocase, SecY subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="protein translocase subunit secY/sec61 alpha"
                     /protein_id="ABO48784.1"
                     /db_xref="InterPro:IPR002208"
                     /translation="MLNSLTTAFKLDELRSKLLFTLAMLFLFRVGAHIPVPGINPEAF
                     ANLLTKGQLLGFFDVISGGAFKNASIFAMSITPYINASIIMQLLTVVIPHLEKLAKEG
                     EEGRKKITQYTRYFTAVLAFVQAIGMTMALKGALVNPSVLNYLTVAITFTAGTVLLMW
                     IGEQITEKGIGNGISLLIFTGIVSRIPSAMVNIGQYLKAGTINILSILVLLIIGTLVI
                     AAVIYVQEGQRRIPVQYAKRVVGRRVYGGQTSHLPLKVNQAGVIPIIFASSLLMFPGQ
                     IASWFHGNAVADWYLRWFAWGGVLNSVLYALLIVGFTYFYTAVIMNPVDMAENIKKYG
                     GFIPGLRPGRSTAEYIGKVMSRITLAGAVFLALIAILPNVILALTRIPNVYFGGTALL
                     IVVGVALDTMKQIESHLLMRSYQGFLK"
     sig_peptide     241053..241190
                     /locus_tag="Dred_0235"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.688) with cleavage site probability 0.613 at
                     residue 46"
     gene            242325..243071
                     /locus_tag="Dred_0236"
     CDS             242325..243071
                     /locus_tag="Dred_0236"
                     /EC_number="3.4.11.18"
                     /note="TIGRFAM: methionine aminopeptidase, type I;
                     PFAM: peptidase M24;
                     KEGG: dsy:DSY0493 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="methionine aminopeptidase, type I"
                     /protein_id="ABO48785.1"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR001714"
                     /db_xref="InterPro:IPR002467"
                     /translation="MITIKNERELKYMRDAGGVVAKTFKILNDMVKPGVTTKELDAKA
                     EDFIISQGARPAFKGYGGFPGTLCTSVNDEVVHGIPGLRKLENGDIISIDCGAVINGF
                     VGDSALTLPVGNISHEAQELLRVTEESLYAGIAQAVEGNRLSDVSHAVQKCAEKQGMS
                     VVRDYVGHGIGAKMHEDPQIPNFGPPGRGPRLKRGMTLAIEPMVNLGTFEVRTLDDNW
                     TVVTLDGRLSAHFEHTIAITDDTPEILTKL"
     gene            243100..243408
                     /locus_tag="Dred_0237"
     CDS             243100..243408
                     /locus_tag="Dred_0237"
                     /note="KEGG: cac:CAC3110 ribosomal protein L14E
                     (archaeal/eukaryotic type)"
                     /codon_start=1
                     /transl_table=11
                     /product="LSU ribosomal protein L14E"
                     /protein_id="ABO48786.1"
                     /translation="MQGLVDEVRAGQLVSSTQGRDTERYYLVLSKSDNSFVYVTDGEY
                     RGVEKPKRKNLKHLKIWPVASENIGTKIAAQMKVTNADIRSELAAMMKKLQEEPLLKG
                     "
     gene            243428..243646
                     /locus_tag="Dred_0238"
     CDS             243428..243646
                     /locus_tag="Dred_0238"
                     /note="TIGRFAM: translation initiation factor IF-1;
                     PFAM: RNA binding S1 domain protein; S1, IF1 family
                     protein;
                     KEGG: dsy:DSY0494 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="bacterial translation initiation factor 1
                     (bIF-1)"
                     /protein_id="ABO48787.1"
                     /db_xref="InterPro:IPR003029"
                     /db_xref="InterPro:IPR004368"
                     /db_xref="InterPro:IPR006196"
                     /translation="MSKNDVIEVEGKVLEPLPNAMFRVELQNGHKVLAHVSGKIRMNF
                     IRILPGDRVTVELSPYDLTRGRIVYRFK"
     gene            243675..243788
                     /locus_tag="Dred_0239"
     CDS             243675..243788
                     /locus_tag="Dred_0239"
                     /note="PFAM: ribosomal protein L36;
                     KEGG: cno:NT01CX_1140 ribosomal protein L36"
                     /codon_start=1
                     /transl_table=11
                     /product="LSU ribosomal protein L36P"
                     /protein_id="ABO48788.1"
                     /db_xref="InterPro:IPR000473"
                     /translation="MKVRPSVKPICEKCKIIRREGKVMVICENPKHKQKQG"
     gene            243810..244181
                     /locus_tag="Dred_0240"
     CDS             243810..244181
                     /locus_tag="Dred_0240"
                     /note="PFAM: ribosomal protein S13;
                     KEGG: mta:Moth_2434 ribosomal protein S13"
                     /codon_start=1
                     /transl_table=11
                     /product="SSU ribosomal protein S13P"
                     /protein_id="ABO48789.1"
                     /db_xref="InterPro:IPR001892"
                     /translation="MARIAGVDLPKDKRAEIALTYIYGIGKPTAQKILAQTGVNPDTR
                     IKDLTEEEVNKLRDYIDKNTKVEGDLRREVALNIKRLIEIGCYRGIRHRRGLPVRGQR
                     TKTNARTRKGPKKTVGARRKK"
     gene            244206..244595
                     /locus_tag="Dred_0241"
     CDS             244206..244595
                     /locus_tag="Dred_0241"
                     /note="PFAM: ribosomal protein S11;
                     KEGG: dsy:DSY0497 30S ribosomal protein S11"
                     /codon_start=1
                     /transl_table=11
                     /product="SSU ribosomal protein S11P"
                     /protein_id="ABO48790.1"
                     /db_xref="InterPro:IPR001971"
                     /translation="MARRQVRTKRKDKKNVEQGVAHIKSTFNNTIVTITDLKGNTLGW
                     SSAGQVGFKGSRKSTPFAAQMAAEAAAKDAMEHGLKEVEVTVKGPGSGREAAIRSLQA
                     AGLEVNMIKDVTPIPHNGCRPPKRRRV"
     gene            244618..245244
                     /locus_tag="Dred_0242"
     CDS             244618..245244
                     /locus_tag="Dred_0242"
                     /note="PFAM: ribosomal protein S4; RNA-binding S4 domain
                     protein;
                     KEGG: mta:Moth_2432 ribosomal protein S4"
                     /codon_start=1
                     /transl_table=11
                     /product="SSU ribosomal protein S4P"
                     /protein_id="ABO48791.1"
                     /db_xref="InterPro:IPR001912"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="InterPro:IPR005709"
                     /translation="MARYTGPHCRQCRREGLKLYLKGDRCYTGKCAIDRRSYAPGQHG
                     QGRKKVSEYGIQLRAKQKARRIYGVLEKPFRNYFEHAERQPGITGENLLRLLERRLDN
                     VVYRLGLGASRVEARQLVRHGHFTVNGKKVNIPSFQVRVGDEIAVREKSKASPRIKEL
                     VERAADRTTPAWLEYDGQEAKGRVIALPSRDQIDAPVEEHLIVELYSR"
     gene            245294..246241
                     /locus_tag="Dred_0243"
     CDS             245294..246241
                     /locus_tag="Dred_0243"
                     /EC_number="2.7.7.6"
                     /note="KEGG: dsy:DSY0499 hypothetical protein;
                     TIGRFAM: DNA-directed RNA polymerase, alpha subunit;
                     PFAM: RNA polymerase, alpha subunit domain protein; RNA
                     polymerase, dimerisation; RNA polymerase, insert;
                     SMART: RNA polymerase, RpoA/D/Rpb3-type"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit alpha"
                     /protein_id="ABO48792.1"
                     /db_xref="InterPro:IPR011260"
                     /db_xref="InterPro:IPR011261"
                     /db_xref="InterPro:IPR011262"
                     /db_xref="InterPro:IPR011263"
                     /db_xref="InterPro:IPR011773"
                     /translation="MLEIEKPKIEIVEQSEDNTYGKFVVEPLERGYGITLGNSLRRIL
                     LSSLPGAAVTSVKIEGVLHEFATVPGVQEDVTDIILNLKNLCLKIHSDEEKVLRVEAQ
                     TEGPVTAGDIIHDADVEILNPDLHLATLDTGGRLFMEISVNKGRGYSSAEKNKKGEHI
                     IGVIPIDSIYTPVRRVNYNVENTRVGQITDYDKLTLEVWTNGSIRPDEATSLSAKILS
                     EHLRLFIGLTETVNDVEIMVEKEEEQKDKILEMTIEELDMSVRSYNCLKRAGINTVEE
                     LIQRNEEDMMKVRNLGKKSLEEVINKLHELGLSLRQEDE"
     gene            246256..246594
                     /locus_tag="Dred_0244"
     CDS             246256..246594
                     /locus_tag="Dred_0244"
                     /note="PFAM: ribosomal protein L17;
                     KEGG: dsy:DSY0500 50S ribosomal protein L17"
                     /codon_start=1
                     /transl_table=11
                     /product="LSU ribosomal protein L17P"
                     /protein_id="ABO48793.1"
                     /db_xref="InterPro:IPR000456"
                     /translation="MGYRRFGLTTGHRKAMLRNLVTSLFRDERIETTGPRAKDVRSIA
                     EKLVTVAKKGDLAARRQCLEYIYEEDVVRKLFDTIAPQYAERQGGYTRIIKVGYRRGD
                     AAEMVLLELV"
     gene            246813..247646
                     /locus_tag="Dred_0245"
     CDS             246813..247646
                     /locus_tag="Dred_0245"
                     /note="PFAM: ABC transporter related;
                     SMART: AAA ATPase;
                     KEGG: tte:TTE2261 ABC-type cobalt transport system, ATPase
                     component"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter related protein"
                     /protein_id="ABO48794.1"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /translation="MSTPIISVQDVSYSYPETGKKQALADINMKVYQGEMIALLGPNG
                     SGKSTLARLLNGLLLPVKGEVIVDGLLSSDNQYTWEIRRKVGMVFQNPDNQLVAALVE
                     EELAFGMENLGISPEEMKRRIRKISERMELSEYLEFPPHRLSGGQKQRVAIASVLALE
                     PEVLVLDEPTSMLDPGGRKRVMLELERLKQRGTTIVLVTHDMTEAVMADRVMVLEQGK
                     LAFQGSPVQCFSKIEWLRKIGLELPPATELARRLKLKGLPVPTSPLHVSDWIEYLCPQ
                     L"
     gene            247631..248482
                     /locus_tag="Dred_0246"
     CDS             247631..248482
                     /locus_tag="Dred_0246"
                     /note="PFAM: ABC transporter related;
                     SMART: AAA ATPase;
                     KEGG: tte:TTE2260 ABC-type cobalt transport system, ATPase
                     component"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter related protein"
                     /protein_id="ABO48795.1"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /translation="MSPVIEINKLNVIYAAGTPMERQALSEISLLVSKGEFRAIIGPQ
                     GSGKSTLLQVMAGLITGEGTVKIAGLDLSAKKNRVQLWRQVGVVFQYPEKQLFEDTVW
                     NDVAYGPQNLGLKQDEVKSRVQMALDKVKLEEEYFHISPFKLSGGQQRRVAIAGILAM
                     EPKILLLDEPTAGLDPQGRQQLMGMFSSLCKKEKVTVVLVTHDMEEVANRADRVTVLQ
                     RGKLIMEGTPREVFCRGEELASAGLSVPFAAELATSLRVKGFNIKNLATLQEAERELE
                     RILKAKR"
     gene            248580..249389
                     /locus_tag="Dred_0247"
     CDS             248580..249389
                     /locus_tag="Dred_0247"
                     /note="PFAM: cobalt transport protein;
                     KEGG: sth:STH3043 cobalt ABC transporter permease protein"
                     /codon_start=1
                     /transl_table=11
                     /product="cobalt transport protein"
                     /protein_id="ABO48796.1"
                     /db_xref="InterPro:IPR003339"
                     /translation="MFLFSNITVGQYYPTKSIIHHMDPRAKLLAMPLIIAAVLLANHR
                     LGYLITATMVFLAVALARVPMVSFLRGMKFLWLFLLISLILQTLTYPGEVLWQWGFLA
                     VSREGLLLGLKLAYQLTLLILTAMLLTMTTTPVNLTGALEKLFQPFKPLGLPAHELAM
                     MMAIALRFIPTLLEEAEAIMKAQQARGGSIAAGKLGPRLKAAVALLVPLLAGSLRRAD
                     ELALAMEARCYRGDQGRTKLKQYQYKMMDFLILIVVAVITAMVILNRWGII"
     gene            249637..251160
                     /locus_tag="Dred_0248"
     CDS             249637..251160
                     /locus_tag="Dred_0248"
                     /EC_number="4.1.3.27"
                     /note="KEGG: sth:STH1407 anthranilate synthetase component
                     I;
                     TIGRFAM: anthranilate synthase component I;
                     PFAM: Anthranilate synthase component I and chorismate
                     binding protein; Anthranilate synthase component I domain
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="anthranilate synthase, component I"
                     /protein_id="ABO48797.1"
                     /db_xref="InterPro:IPR005256"
                     /db_xref="InterPro:IPR005801"
                     /db_xref="InterPro:IPR006805"
                     /translation="MYNPSFTEYRSLAEEYNLIPVYREYLADTETPVSVYEKLAPMGP
                     SFLLESVEGGITLARYSFIGCQCFLSYRFHQGRAEYRGLAGKVRLHGGPLQALEGVLS
                     RFRTPELSGLPRFTSGAVGYFGYDMIRHLEHLPNKKEDELNLPICQLMFPGVVLAFDH
                     VKRTLLIIANHPLSGSPEESYREAIKKIDRVAERIFQQEKINYSPKSNAQGYPMNQIN
                     QFLAEKSSITKEHFEEAVQKAKKHIQAGDIFQVVLSQRFTLPFSGQPLHLYRRLRAIN
                     PSPYLYYLDFGDFSLVGASPEMLVRLEGNQVITHPIAGTRPRGKQREEDNLLAEQLLA
                     DEKERAEHLMLVDLGRNDLGRVCLPGTVKVSQFMKVERYSHVMHLVSHVEGQMEKANN
                     SLGVLAACFPAGTVTGAPKIRAMQIIDDLEPLARGPYAGAVGYVDFAGNLDTAIIIRT
                     AILREGKAYIQSGAGIVADSDPTKEYEETLHKARAMASAVLAATNEEGERFYAGCTG"
     gene            251141..251710
                     /locus_tag="Dred_0249"
     CDS             251141..251710
                     /locus_tag="Dred_0249"
                     /EC_number="4.1.3.27"
                     /note="TIGRFAM: glutamine amidotransferase of anthranilate
                     synthase;
                     PFAM: glutamine amidotransferase class-I;
                     KEGG: mta:Moth_1341 glutamine amidotransferase of
                     anthranilate synthase or para-aminobenzoate synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="anthranilate synthase, component II"
                     /protein_id="ABO48798.1"
                     /db_xref="InterPro:IPR000991"
                     /db_xref="InterPro:IPR001317"
                     /db_xref="InterPro:IPR006220"
                     /db_xref="InterPro:IPR006221"
                     /db_xref="InterPro:IPR011702"
                     /db_xref="InterPro:IPR012998"
                     /translation="MLAVLDNYDSFTYNLVQLVRELGQEVRVYRNDAVSLKELLSPEI
                     KGLIISPGPGRPEQAGICQEAVRYLVGKLPILGVCLGHQVIAQSLGGRVVPAARLMHG
                     KTSAICHDNRGLYSNIPQQFVAARYHSLAVEEKSLPTCLKVTARTKEGEVMGIRHQHY
                     PVEGVQFHPESIATTCGKDLLSNFINQSS"
     gene            251746..252783
                     /locus_tag="Dred_0250"
     CDS             251746..252783
                     /locus_tag="Dred_0250"
                     /EC_number="2.4.2.18"
                     /note="TIGRFAM: anthranilate phosphoribosyltransferase;
                     PFAM: glycosyl transferase, family 3;
                     KEGG: mta:Moth_1340 anthranilate
                     phosphoribosyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="anthranilate phosphoribosyltransferase"
                     /protein_id="ABO48799.1"
                     /db_xref="InterPro:IPR000312"
                     /db_xref="InterPro:IPR005940"
                     /translation="MITEAIQKVVAGINLSEAEAMETMQEVMEGKATQAQIASLLTAL
                     HLKGETVPEITGFARTMRTKVIRVQTKRRNLVDTCGTGGDGANTFNISTACAFVLAGA
                     GLPVAKHGNRSVSSKCGSADVLEQLGVFVQLTPEEAGLCLDQVGIAFLFAPLLHGAMK
                     YAAAPRKEIGIRTVFNILGPLTNPAFAENQVLGVYSSDLAPVLAQVLANLGTKRSFVI
                     HGCGGLDEISLAGEALVYEVKDNQVKEMIIDPMDYGLDRAPISALAGGDAKRNARMIK
                     NILSGAPGPQRDTIIINAALGLIAGGLVRDLAMGIRLAEQIIDEGYALKKLNLLVEFS
                     QTLVGRRSAAL"
     gene            252780..253577
                     /locus_tag="Dred_0251"
     CDS             252780..253577
                     /locus_tag="Dred_0251"
                     /EC_number="4.1.1.48"
                     /note="PFAM: Indole-3-glycerol phosphate synthase;
                     KEGG: chy:CHY_1584 indole-3-glycerol phosphate synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="indole-3-glycerol phosphate synthase"
                     /protein_id="ABO48800.1"
                     /db_xref="InterPro:IPR001468"
                     /db_xref="InterPro:IPR013798"
                     /translation="MILEKIKEKKREEIRQLLLTANVAHMKKKILELPPARDFRKALY
                     NQGQVSLIAEIKKASPSKGLLCPNFDHRQLAHIYQSNGAAALSVLTDENFFLGKLTYL
                     EEIKQQSSLPLLRKDFILDPVQLYQSRLAGADAVLLIAGLLTPGELSQLFLLCREIGM
                     QALVEVHTQEELQRVLTTDAKLIGINNRDLSTFQTNLATTAKLLEQVQIEDITIVSES
                     GIAQKEDIKFLKSLGVHGVLVGEALVTAQDIAKKVQEIVVAGGRGEA"
     gene            253579..254205
                     /locus_tag="Dred_0252"
     CDS             253579..254205
                     /locus_tag="Dred_0252"
                     /EC_number="5.3.1.24"
                     /note="PFAM: N-(5'phosphoribosyl)anthranilate isomerase
                     (PRAI);
                     KEGG: mta:Moth_1338 phosphoribosylanthranilate isomerase"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylanthranilate isomerase"
                     /protein_id="ABO48801.1"
                     /db_xref="InterPro:IPR001240"
                     /translation="MVRVKICGVQDPKIGVAAALAGADAIGIVFASSSRRVTPEQARE
                     ICQALPPFTARVGIFVDTPQQEVQQIAHFCGLDVIQLHGGESADYCRDLGFRCIKAIP
                     ARNRQCLEEANAFPVSALLVDSYVNGKSGGNGCTFNWHLLEGLQLNKPLILAGGLNIE
                     NVGRAVAYVRPYGVDVSSGVEVKGQKDIPLIKAFIKRVREVSFNATGS"
     gene            254189..255379
                     /locus_tag="Dred_0253"
     CDS             254189..255379
                     /locus_tag="Dred_0253"
                     /EC_number="4.2.1.20"
                     /note="KEGG: ppd:Ppro_1291 tryptophan synthase, beta
                     subunit;
                     TIGRFAM: tryptophan synthase, beta subunit;
                     PFAM: Pyridoxal-5'-phosphate-dependent enzyme, beta
                     subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophan synthase, beta chain"
                     /protein_id="ABO48802.1"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="InterPro:IPR006653"
                     /db_xref="InterPro:IPR006654"
                     /translation="MQPDHRGYFGPYGGAFVPETLMPALEELIQAYGAASEDEEFLKE
                     VTYYLNDYVGRPSPIYFARALSEGTGGAKIFLKREDLNHTGAHKINNTIGQLLLARRM
                     GKKRIVAETGAGQHGVATATVSAMLGMQCVVYMGEEDIRRQALNVFRMRLLGAEVVKV
                     SSGTGTLKDAMNEAMRDWVTNVRNTFYVIGSVAGPHPYPKMVRDFQSIIGREAREQML
                     KKTGRLPDYVVACVGGGSNSMGIFYPFLEDQEVHLVGVEAGGLGLSSGQHAAPLTVGR
                     PGVLHGSYSYLMQDSHGQVHSVYSISAGLDYPGVGPEHSYLRDAGRVRYTVATDKEAL
                     EAFHLLCRTEGILPALESSHALVEAVKLAKVLDNSHNILVCLSGRGDKDVHTVAEGMG
                     EELV"
     gene            255376..256179
                     /locus_tag="Dred_0254"
     CDS             255376..256179
                     /locus_tag="Dred_0254"
                     /EC_number="4.2.1.20"
                     /note="KEGG: chy:CHY_1581 tryptophan synthase, alpha
                     subunit;
                     TIGRFAM: tryptophan synthase, alpha subunit;
                     PFAM: tryptophan synthase, alpha chain"
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophan synthase, alpha chain"
                     /protein_id="ABO48803.1"
                     /db_xref="InterPro:IPR002028"
                     /translation="MTGVEKINATFNKVREKHEKALVTYVTAGDPDLKTTGRLICSMD
                     RAGADIIEIGIPFSDPSADGPVIQRASARALKEGTNPPAILELVKEVKEQVLAPLILM
                     SYYNPILQYGLLEFCRDAANAGAAGLIVPDLPLEESTELLLAAGQVGLALIPLVAPTT
                     NRRRLARITAAAQAFVYCVTVTGITGTSQNVTGEIEELSKEVREATELPMVAGFGIAS
                     PEQAVKVAKYCDGVVVGSALVKLVETHQEDSLEPVANLTRQLKQALVQP"
     gene            256398..257141
                     /locus_tag="Dred_0255"
     CDS             256398..257141
                     /locus_tag="Dred_0255"
                     /EC_number="4.2.1.70"
                     /note="KEGG: cac:CAC3099 pseudouridylate synthase, TRUA;
                     TIGRFAM: tRNA pseudouridine synthase A;
                     PFAM: tRNA pseudouridine synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA pseudouridine synthase A"
                     /protein_id="ABO48804.1"
                     /db_xref="InterPro:IPR001406"
                     /translation="MKNIKLTLAYDGTNYHGFQEQRGTGLATIQEALEKALSTIAQTP
                     IQVIGAGRTDAGVHAQGQVVNFRSEKWPVPAEKAPLALNVLLPGDIKVVKAEEVPMDF
                     HARFSAVAKTYRYSIYHHRVMSPFHRYYCYHEPRRLDVNAMQEGAAYLLGTYDFKSFQ
                     AQGTPVKDTIRTIYRADIIEDAPVINLYLRGNGFLYNMVRIITGTLLNIGFGKIKPED
                     MVKIIESKNRTLAGTTAPPQGLCLMEVEY"
     gene            257408..257839
                     /locus_tag="Dred_0256"
     CDS             257408..257839
                     /locus_tag="Dred_0256"
                     /note="PFAM: ribosomal protein L13;
                     KEGG: chy:CHY_2274 ribosomal protein L13"
                     /codon_start=1
                     /transl_table=11
                     /product="LSU ribosomal protein L13P"
                     /protein_id="ABO48805.1"
                     /db_xref="InterPro:IPR005822"
                     /db_xref="InterPro:IPR005823"
                     /translation="MKTTFMAKPADVQRKWYVIDAEGKPLGRVAAEAARILRGKHTPM
                     FTPHVDTGDHVIVINADKVILTGKKLDQKMYTRHSGYPGGLKEFSYRTMMEKRPELIV
                     EKAIKGMLPHNRLGAQQFKKLKVYVGSEHSHEAQKPEVWNF"
     gene            257873..258265
                     /locus_tag="Dred_0257"
     CDS             257873..258265
                     /locus_tag="Dred_0257"
                     /note="PFAM: ribosomal protein S9;
                     KEGG: mta:Moth_2424 ribosomal protein S9"
                     /codon_start=1
                     /transl_table=11
                     /product="SSU ribosomal protein S9P"
                     /protein_id="ABO48806.1"
                     /db_xref="InterPro:IPR000754"
                     /translation="MAQVQFYGTGRRKNAVARVYLVPGEGKVVVNNKEVLDYFGRKTL
                     DMVVRQPLELTNTTGRFDVLVKVVGGGVSGQAGATRHGLARALVQADPNLRPVLKRAG
                     FLTRDPRMKERRKYGLKKARRAPQFSKR"
     gene            258607..260388
                     /locus_tag="Dred_0258"
     CDS             258607..260388
                     /locus_tag="Dred_0258"
                     /note="PFAM: sigma-54 factor, interaction
                     domain-containing protein; helix-turn-helix, Fis-type;
                     SMART: AAA ATPase;
                     KEGG: dsy:DSY1810 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="sigma54 specific transcriptional regulator, Fis
                     family"
                     /protein_id="ABO48807.1"
                     /db_xref="InterPro:IPR002078"
                     /db_xref="InterPro:IPR002197"
                     /db_xref="InterPro:IPR003593"
                     /translation="MAGILLEIQETVEKYASIMAKISNFDVEVVDADLFRVAGTGIFA
                     PFVNMDMSAEGYAYRQVLKTGKLQIIYTPGRDPICQDCPKRHNCTEEIEIAMPILARG
                     KTIGVIGLVGSSEWHRNTILQDEGTYLGLIEQIANFIAAKATERIDQKKQESMLSALS
                     CTIDHMEQGILILGSDRTITLANYEARKQLKLEILEGSQVKLTPTRDKINGQSEYLLS
                     VAEKKTYILGEIYIPFKVDESYAEVLVFTRSKNLHQKMYALTAAISTGNIIGSSEETA
                     ALRMEIEKVANSASTVLITGESGTGKEVAATAIWRAGNRRDQQFVALNCAAIPESLLE
                     SELFGYVKGAFTGADPNGRIGKFELANHGIVFLDEIGDMPLYLQAKLLRILQDRKIVR
                     IGSNQLIPVDVRVIAATNKDLKSMIADGKFREDLYYRLNVIPLNILPLRQRQKDIPDL
                     ANLFAQRYATRFGKSQCRIPPQTMDALLAHPWYGNVRELENTIEFMVNMSDEEGILDL
                     DTLPRDFLEHQRRAAYKHDWSANPAEGSLPPTDAQTVLPLKEVERREIQKALQLFGES
                     TQGKKSAAKSLGISLATLYRKTEEFSK"
     gene            260641..261843
                     /locus_tag="Dred_0259"
     CDS             260641..261843
                     /locus_tag="Dred_0259"
                     /note="TIGRFAM: diaminopropionate ammonia-lyase;
                     PFAM: Pyridoxal-5'-phosphate-dependent enzyme, beta
                     subunit;
                     KEGG: dsy:DSY1809 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="diaminopropionate ammonia-lyase"
                     /protein_id="ABO48808.1"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="InterPro:IPR010081"
                     /translation="MKELFKLVSYKRDEQQTADLSFLSLEEAKKVQSFHASFPVYQKT
                     PLVELKNTAQALGLGTLYVKDESHRFGLNAFKVLGGSFAIGNYMAKKLGMDIAELPYK
                     RMVSAEIREKLGDLTFVTATDGNHGRGVAWTANQLKMHSVVYMPKGSAIERLENIRAE
                     GAEASITDLNYDDAVRFANKQAEDKGWIMVQDTAWDGYEDIPAWIMQGYVTMGLEAYE
                     QLHEKPTHIFVQAGVGSMSASIIGFFSALYGDERPIMTVVEPNKADCLYRTAEANDGK
                     LHFVTGQMDTIMAGLACGEPCSIGWEILKNYTDNFISCPDYAAAKGMRILGNPAARDE
                     RVISGESGAATFGCVAEIMTNPELKHIKEALKLDENSRVLFFSTEGDTDRENYRAVVW
                     DGRFPSGK"
     gene            261878..263062
                     /locus_tag="Dred_0260"
     CDS             261878..263062
                     /locus_tag="Dred_0260"
                     /note="PFAM: peptidase M20; peptidase dimerisation domain
                     protein;
                     KEGG: dsy:DSY1807 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M20"
                     /protein_id="ABO48809.1"
                     /db_xref="InterPro:IPR001261"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR011650"
                     /translation="MLSKERKATVVELCQKLIRQRSYSGEEQGVVQVLQENMKAMGFD
                     EVTVDRYGNIIGCIKGKRPGKKLLFDGHIDTVPVTNAAEWQHPPFEAEIHDGKIYGRG
                     TSDMKGAVAAMTCAAANFANDTNKDFAGEIYVAGVVHEECFEGVAAREISKLVQPDYV
                     VIGEASQLNLKIGQRGRAEIVIETFGIPCHSANPKKGVNAVYKMAKVIEAIHTLVPPH
                     HPVLGDGILELTDIKSSPYPGASVVPEYCRATYDRRLLVGETKESVLAPIQQLLGQLM
                     AQDPELKVTVSYAVGVEKCHTGNEIEGKRFFPGWLYEENSDFVQSVFSQLKEMGYNPS
                     ITQYNFCTNGSHYAGEAGIKTFGLGPSKENLAHTVDEHIEIDQLTKVTDCYYGVMQAL
                     LK"
     gene            263093..264517
                     /locus_tag="Dred_0261"
     CDS             263093..264517
                     /locus_tag="Dred_0261"
                     /EC_number="3.5.2.2"
                     /note="PFAM: amidohydrolase;
                     KEGG: dsy:DSY1806 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydropyrimidinase"
                     /protein_id="ABO48810.1"
                     /db_xref="InterPro:IPR005847"
                     /db_xref="InterPro:IPR006680"
                     /translation="MFDLIIKNGKVVSPSSTVECDVAVKDGKIAALGHFNASEAASVV
                     DATGKYVMPGVIEAHMHCQAPFQGCLGANTFFEQSISGAFGGVTTFMDFANMGRGQSP
                     YTQALARAEEMSESAIDYSVHGKFVESTPEAISDIEKMANAGIPTFKMFMTYKKEGVM
                     SDDETMLKVFQKAKEVGGLPMVHCESNAIAETNIEKCRQAGDMNWVNFAKCKPVLCEA
                     EAFARAVYFAEYVGNGLIVVHTTNGEALGTARRAQAKDIPLYVETGPHYLTLFDDLYE
                     GENGHLAICSPPLRTPEEAENLWKGLEDGTILLTGSDDCTFDVDEKSMFLEKNPDGSW
                     KQDFTKVVNGLSGLEIRLPILLSEGVNKGRISINKLCALTSTNIAKVYGCYPHKGIIA
                     PGSDADIVLVDLNKEVVLSKEVLHNNISYCLHEGMKVTGFPVMTISKGKIIVENGEFK
                     GEKGAGRFLKRKIDPHYLEHYSLD"
     gene            264547..265953
                     /locus_tag="Dred_0262"
     CDS             264547..265953
                     /locus_tag="Dred_0262"
                     /note="PFAM: permease for cytosine/purines, uracil,
                     thiamine, allantoin;
                     KEGG: dsy:DSY1805 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="permease for cytosine/purines, uracil, thiamine,
                     allantoin"
                     /protein_id="ABO48811.1"
                     /db_xref="InterPro:IPR001248"
                     /translation="MTANSNEVLRNSELLPTTDAQRTMSLADYIILWAGMTINVVAFS
                     LGAQYYDGGRGLSPWTMIFVMTIGYGLVTALTAMVGDIGTKYGVPFAAYTRAPFGYKG
                     SYVAGLIRAIPGMYWFGFLTWVGASAINQMLGIIFPGFSNLTLMIILFAAIQIFNTMY
                     GLHAMAKFDWVAIPCLAIMFGAILVASLQKYNITLPDIMATPAEGQYSLAYAIAGIAG
                     GWITMSLNGSDLSRQIKRVDGYEKKGFFARNQRSIIGQVVGLMMVGIGTMLVGVVTGI
                     TSGYWDLNQVIPDLFQSKTVLILSFLVIMFAQWSTNTAANLLPPTLVLLNIFPKLKYW
                     MSAVICGVISVGMMPWKLQSQGGFLVMVQAWISQMLGPIIGILLVDYFLIRKCKLNVR
                     DLYVAEGQYQYTNGFNISAMVTIVVSFFVGLLCGDYAFFAGLACSAVLYYVLMKAFTL
                     KKYNQHIGEEVLFDPEKD"
     gene            266018..267619
                     /locus_tag="Dred_0263"
     CDS             266018..267619
                     /locus_tag="Dred_0263"
                     /EC_number="3.5.1.81"
                     /note="PFAM: D-aminoacylase domain protein; Amidohydrolase
                     3;
                     KEGG: dsy:DSY1804 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acyl-D-amino-acid deacylase"
                     /protein_id="ABO48812.1"
                     /db_xref="InterPro:IPR012855"
                     /db_xref="InterPro:IPR013108"
                     /translation="MKTLIQNGLVVDGSGAASYKADVLLNGDRITAIGTGLSADGALV
                     IDATGLVVAPGFIDTHSHSDLQILINPEVAPKVMQGITTEILGQDGISMAPLPVEYIS
                     PWRKNLAGLDGDSDNINWEFETTEGYLKLIEEVGPGLNECYLVPHGNIRMEAMGLENR
                     LPNDEELKKMCQITRREMEAGAVGLSTGLIYMPCAYSESKEIIEMCKVVAEYDGIFVI
                     HQRSEADTILDSMDEVIKIGRESGVKIHYSHFKVCGKKNWDKIEKVVELLEKAQKEGI
                     RVSFDQYPYVAGSTMLGVILPPWVHDGGTNRVLERLADPKLRQKMVYDIEHGIPGWDN
                     FVEFAGLDQIFVTNVKTSKNKDAVGLNLIQLGELHGKNPYDATFDLLLEEENAVGMVD
                     FYGTEEHVQLFMKRPEMNACTDGLLGGKPHPRVFGAFPRILGKYVREEKTFSLEEAVY
                     KMTKKPATTFNIVNRGELREGYFADITIFNPDTVIDKGTYTEPVQYPEGIEYVIINGS
                     LTVAQGKHTGSRTGKVLRKKGTDVI"
     gene            267684..268052
                     /locus_tag="Dred_0264"
     CDS             267684..268052
                     /locus_tag="Dred_0264"
                     /note="TIGRFAM: putative endoribonuclease L-PSP;
                     PFAM: Endoribonuclease L-PSP;
                     KEGG: dsy:DSY1808 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="putative endoribonuclease L-PSP"
                     /protein_id="ABO48813.1"
                     /db_xref="InterPro:IPR006056"
                     /db_xref="InterPro:IPR006175"
                     /translation="MKEIKTINAPGAIGPYSQGFISNGMVYTSGQIPVNPANGEVPEG
                     ISAQAEQSCKNVGALLESAGIGFANVVKTTCFLVDMADFAAFNEVYARYFISKPARSC
                     VAVKELPKGVLCEIEAVAEL"
     gene            268246..269061
                     /locus_tag="Dred_0265"
     CDS             268246..269061
                     /locus_tag="Dred_0265"
                     /note="PFAM: cell wall hydrolase/autolysin;
                     KEGG: swo:Swol_2295 N-acetylmuramoyl-L-alanine
                     amidase-like protein"
                     /codon_start=1
                     /transl_table=11
                     /product="cell wall hydrolase/autolysin"
                     /protein_id="ABO48814.1"
                     /db_xref="InterPro:IPR002508"
                     /translation="MAVIRAFRIKKRYVLGFITLSILFFQLYQMVLVKIEEKNITALS
                     YVLANKTIVVDPGHGGRDPGKIGLSGVPEKEINLEVSKRLAAVLGQMGAAIIMTREAD
                     VDLSDSSASGWKSKKQQDLTRRTDMANERKADLYISVHCNAYTSPREHGAQVFSQPGS
                     EDSKRLAECVQSEMAALLKNTNRKAKQVDYFALRKTKMPAAIVEIGFITNPKEDELLR
                     DPLYQSKVAWSIAAGIIKYYADLEERENQKIDEKNKEILETFRQQPGQYIPAP"
     gene            269209..270375
                     /locus_tag="Dred_0266"
     CDS             269209..270375
                     /locus_tag="Dred_0266"
                     /note="TIGRFAM: cysteine desulfurase family protein;
                     PFAM: aminotransferase, class V; aromatic amino acid
                     beta-eliminating lyase/threonine aldolase;
                     KEGG: tte:TTE2789 selenocysteine lyase"
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine desulfurase family protein"
                     /protein_id="ABO48815.1"
                     /db_xref="InterPro:IPR000192"
                     /db_xref="InterPro:IPR001597"
                     /db_xref="InterPro:IPR010969"
                     /translation="MVYFDSAATSWPKPPEVWQAMEHFIRKVGASPGRAGHKRTVEAN
                     KIVDETRQLLADLFNVDDYQRIIFTLNATDSLNLAIKGLLRPGDHVVTSSMEHNSVTR
                     PLYTLEAYGVQVTKVKCDQQGNINLGEVEQAIRPNTRAIVLTHASNVSGTIMPVEEVG
                     RIAAKYNLFFVMDAAQTAGLLDIDVKKLNISVLTFPGHKSLMGPQGTGGLYIREGVPL
                     LTLREGGTGSGSETPTQPDMMPEKYESGTLNAVGIAGLGAGVKFLRRVGMAKIREHEM
                     RLTKQFLEGAAGIEGLHIYGQQDLNNRVPVVSFRIDGYKAGPVGDSLDKEYDIACRAG
                     LHCAPDAHNTLGTFDEKLVRFSFSYFNKPEEVDYALNALRKIAFQSPVQTLPAR"
     gene            complement(270518..270790)
                     /locus_tag="Dred_0267"
     CDS             complement(270518..270790)
                     /locus_tag="Dred_0267"
                     /note="KEGG: mta:Moth_1003 flagellar biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis"
                     /protein_id="ABO48816.1"
                     /db_xref="InterPro:IPR006135"
                     /translation="MNRKKERVAAALRYHHGKDHAPTVVAVGKGDLATAIERLATEHN
                     IPLYRDETLAHTLTELGLGTEIPPELYEAVAKILIHVAVLDQKIIK"
     gene            complement(270794..271381)
                     /locus_tag="Dred_0268"
     CDS             complement(270794..271381)
                     /locus_tag="Dred_0268"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABO48817.1"
                     /translation="MIDRVMSALFKATDNMRVTPGKQVDKVQQKPFTLDQNIVAGAKE
                     TTKVHRSSETKTAEPSGNIDRQDQLSYVPLPLRTPLDENAHFYLKLKDLSAKTDSNGQ
                     NKLIFHINTDTLGPLWVTLSTQPGSLSVQCITERNSTAEIFRAASLDLQRELNETGYQ
                     NVLVSCRIQPGIRGIADIDPDFASADVFSLVNVQV"
     gene            271656..273059
                     /locus_tag="Dred_0269"
     CDS             271656..273059
                     /locus_tag="Dred_0269"
                     /note="PFAM: AMMECR1 domain protein; Extradiol
                     ring-cleavage dioxygenase, class III enzyme, subunit B;
                     KEGG: mta:Moth_2295 extradiol ring-cleavage dioxygenase,
                     class III enzyme, subunit B"
                     /codon_start=1
                     /transl_table=11
                     /product="Extradiol ring-cleavage dioxygenase, class III
                     enzyme, subunit B"
                     /protein_id="ABO48818.1"
                     /db_xref="InterPro:IPR002733"
                     /db_xref="InterPro:IPR002737"
                     /db_xref="InterPro:IPR004183"
                     /translation="MTIVFCGIMPHPPIALPEVGGAESDKIMATRKAMLELGYRIKES
                     GAETLVMISPHSTVFGDAIAINGLLEATGDMSRFGAPQVALHYKYDKDLGSEIGWQSE
                     DLGLPVVEVDKKMASKLGVNLELDHGFMVPLYYLAKAGLQLPLVPCSMGVFLPEKLYA
                     FGVAVKNAAEATQTKVAVVASGDLSHRLTPDAPAGYDEKGKEFDQAIVSLIKAMDVPG
                     LINLEEDLCERAGECGLRPITMMLGALDGLAVKSEVLSYEGPFGVGYMIATLTPLGSD
                     PKREILLKLREERKKKLALERARESYLVQVARQSLESYLQGQWKDLASYDIPKEYSGA
                     AGTFVSFKKGGNLRGCIGTTAPTRANIIQEVAYNAVSAGTQDPRFYPIRLDELDELTI
                     SVDVLMSPEPISGLDQLDVKRYGVIVRRGSRSGLLLPDLEGVDTPQQQVDIAKQKAGI
                     GPDEEVQLERFEVIRYR"
     gene            273099..273959
                     /locus_tag="Dred_0270"
     CDS             273099..273959
                     /locus_tag="Dred_0270"
                     /note="PFAM: Radical SAM domain protein;
                     SMART: Elongator protein 3/MiaB/NifB;
                     KEGG: chy:CHY_2267 radical SAM domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Radical SAM domain protein"
                     /protein_id="ABO48819.1"
                     /db_xref="InterPro:IPR006638"
                     /db_xref="InterPro:IPR007197"
                     /translation="MQEAMFYHQKENGLLFCELCPKGCSIREGHKGFCRVRENQKGVL
                     YTLNYGKVSSYAMDPMEKKPLYHFYPGTLILSLGTVGCNLRCGFCQNWQIAHGDPHTL
                     NLKPREAVELALEQRKKGFPCTGIAYTYSEPFMWYEYVYDTSRLAREAGLKNVMVTNG
                     YVREEPLKKLLPFIDAMNIDVKGFTDRYYRESCVGHLEPVKRTVEIAHQECHVELTTL
                     LVPELNDTPDEISELVDWVASLNPEIPLHFSRYFPNYQFDQPPTPLETMQRAYEIAKR
                     KLKNVHLGNV"
     gene            274300..275340
                     /locus_tag="Dred_0271"
     CDS             274300..275340
                     /locus_tag="Dred_0271"
                     /EC_number="1.2.1.38"
                     /note="KEGG: sth:STH2892 putative
                     N-acetyl-gamma-glutamyl-phosphate reductase;
                     TIGRFAM: N-acetyl-gamma-glutamyl-phosphate reductase;
                     PFAM: Semialdehyde dehydrogenase, NAD - binding;
                     Semialdehyde dehydrogenase, dimerisation region"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyl-gamma-glutamyl-phosphate reductase"
                     /protein_id="ABO48820.1"
                     /db_xref="InterPro:IPR000534"
                     /db_xref="InterPro:IPR000706"
                     /db_xref="InterPro:IPR012280"
                     /translation="MIKVGVVGATGYAGAELVRLLSRHPKVELTMLTSQTYAGKPMWE
                     VFPHLYGIVDNTLEELNIPKLVANCDVIFTALPHGHAMPIAQEVMKKSKRLIDLGADF
                     RLKDVNIYQAWYKTEHTAQLLLNNAVYGLPELYREIIKQSVIVANPGCYPTSVILGLA
                     PLLTNEMVDTKTLIIDAKSGVSGAGRGLSLKTHFSETTNNFQAYGVATHRHTPEIEQE
                     LALLAGNPVTVSFTPHLTPMIRGILSTIYASLINNVTTEELTAIYRQFYQGERFVRVL
                     PAGMYPTTKGVAGSNHCDISVTVDVRTKRVIVLSAIDNLIKGAAGQAVQNLNVMLGLP
                     EDTALDFAGIYP"
     gene            275352..276569
                     /locus_tag="Dred_0272"
     CDS             275352..276569
                     /locus_tag="Dred_0272"
                     /EC_number="2.3.1.1"
                     /EC_number="2.3.1.35"
                     /note="KEGG: sth:STH2890 putative amino-acid
                     acetyltransferase;
                     TIGRFAM: arginine biosynthesis bifunctional protein ArgJ;
                     PFAM: arginine biosynthesis protein ArgJ"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylglutamate synthase / glutamate
                     N-acetyltransferase"
                     /protein_id="ABO48821.1"
                     /db_xref="InterPro:IPR002813"
                     /translation="MKEKAINIIKGGVTSAKGFLAGAVAAGLKKNDLLDLALIYSEVP
                     ASVAGVYTTNRVKAAPLELTKQRVSGGIGQAVIINAGNANACTGEQGMPAAMEMARSA
                     AVALDIPEEYVMVASTGVIGVPLPVEKIVKAVPGAASSLSKEGHDLACQAIMTTDLVP
                     KEYAVQVQIGEKVVTIGGMAKGSGMIHPNMATMLCFITTDAVIASDVLQGALKGSVDD
                     SFNMITVDGDTSTNDMVVVLANGLADNPAIQMDSEDYQTFCKGLSEVCRALAKSIARD
                     GEGATRLIEVQVIGAPSVQDARLASRSVAGSNLFKAAVFGKDANWGRILCALGYSGAN
                     FDPALTDILIGDVAVAKDGGAVHFDEEQALKMLEQDPVKVFVDLKSGTHAATAWGCDL
                     TYDYVRINGSYRT"
     gene            276638..277501
                     /locus_tag="Dred_0273"
     CDS             276638..277501
                     /locus_tag="Dred_0273"
                     /EC_number="2.7.2.8"
                     /note="KEGG: mta:Moth_2288 acetylglutamate kinase;
                     TIGRFAM: acetylglutamate kinase;
                     PFAM: aspartate/glutamate/uridylate kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylglutamate kinase"
                     /protein_id="ABO48822.1"
                     /db_xref="InterPro:IPR001048"
                     /db_xref="InterPro:IPR001057"
                     /db_xref="InterPro:IPR004662"
                     /translation="MISPLEKAGILVEALPYIKKFSGKTIVIKYGGHAMLNADLKKAV
                     MTDLVLMKFVGINPVVVHGGGPEITGMLHRLGIESQFVSGLRVTDAPTMEVVEMVLGK
                     LNKEIVALINGLGGRSVGLSGKDANLIMANKKYSNDCQDIGFVGEVTGVNPQLLQTVI
                     QEGYIPVVSPVGISTEGETYNINADTVASAIATALKADKLIILTDVEGILEDRQDKGT
                     LISTVKMEDIPRLIERGVIQGGMIPKVECCMQAIQTGVATTHILDGRVPHSILLEVFT
                     DKGIGTMVVSD"
     gene            277515..278705
                     /locus_tag="Dred_0274"
     CDS             277515..278705
                     /locus_tag="Dred_0274"
                     /EC_number="2.6.1.11"
                     /note="TIGRFAM: acetylornithine and succinylornithine
                     aminotransferases;
                     PFAM: aminotransferase class-III;
                     KEGG: mta:Moth_2287 acetylornithine and succinylornithine
                     aminotransferases"
                     /codon_start=1
                     /transl_table=11
                     /product="acetylornithine aminotransferase apoenzyme"
                     /protein_id="ABO48823.1"
                     /db_xref="InterPro:IPR004636"
                     /db_xref="InterPro:IPR005814"
                     /translation="MNNQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDF
                     VSGIAVNCLGHAHPEVAEAVCKQVKTLLHCSNIYWIEPQVKLAKLLVENSCADKAFFC
                     NSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHGRTLATVTATGQTKYQRGLDP
                     LPQGFAYVPFNDLEALKNTIGPHTCAVMLEPVQGEGGVIPAAQAYLEGVKQLCEEKGL
                     LLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPG
                     DHASTFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRG
                     LGLMIGLELGIEGKDIVAHCLEQGLLINCTNGNVLRFLPPLIITKDEIDQAVQILKRA
                     MLVV"
     gene            278717..281941
                     /locus_tag="Dred_0275"
     CDS             278717..281941
                     /locus_tag="Dred_0275"
                     /note="TIGRFAM: carbamoyl-phosphate synthase, large
                     subunit;
                     PFAM: phosphoribosylglycinamide synthetase;
                     Carbamoyl-phosphate synthase L chain, ATP-binding;
                     Carbamoyl-phosphate synthetase large chain,
                     oligomerisation; Carbamoyl-phosphate synthetase large
                     chain domain protein; MGS domain protein;
                     KEGG: dsy:DSY2042 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="carbamoyl-phosphate synthase large subunit"
                     /protein_id="ABO48824.1"
                     /db_xref="InterPro:IPR000115"
                     /db_xref="InterPro:IPR005479"
                     /db_xref="InterPro:IPR005480"
                     /db_xref="InterPro:IPR005481"
                     /db_xref="InterPro:IPR005483"
                     /db_xref="InterPro:IPR006275"
                     /db_xref="InterPro:IPR011607"
                     /db_xref="InterPro:IPR011761"
                     /translation="MPKRKEIKTVLVIGSGPIIIGQAAEFDYAGTQACKALREEGIRV
                     VLVNSNPATIMTDADIADVVYVEPLTWQSIEKIIAKEKPDGLLPTLGGQTGLNMAVEL
                     AEQGILDKYGVTLLGTTLETIKRAEDRELFRATMLEIGEPIPESTIASTLEECIEFAN
                     KIGYPLIVRPAYTLGGTGGGIVKDEKELTATCHRGLKMSMINQVLLERSVAGWKEIEY
                     EVMRDNADNCITICNMENIDPVGVHTGDSIVVAPSQTLADREYQMLRTASLKIIRALK
                     VAGGCNVQFALDPHSMEYIVIEVNPRVSRSSALASKATGYPIAKLAAKIAIGLNLDEI
                     NNPVTGKTTACFEPTLDYVVVKIPRWPFDKFASGDRILGTQMKATGEVMAIDRSFEGA
                     LMKAVRSLEIGVDSIQMKGSASWTEMELESKLSRPDDERLFVIAEAFRRYWTMKEIQQ
                     LTGIDYWFLEKIKDLVVLEQQIRNVGSLPAQDLLRRAKACGLSDAQIGRLCGKTMQDI
                     RNLRKAYNILPTYKVVDTCAAEFEASTPYYYSTYDWEDEVEVSSRKKVIVLGSGPIRI
                     GQGVEFDYCSVHSVWGLQREKIEAIIINNNPETVSTDFDTADKLYFEPLTIEDVMNII
                     EKEKPLGVIVQFGGQTAINLAGDLAEMGVKILGTPIEGIDAAEDREKFEKLLKGLGIP
                     QTEGKTATNVEEAQKIAAELGFPVLVRPSYVLGGRAMEIVYNEDQLLKYMSTAVQVSP
                     KHPVLVDKYVRGKEVEVDAIGDGENIFIPGIMEHIERAGVHSGDSIAVYPPQSLNQQE
                     MEQVVDYTLRIGKGLKICGLMNIQYVVGEEGVFVLEVNPRASRTVPVLSKVTGVPMVQ
                     AATRCMLGNSLSDMGYGCGLGPVSNYITVKAPVFSFEKLSLVETSLGPEMKSTGEVMG
                     VDQNFSHAFYKAMTAAGLKVAKSGTVLFSVAERDKLEAVAVARQYASLGFKLYATTHT
                     AATLSSAGLPVLNTEDPLSLVRSGKVQMVVNTPTKGKVSGRPGFRLRRLASEYKVPCL
                     TSLDTARAMAVVLTDLLQGEPVLPVSLNQFTKFLNDKEPVQNAG"
     gene            282036..282983
                     /locus_tag="Dred_0276"
     CDS             282036..282983
                     /locus_tag="Dred_0276"
                     /EC_number="2.1.3.3"
                     /note="KEGG: swo:Swol_2287 ornithine carbamoyltransferase;
                     TIGRFAM: ornithine carbamoyltransferase;
                     PFAM: aspartate/ornithine carbamoyltransferase,
                     Asp/Orn-binding region; aspartate/ornithine
                     carbamoyltransferase, carbamoyl-P binding domain"
                     /codon_start=1
                     /transl_table=11
                     /product="ornithine carbamoyltransferase"
                     /protein_id="ABO48825.1"
                     /db_xref="InterPro:IPR002082"
                     /db_xref="InterPro:IPR002292"
                     /db_xref="InterPro:IPR006130"
                     /db_xref="InterPro:IPR006131"
                     /db_xref="InterPro:IPR006132"
                     /translation="MEKINDCLKGRDLLTLHDYTVDEVKLILQEAQRIKAMQKAGIPH
                     PYLQGKTLGMIFQKSSTRTRVSFEVGMYQLGGYALFLSPKDIQMGRGESVADTARVLS
                     RMLDGIMIRTFAQEEVEELAEYADIPVINGLTDRTHPCQILADFLTIQEHKGQLAGLK
                     LAYVGDGNNIAHSLLYGCAKVGMDICVASPEGYQPDAQIVSQAKEDARTTGAKVEVVS
                     DPVVAMQAADVVITDVWASMGQEAEQRERERAFAGYQVNSDLCAHAKPDFIFLHCLPA
                     HRGEEVTAEIIDGPHSVVWDEAENRLHAQKAVMALLIQS"
     gene            283235..284440
                     /locus_tag="Dred_0277"
     CDS             283235..284440
                     /locus_tag="Dred_0277"
                     /EC_number="6.3.4.5"
                     /note="PFAM: argininosuccinate synthase;
                     KEGG: dsy:DSY0785 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="argininosuccinate synthase"
                     /protein_id="ABO48826.1"
                     /db_xref="InterPro:IPR001518"
                     /translation="MPKVVLAYSGGLDTSVIIAWLKENYGYEVIAVTADLGQGEELAP
                     LEEKALQSGASKIYIEDLRKEFVEDYIWPTLKAGAIYEGKYLLGTSFARPLIAKKLVE
                     IAEKEGAVAVAHGATGKGNDQVRFELGVKALAPHLKVIAPWREWDIRSREDAIDYAEA
                     RGIPVPVTKKSIYSRDRNIWHISHEGGELESPANAASYDMLMLTVPPEKAPDQPTYVE
                     IGFEKGIPVSINGELMDSIGLLEKLNVIGGENGIGIVDMVENRLVGMKSRGVYETPGG
                     AILVYAHRELELLTLDRATLHYKEQIALRYAELVYDGVWFAPLREALDAFVDNTQRTV
                     TGTVKLKLYKGNMMPAGVTSPYSLYDEELSTFGRDEVYNQADAAGFINLFGLPLKVRA
                     MMEKKAGLR"
     gene            284575..285957
                     /locus_tag="Dred_0278"
     CDS             284575..285957
                     /locus_tag="Dred_0278"
                     /EC_number="4.3.2.1"
                     /note="TIGRFAM: argininosuccinate lyase;
                     PFAM: fumarate lyase;
                     KEGG: dsy:DSY0786 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="argininosuccinate lyase"
                     /protein_id="ABO48827.1"
                     /db_xref="InterPro:IPR000362"
                     /db_xref="InterPro:IPR003031"
                     /db_xref="InterPro:IPR009049"
                     /translation="MKLWGGRFQKTTDSLVEDFHSSISFDQRLYKQDIRGSIAHATML
                     GKVGIISLEEAAQIVTGLKQILEEIEAGKVEFDVAAEDIHMNVEQLLTAKIGAVGKKL
                     HTARSRNDQVAVDIRMYLKDEIIEIRALLKELVETLLNLAEQHTNTVMPGYTHMQRAQ
                     PITFAHHLMAYSQMFMRDMGRLTDCYKRTDVMPLGSGALAGTTFPLDREYTAELLGFA
                     AVSDNSLDAVSDRDFAVEFCAAASLIMMHLSRFCEEIILWATGEFAFIDLDDAYSTGS
                     SIMPQKKNPDVAELIRGKTGRVYGDLMGLLTMLKGLPMAYNKDMQEDKEALFDAMDTV
                     KGCLMVFRPMLATMTVRQENMAKAARGGFTNATDVADYLAKKGVPFREAHEVVGKAVF
                     YCLQQNKALEELTLEEYKELSPVFEDDIYAAIGVEYCVAARKVRGGPAPEAVQQAITR
                     TKERLKQLGE"
     gene            286097..287188
                     /locus_tag="Dred_0279"
     CDS             286097..287188
                     /locus_tag="Dred_0279"
                     /note="PFAM: GAF domain protein; metal-dependent
                     phosphohydrolase, HD sub domain;
                     SMART: metal-dependent phosphohydrolase, HD region;
                     KEGG: mta:Moth_2150 metal dependent phosphohydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="metal dependent phosphohydrolase"
                     /protein_id="ABO48828.1"
                     /db_xref="InterPro:IPR003018"
                     /db_xref="InterPro:IPR003607"
                     /db_xref="InterPro:IPR006674"
                     /translation="MEQRNVFTAEEVEILIEVSALLSSDLRGEEILEILMEQAVFLVK
                     AETGILWLRPGEEKDLVPVAAYGLDFASVNLLHKQFKGYVESLTVGGKSIITKEKTGG
                     NILLENASFAMNMAVKSMVFLPLINKGRILGCLQLMNKQDGGVFGPRDLRLCNTFASQ
                     AAVIIDNSFLIANQEKLMLSLIRALSSALDARDPYTQGHSERVSKLALLIAREIQMSH
                     KQQVVLQRAALLHDVGKIGIRDNVLLEPGPLDEQRWQIMKSHPVIGAQIIQQIEPKSM
                     MQQIYDGVMYHQEKYDGTGYPSGLRGKEIPLVARIIAIADAYDAITSDRPYRKGKDAK
                     EALEEIERCAGKHFDPQLVQAFLRAMAEQ"
     gene            287925..289589
                     /locus_tag="Dred_0280"
     CDS             287925..289589
                     /locus_tag="Dred_0280"
                     /EC_number="4.2.1.9"
                     /note="KEGG: tte:TTE0020 dihydroxy-acid dehydratase;
                     TIGRFAM: dihydroxy-acid dehydratase;
                     PFAM: dihydroxy-acid and 6-phosphogluconate dehydratase"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroxyacid dehydratase"
                     /protein_id="ABO48829.1"
                     /db_xref="InterPro:IPR000581"
                     /db_xref="InterPro:IPR004404"
                     /db_xref="InterPro:IPR010916"
                     /translation="MMRSDTMKKGLERAPHRSLFRALGLIDEELSRPMIGVVNSFNEI
                     VPGHMHLREIAEAVKAGVRMAGGTPVEFPVIAVCDGIAMGHPGMRYSLASREIIADSI
                     EVMAQAHPFDGLVLIPNCDKVVPGMLMAAARLNIPAIVVSGGPMMAGRFQDKDVSLSQ
                     MFEAVGAVVANRMSQEELAELEDQACPGCGSCSGMFTANSMNCLTEALGMALPGNGTV
                     PAVSAARRRLAKTAGMRAVALVKEDLKPRDILTPENFRNGLAVDMALGCSTNTVLHLP
                     AIAHEAGLDLDLNLINEISEKSPHLCKLSPAGEYHIQDLYAAGGIQAVMKELSLNGLI
                     NLNIKTVSGLTVEQLIEQAKVRDYNVIRSVQEPYSPTGGLAILRGNLALEGAVVKRAA
                     VAPEMLQHTGPAKVFDGEETAIEAIMGGQIKAGDVVVIRYEGPKGGPGMREMLGPTSV
                     LAGMGLDKEVALLTDGRFSGASRGASIGHISPEAAEGGLIAVLQDGDIVEIDIPNYRL
                     EVKLDSEEINRRMAAWQAPQPRVKEGYLARYAEKVSSAGKGAVCNR"
     gene            289675..291339
                     /locus_tag="Dred_0281"
     CDS             289675..291339
                     /locus_tag="Dred_0281"
                     /EC_number="2.2.1.6"
                     /note="KEGG: chy:CHY_0517 acetolactate synthase, large
                     subunit, biosynthetic type;
                     TIGRFAM: acetolactate synthase, large subunit,
                     biosynthetic type;
                     PFAM: thiamine pyrophosphate enzyme domain protein
                     TPP-binding; thiamine pyrophosphate enzyme, central
                     region; thiamine pyrophosphate enzyme TPP binding domain
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="acetolactate synthase, large subunit"
                     /protein_id="ABO48830.1"
                     /db_xref="InterPro:IPR000399"
                     /db_xref="InterPro:IPR011766"
                     /db_xref="InterPro:IPR012000"
                     /db_xref="InterPro:IPR012001"
                     /db_xref="InterPro:IPR012846"
                     /translation="MMRMSGAKILLDSLKEMGVDTIFGYPGGSAIPIYDALYDSDIRH
                     ILCRHEQGAVHAADGYARASGKVGVCLATSGPGATNLVTGIANAYMDSIPLVAITGQV
                     PTSMLGRDSFQEADITGITLPITKHNYIVKDINELGKVVKEAFHIAASGRPGPVLIDI
                     PKDISAGEMDYQPNGPVDLPGYKPPGMAREDLVNQAFRLIAVSERPVIYAGGGIISAG
                     AHEELKKLAETILAPVATTLMGLGGFPGDHALALGMLGMHGTKYANFAICDCDLLIAV
                     GVRFDDRVTGKVESFAPNAKIIHIDIDPAELGKNVRVDVPIAGNVKLVLQQLLERVQT
                     RIPEAWQHKVAQWKKEYPLDFDENGEGLTPQYVIREIYRQTGGEARIATEVGQHQMWA
                     AHYYTYTKPRSFISSGGLGTMGYGFPAAIGVQVACPEETVFDIAGDGSIQMNIQELAT
                     AVDYDLPVNIAVMNNGYLGMVRQWQELFYNRRYSYVEMKSPNFVKLAEAYGAEGYQVT
                     RKDEVAEVMQAAVQSRKPVLMDFVVEREGNVLPFVPPGKALNEMLG"
     gene            291355..291867
                     /locus_tag="Dred_0282"
     CDS             291355..291867
                     /locus_tag="Dred_0282"
                     /EC_number="2.2.1.6"
                     /note="TIGRFAM: acetolactate synthase, small subunit;
                     PFAM: amino acid-binding ACT domain protein;
                     KEGG: chy:CHY_0518 acetolactate synthase III small
                     subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="acetolactate synthase, small subunit"
                     /protein_id="ABO48831.1"
                     /db_xref="InterPro:IPR002912"
                     /db_xref="InterPro:IPR004789"
                     /translation="MYHTLAVLVENSPGVLARVAGLFSRRGYNIDSLAVGRTDDPAIS
                     RMTIVVEGDERVLEQVSKQLHKLVDVIKINDITANPHVDRELVLIKVSADNGSRNEIM
                     QIAQIFRANIVDYGHKNLTLECTGNQEKINAFEEALRPFGMKELVRTGKVAMLRGAKY
                     TNITKTKEED"
     gene            291870..292862
                     /locus_tag="Dred_0283"
     CDS             291870..292862
                     /locus_tag="Dred_0283"
                     /EC_number="1.1.1.86"
                     /note="KEGG: dsy:DSY1368 hypothetical protein;
                     TIGRFAM: ketol-acid reductoisomerase;
                     PFAM: acetohydroxy acid isomeroreductase; Acetohydroxy
                     acid isomeroreductase, catalytic domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ketol-acid reductoisomerase"
                     /protein_id="ABO48832.1"
                     /db_xref="InterPro:IPR000506"
                     /db_xref="InterPro:IPR013023"
                     /db_xref="InterPro:IPR013116"
                     /translation="MVKVYYDADANLEFLKGKKIAVLGYGSQGHAQAQSLRDSGLDVV
                     VGLRKDSARWSKAEADGLQVATVPDACAQAEVIQVLLPDEIQGRVYAEEIEPYLSEGK
                     ALMFSHGFNIHFGQIVPPKNVDVFLVAPKSPGHLVRRMYAEGKGVPGLVAVHQDYTGK
                     AKDIALAYAKGIGCTKAGVFETSFREETETDLFGEQAVLCGGVSELIKAGFDTLVEAG
                     YAPEMAYFECLHELKLIVDLIYEGGLSRMRYSVSNTAEYGDYMIGPRIVNEETREEMR
                     QVLMEIQDGTFARNWMLENQVKSPQFNAVRKMEQEHPIEEVGARLREMMPWLKK"
     gene            293058..294725
                     /locus_tag="Dred_0284"
     CDS             293058..294725
                     /locus_tag="Dred_0284"
                     /EC_number="2.2.1.6"
                     /note="KEGG: sfu:Sfum_3023 acetolactate synthase, large
                     subunit, biosynthetic type;
                     TIGRFAM: acetolactate synthase, large subunit,
                     biosynthetic type;
                     PFAM: thiamine pyrophosphate enzyme domain protein
                     TPP-binding; thiamine pyrophosphate enzyme, central
                     region; thiamine pyrophosphate enzyme TPP binding domain
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="acetolactate synthase, large subunit"
                     /protein_id="ABO48833.1"
                     /db_xref="InterPro:IPR000399"
                     /db_xref="InterPro:IPR011766"
                     /db_xref="InterPro:IPR012000"
                     /db_xref="InterPro:IPR012001"
                     /db_xref="InterPro:IPR012846"
                     /translation="MKITCAEALVRCLELEGVELIFGYPGGAILPVYDALINSKIKHI
                     LTRHEQGAAHAASGYARTTGKVGVCMTTSGPGATNLVTGLANAYMDSIPLVAITGQVP
                     TSQVGTDAFQEVDITGITIPVTKHNYLVKDPKMLPKILKQAFHIAQTGRPGPVLIDLP
                     KDVAQAEINFNYPQDVELMGYKPTVKGHVAQINQAAKLIMQAERPVIYTGGGIVNANA
                     SEELLWLAETIDAPVVSTLMGLGAFPGDHRLFLGMLGLHGIKAANLAVTECDLLITLG
                     ARFDDRVTGRISGFAPNAKVIHVDIDPAEISKNVISHMPIVGDTKKVLEALLVRLDKK
                     QNISWNAKVADWKKEFGPRYQAEGEYLKPQHIIEEIHRHTNGKAIMTTDVGQHQMWVA
                     QHYTFTGPRDLVTSGGLGCMGFGLPGAIGAQIGRPNETVVLVTGDGSFQMTLNELSTA
                     AEQGLPLKIFVLNNQRLGMVRQLQEFYCDKRYTAVDFSFVPDFAALARVYGFKGITVK
                     NEEELQKALKETFGETGPVLVDCTIDPEENVLPMVLAGKDINDCVDC"
     gene            294750..296267
                     /locus_tag="Dred_0285"
     CDS             294750..296267
                     /locus_tag="Dred_0285"
                     /EC_number="2.3.3.13"
                     /note="TIGRFAM: 2-isopropylmalate synthase;
                     PFAM: pyruvate carboxyltransferase; LeuA allosteric
                     (dimerisation) domain;
                     KEGG: chy:CHY_0521 2-isopropylmalate synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="2-isopropylmalate synthase"
                     /protein_id="ABO48834.1"
                     /db_xref="InterPro:IPR000891"
                     /db_xref="InterPro:IPR002034"
                     /db_xref="InterPro:IPR005671"
                     /db_xref="InterPro:IPR013709"
                     /translation="MNNRVHIFDTTLRDGEQSPGVSLNLNEKLQIARQLARLGVDIIE
                     AGFPITSPGDFAAVQAVAREVRGVTVAGLARANFKDIDVAWDAIKEAEQARIHTFIAT
                     SDIHLKYKLRKDREQVIEAAVAAVKHARKYTSDVEFSAEDASRSDIDYLCRIFQEVIK
                     AGATVINVPDTVGYTTPGEYAQFIRDILEKTPGMEKIVLSVHCHDDLGLAVANSLAAV
                     GAGARQVEGAINGIGERAGNAALEEVVMGLYTRKDYYGLMTGINTPEIYRTSRLVSSL
                     TGMPVQPNKSVVGKNAFAHESGIHQDGVLKERTTYEIMNPEQVGITANNLVLGKHSGR
                     HAFRDRLEELGYHLNEEELNLAFSRFKVLADKKKEITDHDLQAMVEDEIKHIPDTYVL
                     KYLHISTGTAVVPTATLGLQMGDELKEEAACGDGPVDAIYKTVDKITGISCTLVNYAI
                     NAITGGKDALGDVTVKIRCEEKEKVYIGRGVSTDILEASAKAYVNAINKLIHDMQ"
     gene            296297..297553
                     /locus_tag="Dred_0286"
     CDS             296297..297553
                     /locus_tag="Dred_0286"
                     /EC_number="4.2.1.33"
                     /note="KEGG: mta:Moth_2254 3-isopropylmalate dehydratase,
                     large subunit;
                     TIGRFAM: homoaconitate hydratase family protein;
                     3-isopropylmalate dehydratase, large subunit;
                     3-isopropylmalate dehydratase;
                     PFAM: aconitate hydratase domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate dehydratase, large subunit"
                     /protein_id="ABO48835.1"
                     /db_xref="InterPro:IPR001030"
                     /db_xref="InterPro:IPR006251"
                     /db_xref="InterPro:IPR011823"
                     /db_xref="InterPro:IPR011826"
                     /translation="MTITEKVLAAAAGKESVKPGELINAKVDLVLANDITAPVAIKEF
                     QKIGLDKVWDKNRVALVPDHFTPNKDIKSAEQAKLVRDFAHTQELANYFEVGRMGIEH
                     CLLPEQGLVGPGDVIIGADSHTCTYGALGAFATGVGSTDLAAAMALGETWFKVPESIK
                     FVFNGQLNKYVGGKDLILHTIGQIGVDGALYKAMEFCGEAISQLSMDGRFTMCNMAIE
                     AGGKNGIIQPDEITRQYVEGRTKRPYTFYTSDPDAQYSKVYEFDVNKIEPQVAFPHLP
                     ENARPVSQAGHVDIDQAVIGSCTNGRMEDLRLAAEILKGKKVHQQVRLIVIPGTQEIY
                     RQAMREGLFEIFLDAGAVVSTPTCGPCLGGHMGILAKGERCIATTNRNFVGRMGHAES
                     EVYLANPAVAAASAITGRISHPQEVL"
     gene            297554..298054
                     /locus_tag="Dred_0287"
     CDS             297554..298054
                     /locus_tag="Dred_0287"
                     /EC_number="4.2.1.33"
                     /note="TIGRFAM: 3-isopropylmalate dehydratase, small
                     subunit;
                     PFAM: aconitate hydratase domain protein;
                     KEGG: pab:PAB0892 3-isopropylmalate dehydratase small
                     subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate dehydratase, small subunit"
                     /protein_id="ABO48836.1"
                     /db_xref="InterPro:IPR000573"
                     /db_xref="InterPro:IPR011827"
                     /translation="MNQQGKVWKFGNDIDTDIIIAARYLNSSDPVELAKHCMEDGDPT
                     FASKVSAGDVMLAGKNFGCGSSREHAPIAIKAAGVSCVVAKSYARIFYRNAFNIGLPI
                     FECPEAVDEINEGDVITVDAASGAIVNQTSGKHYQAVPIPDFMRQIIDAGGLISYVKG
                     RVKQDV"
     gene            298047..299117
                     /locus_tag="Dred_0288"
     CDS             298047..299117
                     /locus_tag="Dred_0288"
                     /EC_number="1.1.1.85"
                     /note="KEGG: swo:Swol_2140 3-isopropylmalate
                     dehydrogenase;
                     TIGRFAM: 3-isopropylmalate dehydrogenase;
                     PFAM: isocitrate/isopropylmalate dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate dehydrogenase"
                     /protein_id="ABO48837.1"
                     /db_xref="InterPro:IPR001804"
                     /db_xref="InterPro:IPR004429"
                     /translation="MYKVALLPGDGIGPEIVPQAVRVLQAIGEKYKREFSFQTALIGG
                     AAYDATGHPLPEETLAVCRNSDAILLGAVGGPKWDNLEPQLRPERGALLPLRKKLGLY
                     ANVRPASVNSALAEASPLKEELVSGLDILIIRELTGGLYFGQKHREDIPGGGQKAVET
                     LEYTTEEVERVARLGFEMASKRNKKLMSVDKANVLESSRLWREVVEEVAKDYPDVELS
                     HMYVDNCAMQLVRYPKQFDVMVTENMFGDILTDLASQLTGSIGMLPSASLGGEVALYE
                     PIHGSAPDIAGKNLANPIATILSAAMMLRISFGLETEAAAIEQAVAKVLDQGYRTGDI
                     MQPGKTKVGTVEVTDAIIKALG"
     gene            299270..300811
                     /locus_tag="Dred_0289"
     CDS             299270..300811
                     /locus_tag="Dred_0289"
                     /EC_number="2.3.3.13"
                     /note="TIGRFAM: 2-isopropylmalate synthase/homocitrate
                     synthase family protein;
                     PFAM: pyruvate carboxyltransferase; LeuA allosteric
                     (dimerisation) domain;
                     KEGG: mta:Moth_2251 2-isopropylmalate synthase/homocitrate
                     synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="(R)-citramalate synthase"
                     /protein_id="ABO48838.1"
                     /db_xref="InterPro:IPR000891"
                     /db_xref="InterPro:IPR002034"
                     /db_xref="InterPro:IPR005675"
                     /db_xref="InterPro:IPR013709"
                     /translation="MYDTTLRDGTQGEGVSLSAEDKVKIALRLDEMGFQYIEGGWPGS
                     NPKDMEFFQKIQQYSLRNAQVTAFGSTCRPGVEPHEDANINCLLEAGAKIATIFGKCW
                     DFHVTKALNTTLEENLRMVRESVAYLKSKGLMVFFDGEHFFDGYKANADYALSVLKAA
                     VQGGAATVILCDTNGGSMPQEIQRAVTHVVEELPGVELGIHAHNDGEMAVANSIMAVQ
                     AGVSQVQGTVNGLGERCGNANLCSIIPNLALKMGYSTIPAENLVYLTELSRYVYELAN
                     LNPIANQPFVGESAFAHKGGIHVSALMKEPGTYEHMNPEAVGNVRRVLMSELAGISNL
                     LYKYKELHLDKSSPEGRQVLEKLKNMEHGGYQFEAAEGSLELMLRKAMNGYREPFQLE
                     SMRLILEMREENPIHSEAVIKLKVGDQVVHTAAEGNGPVHALDNALRKALETFYPEVA
                     GMRLSDYKVRVLEEKAGTEARVRVLIETGDGKKTWGTVGVSTNIIEASWQALADSMAY
                     GLLKK"
     gene            complement(300964..302193)
                     /locus_tag="Dred_0290"
     CDS             complement(300964..302193)
                     /locus_tag="Dred_0290"
                     /note="KEGG: mta:Moth_2335 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABO48839.1"
                     /translation="MKKIILFCLSLLLLVDFSQAKANGNSDKIDFFKGKVAGKVLFVP
                     LDERPVSLDYVTETIGGTGVEVITPPKELLPNKKIPANTEKLWQWVFENSPQVDYLVL
                     SSDNMVYGGLIPSRIHSLDIQTLTNRVANFSRIKKINPKVKVYIFTTIMRSPREGGNT
                     EEPDYYTTYGSKLFQYSALLDRADMGTLTIEENKRITQLQESIPQTIRSDWFNRRARN
                     LNVTRQLINLNQKNVIDYMVLTRDDCAVYSASHKDFRKLQEVFKGMPQSQFITFPGAD
                     NTLMALLEKEKLLPHLTAYSGWNTCGNSIGYALGQGMLADYMDIPFQKKFLITRYLDD
                     WGYQANIRQAIERELLFPLGYDRNNLGPLEGKVKKEINKRLQTFADNHAFKVKVLEAS
                     LPWHRTFNIKVELEPVK"
     sig_peptide     complement(302119..302193)
                     /locus_tag="Dred_0290"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.999) with cleavage site probability 0.442 at
                     residue 25"
     gene            complement(302579..303820)
                     /locus_tag="Dred_0291"
     CDS             complement(302579..303820)
                     /locus_tag="Dred_0291"
                     /note="PFAM: transposase, IS4 family protein;
                     KEGG: dsy:DSY1678 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase, IS4 family"
                     /protein_id="ABO48840.1"
                     /db_xref="InterPro:IPR002559"
                     /translation="MDKNTNKSTYNQLFQTIYNEKFLSNVKESEVDAYAKKLTVIKLI
                     QMISYAQLEQLKGLRHISNSLNDDNFSSAVGLDSISASQLSRKLRDLSPELTQSLFSD
                     IVHQFGTEIGFKSIRQELGRIYLIDSSTISLCLSRYRWAEFRKTKSGVKLHLRIQLLE
                     QGVLPDKAIIKPAKSADKTQMDALVVEKDALNVFDRGYLDYKRFDNYSNNGTRFVSRL
                     KSNAIVETLEKFPTNQDSLIKKDHKVILGKDGTTKMQNPLRLIETEDTEGKPVIIITN
                     DFELSAEEISDIYRYRWQIELFFKWIKQHFCVKHFYGLSQQAVENQLMIALITYCLMM
                     LLKKKTGYEGPLLKIQMLLHTCLYVDFTKFVRKLHHKSGQSSRGRRCIDHEKVYNITL
                     VQVLQGEAEHLDDLTYDPIIA"
     gene            304238..305062
                     /locus_tag="Dred_0292"
     CDS             304238..305062
                     /locus_tag="Dred_0292"
                     /note="PFAM: protein of unknown function DUF147;
                     KEGG: mta:Moth_2248 protein of unknown function DUF147"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF147"
                     /protein_id="ABO48841.1"
                     /db_xref="InterPro:IPR003390"
                     /translation="MLPQLKALNLEIINLTSIVDILLVTYVFYRFMRVIQGTRAVQLI
                     KGLVILLVGTTVTSWFHLYTLNWLLQQVMTGLVVALPIVFQPELRRALESLGRGKFFA
                     RSMSTLREADRSRMINEVVRSITVLAKNKMGALIIIERVTGLEEYIDTGVKVDGMVSG
                     EFLVNIFIPNTPLHDGAVVIRGDRVAAAACFLPLSENPDLSKELGTRHRAGIGISEVS
                     DALAVIVSEETGNISLAADGVLDRMLDEPTLKQKLTDALEPKISNSLSGVLRRNEE"
     gene            305059..306063
                     /locus_tag="Dred_0293"
     CDS             305059..306063
                     /locus_tag="Dred_0293"
                     /note="PFAM: YbbR family protein;
                     KEGG: mta:Moth_2247 YbbR-like"
                     /codon_start=1
                     /transl_table=11
                     /product="YbbR family protein"
                     /protein_id="ABO48842.1"
                     /db_xref="InterPro:IPR012505"
                     /translation="MIRLKWSNNTMLLLSLLLAIILWLYVNIVHNPGKEQEFRVALDT
                     RGKVAQGLTISSSLPQEVTVRVQGRNIIQLSGVKAQDFQATVDLNNLQEGVNNRIIQV
                     TAPSGLQVVQVNPARVEITADRVIQRQLPVKVVIKGQPQYGYTTLEPVIEPADVLVRG
                     PARLLKNLTSIALNVDVSGATQNIEQVKSVALPAGLESTPERVKLLLPITRSVPYRMV
                     PVLPRYSGNPEDNYQLVRITVEPSSVKVYAPEEILNNLAGIHTETIQLEGLDKDDIRE
                     AKILLPPGVVDIMPGKVEVAIQIKQKQPTTEPSPPKETLPQGKPDTSGEIKQPDTVPE
                     "
     gene            306235..307569
                     /locus_tag="Dred_0294"
     CDS             306235..307569
                     /locus_tag="Dred_0294"
                     /EC_number="5.4.2.10"
                     /note="TIGRFAM: phosphoglucosamine mutase;
                     PFAM: phosphoglucomutase/phosphomannomutase C terminal;
                     phosphoglucomutase/phosphomannomutase alpha/beta/alpha
                     domain I; phosphoglucomutase/phosphomannomutase
                     alpha/beta/alpha domain II;
                     phosphoglucomutase/phosphomannomutase alpha/beta/alpha
                     domain III;
                     KEGG: chy:CHY_2012 phosphoglucosamine mutase"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglucosamine mutase"
                     /protein_id="ABO48843.1"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR005841"
                     /db_xref="InterPro:IPR005843"
                     /db_xref="InterPro:IPR005844"
                     /db_xref="InterPro:IPR005845"
                     /db_xref="InterPro:IPR005846"
                     /db_xref="InterPro:IPR006352"
                     /translation="MAKLFGTDGVRGVANTELTAELAFRLGRAGAHVLTRQGHSKKII
                     IGRDTRISGDMLEAALVAGICSVGVDVYKIGVLPTPGIAYLTRKLGAGAGVVISASHN
                     PVQDNGIKFFGPSGYKLPDELESQIEKLALDDQAELPRPTGGELGRLYYVEDAVDQYV
                     DFAKATISTDLKGLKIVVDCANGAAYAVAPRILSELGAEVIPIFHRPDGVNINAHCGS
                     THPETLMEEVVKQGADLGLAHDGDADRVLAVDHLGNLVDGDQIMVLCAKHLKSKGKLR
                     KNTTVVTVMSNLGLYKALERSGIEVVETKVGDRYVLEKLLETGARFGGEQSGHIIFLQ
                     HNTTGDGIITALQLLAVVKETGMSLAQLAGQMERYPQILKNVQVKDKNYVMNSPIISE
                     AIRRFERDLAGQGRILVRPSGTEPLVRIMVEGKDMAELQSIVDKMAEIVGNI"
     gene            307919..309748
                     /locus_tag="Dred_0295"
     CDS             307919..309748
                     /locus_tag="Dred_0295"
                     /EC_number="2.6.1.16"
                     /note="TIGRFAM: glucosamine--fructose-6-phosphate
                     aminotransferase, isomerizing;
                     PFAM: glutamine amidotransferase, class-II; sugar
                     isomerase (SIS);
                     KEGG: chy:CHY_2010 D-fructose-6-phosphate
                     amidotransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine--fructose-6-phosphate transaminase"
                     /protein_id="ABO48844.1"
                     /db_xref="InterPro:IPR000583"
                     /db_xref="InterPro:IPR001347"
                     /db_xref="InterPro:IPR005855"
                     /translation="MCGVVGYVGNKPATPIIVDGLKKLEYRGYDSSGVAVLDKDGLKV
                     EKKMGRLAELEKALAGREVEATIGIGHTRWATHGRPSDVNAHPHTSNDGKIAVVHNGI
                     IENYLQLREWLSSQGHTFKSETDTEVIPHLIEHFYKGDLIEAVQKTVSHLEGSYAIMA
                     ISVDQPGRIVAVRQDMPLVVGLGEGENLLASDIPALLKHTRKCYLLNDGDVVDLRAEE
                     VIIQDVTGKVVQKDIFEVTWDAEEAEKGGYEHFMLKEINEQPRALRDTLKGRISHAGD
                     KVILDEIKMTPEEVQNIKRVIITACGTAYHAGLVGKYVIEQLVRVPVEVDIASEFRYR
                     DPLVDKDTLVVVVSQSGETADTLAALREARRRGARVVAITNVIASSVAREADDIIYTW
                     AGPEISVASTKAYTTQLVAMYLLALYLAQERNTLAAGNIKEILDDLKSIYAKAQEVLD
                     DIEPIKEFAEKYHKAEDTFFIGRGLDYAVALEGSLKLKEISYIHAEAYAAGELKHGTL
                     ALIVENIPVIALATQQSLFEKMVSNIKEVKARDASVIALAMEGHTEVEKVADQVLYIP
                     KTHPVLAPIITVIPLQLLAYYMAVYRGCDVDKPRNLAKSVTVE"
     gene            309968..311422
                     /locus_tag="Dred_0296"
     CDS             309968..311422
                     /locus_tag="Dred_0296"
                     /note="PFAM: transposase, IS4 family protein;
                     KEGG: sec:SC089 transposase"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase, IS4 family"
                     /protein_id="ABO48845.1"
                     /db_xref="InterPro:IPR002559"
                     /translation="MMVSQFITTNQLETLTRQQRRDLERKYQKKLHSLQRLTSKSDLP
                     ISFDNTSVTAYGNFGILEAFKQAIDFKGMLKGVSLKRHHNCKYSDTGLLDTIIDALSL
                     GLLRFSHMNALQTDPGYQKIKEVTQVPDESTLRNFLSLICEQEALNQLPLVNQEMLSL
                     KAKSDQPREVWLDINDSVLTVFGKQEGSKVGYNPRYHGRPSYKVKVAFISGTCELVNA
                     GLYSGNVASNGQFMEFLKETLEILAAQNILVKGIRIDKGFFDEDNFAYLEEQGIEYIC
                     KAKLTSNMRKVIKYLDDQNQWQSLSNHYAAAEITIPLPKWSKARRFVFIRETQEPKAC
                     GDQLNFDLKTFDYQVIITSSDEHNPEEVWHEYNKRCNIENKIDELKVGLGFEKMSQAE
                     MDRNKAFMWLKVLSYNLLNWFRLALLDGKDSRAEVPTIRRKILNVPGNIVGNNRYRHI
                     KLAPNPWLQKALKNAKEKLQEFLCIQAWVAVSSG"
     gene            311933..312868
                     /locus_tag="Dred_0297"
     CDS             311933..312868
                     /locus_tag="Dred_0297"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABO48846.1"
                     /translation="MITLKVQTYIKLIIKTKYSNLKWRYTIVRKNLFEKIDSKPISYL
                     EEITRIEFLFSKDLVIGSRDLIGRQHRCTIEQYIDAFLFKNWKYRSTYLCIDEVRQDL
                     KITERDLATAPTQEDLLAYFEFVANMLLLIKNRFNYSVFFYLNRDCLDILRENLTEVL
                     EKINYKIVELDFDKIIIVARNENADAVAENFKDIGDKVIEYNRTILHGDIAGKREILL
                     VLGDKFEPLRKTLKGHGFGDLESNIGFLLNSINIRHNNKEGTNKNKFVVSAKPEELEK
                     WYDTTYELLLLAFLAVTYINKKTEIDNLKAIIAKK"
     gene            312994..314625
                     /locus_tag="Dred_0298"
     CDS             312994..314625
                     /locus_tag="Dred_0298"
                     /note="KEGG: cch:Cag_0911 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABO48847.1"
                     /translation="MFCLIKKLNVNEVSLYREIAKNLVNPLEVIREAISNSHDAQANE
                     IRIKIYRNSDNALCIQISDDGKGMSEEDFERFFNLGDSLKKDNNIGQKGLGTKTYFRS
                     KKLLVESQVSDKRYRAILQEPWEKLSSNVLPEYDFEQIAIKPGENGTFITIEDYKIDK
                     PENYFNFDTLMDYILWYTAAGSFKTKFSNQLSLRKYVKNINISPIIFLDDEINHKKEE
                     FIGEHRFSDPNENPEVVLDEEKNPKSCNYCKHFGPFHRETTIAGKFASFQLYGTVSGI
                     NKRREISHFYVGETHKSRFGLYLCKDFIPIINRKDLINDSNYQHYHLLLNSQNFDLTA
                     DRNNISNEDDPIVKWVFEEVDKILSKDVKPIAEAAYFNMRREEDEVYKQKKRADELKN
                     RIEHYNSLENLQIDNLPVVKVPNNEAQVAILFTSLLSKYGDLHFDNIRIGHYSDKSTT
                     DLICLDKDNKPILVELEYKLSNLFYHGHSYNTFDIVVCWMVDLELNSKRQTPDHITLK
                     LVKTEDKWFLKYGPDKTIPIIELKSIVNEINNKNN"
     gene            complement(314991..315770)
                     /locus_tag="Dred_0299"
     CDS             complement(314991..315770)
                     /locus_tag="Dred_0299"
                     /note="PFAM: IstB domain protein ATP-binding protein;
                     SMART: AAA ATPase;
                     KEGG: bfs:BF4071 putative IstB IS21 family transposase
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="IstB domain protein ATP-binding protein"
                     /protein_id="ABO48848.1"
                     /db_xref="InterPro:IPR002611"
                     /db_xref="InterPro:IPR003593"
                     /translation="MSAATRKEWKEAIIEYSKELKLPAIRKYLEEYVQEACQRDACYE
                     EFLAQLLQKECDARREASRYNRIRLAQFTHKKYLEDLSIKDLPEDAQKKLKILKTLDF
                     LREGRNVILAGSPGTGKTHVAIGLGIKACMEGYKVWFTTVPLLISRIKECRAEQTLRA
                     FQNRFEKYDLVIADEMGYISFDKEGSELLFTHLSLRAGRKSTIITTNLSFERWGEIFQ
                     DPVMTAAMIDRLTHQSYIINMNGNSYRMKETKEWLQKQQLA"
     gene            complement(315767..317356)
                     /locus_tag="Dred_0300"
     CDS             complement(315767..317356)
                     /locus_tag="Dred_0300"
                     /note="KEGG: ajs:Ajs_3099 integrase, catalytic region"
                     /codon_start=1
                     /transl_table=11
                     /product="Transposase and inactivated derivatives-like
                     protein"
                     /protein_id="ABO48849.1"
                     /db_xref="InterPro:IPR001584"
                     /translation="MIKLIQKQNILIMYYREGKSQREIARLLGVDRKTVRRYINKYEE
                     KRKELEQSSGLVDPRELIQEIVENPKYSVGNRPKRKVTEDIQSLIKKHLDENEQKRRN
                     GQHKQVKKIIDIYESLVEDNIDISYSSVKRIVRSLEQKAKEAFIKESYIPGDVCEFDW
                     GEVKLTIGGKLQILQMAAFTSAYGNYRYAYLFTKQKTECFQEAHARFFQEVGGVYQTL
                     VYDNMKVAVKRFVGTEKEPTEGLLQLSIYYGFRYRFCNVRRGNEKGHVERSVDVIRRK
                     AFAFRDTFESLDEANRYLLKICNKLNAKPQDTRDGQSALACLEQERANLLTLPPMFDS
                     ARVVNARVDKYATIVVDQNHYSVPDHLVGELVMVKIYSSRICCFYKDAKIAEHARLTG
                     CHEWRLELSHYLETLKKKPGALAGSMALQQADQKIKQIFETYYTKKEKEFIELMQYIK
                     DGTSLSDVEKSITELCKIHPSHVTTDKIKALCAKRRENISEIAIISQVAQDITDQAIQ
                     HLKMYDKLFNTQNLAPKEAIA"
     gene            317712..318155
                     /locus_tag="Dred_0301"
     CDS             317712..318155
                     /locus_tag="Dred_0301"
                     /note="PFAM: transposase IS3/IS911 family protein;
                     KEGG: aeh:Mlg_2330 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS3/IS911 family protein"
                     /protein_id="ABO48850.1"
                     /db_xref="InterPro:IPR002514"
                     /translation="MTRYSDEFKYSIIKRMMPPNNESVKAISKETGLSEGTLHAWKKK
                     ARANGIAVPSGEPEAERWSTQDKFLIVVETASLSEIEMAEYCRSKGLFVEQVEAWRDA
                     CMQANGGIAQQAAQLQKDLRQKDRLNIAIGKSQLCHIFEPLMTSN"
     gene            complement(318207..318965)
                     /locus_tag="Dred_0302"
     CDS             complement(318207..318965)
                     /locus_tag="Dred_0302"
                     /note="PFAM: IstB domain protein ATP-binding protein; IstB
                     ATP binding N-terminal domain protein;
                     KEGG: swo:Swol_0734 ATP binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="IstB domain protein ATP-binding protein"
                     /protein_id="ABO48851.1"
                     /db_xref="InterPro:IPR002611"
                     /db_xref="InterPro:IPR013690"
                     /translation="MEVKTMTNENTISKLNDMRLTAMAETYRKQLHDTDYRELSFEDR
                     FSLLVDVEWSRRKNNKLNLLIKGSQFRYNQACIEDIEYHPDRKLDKAQILRLASGQYI
                     QDHHNIIIMGASGNGKTYLACAFGVAACRQFYKVRYVRLPDLLDELTIARGEGIFQKV
                     IKQYKKVNLLILDEWLLTPLKGSEARDLLEIVESRHQTGSTIFCSQFDPRGWHEKIGE
                     VTLADSILDRIVHDSYTILIDGEISMRERHGLEK"
     gene            complement(318943..320502)
                     /locus_tag="Dred_0303"
     CDS             complement(318943..320502)
                     /locus_tag="Dred_0303"
                     /note="PFAM: Integrase, catalytic region;
                     KEGG: shw:Sputw3181_1114 integrase, catalytic region"
                     /codon_start=1
                     /transl_table=11
                     /product="Integrase, catalytic region"
                     /protein_id="ABO48852.1"
                     /db_xref="InterPro:IPR001584"
                     /translation="MIKYREILRLHAQGLSMRGIAASCSNSRNTVSEVLKRAESQGIS
                     WPFEKDMSDGQLQDVLFPEKNVSLTFRRRPDCEYIHKEMAKSGVTLSLLWDEYCQNCR
                     QNHKIPYSYRQFCRFYHDYANTTKATMRIKRKPGELMEVDWAGQTMSIKDNITGEDIT
                     AYVFVAALPCSQYAYVEAFLSMETESWITAHIHAFKFFGGVTRMIVPDNLKTGVEKSS
                     QTDPIINRTYQEMAEHYNTSIMPARVRHPKDKPSAEGTVGIISTWIIASLRNQQFFSI
                     KELNEAIHKKLTEYNTKSFQKKPGNRLSAFTEEEKFALIPLPASPYELATWKKATVQY
                     DYHISVDKIYYSVPYEYIKQLVDVRITKNVVEIFFKHFRIASHKRLSGKVGQASTIPE
                     HMPDNHKKYIEFNQDSILEWASKVGSHTLTTVKSILASYKTEKQGLKSCLALMKLADK
                     HSVERIEAACKRALDYTPRPTLKSIQTILKTGQDKLSEVNPTVDNTTKKTASSYGFTR
                     GAAYYGGKNND"
     gene            320636..320776
                     /locus_tag="Dred_0304"
     CDS             320636..320776
                     /locus_tag="Dred_0304"
                     /note="KEGG: aeh:Mlg_2336 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABO48853.1"
                     /translation="MLSLFNRELKDLQKELKRKEAALAETAALLVLRKKAQAIWGDPE
                     DE"
     gene            320773..321588
                     /locus_tag="Dred_0305"
     CDS             320773..321588
                     /locus_tag="Dred_0305"
                     /note="PFAM: Integrase, catalytic region;
                     KEGG: dsy:DSY4578 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Integrase, catalytic region"
                     /protein_id="ABO48854.1"
                     /db_xref="InterPro:IPR001584"
                     /translation="MISVSDRKKAISLIKEAVANGAREPEACKVLGITQRTLQRWRSS
                     LTPIEDQRKNAKRPEPANKLSIDERQAIIETANQPEFKSLPPSQIVPRLADQGIYLAS
                     ESTFYRVLKENNMQHHRGRAKKPCAKPISTHCATSPNQVWMWDITWLPGPAKGIFFYL
                     YLILDLFSRKIVAWDIWTEESSENASILVRRAIMSEKRTLANEPLVLHSDNGSPMKGA
                     TLLETLYQLGITPSKSRPRVSNDNPYAESIFRTCKYRPNYPAKGFDTLTEARE"
     gene            321589..321807
                     /locus_tag="Dred_0306"
                     /pseudo
     gene            complement(322287..322688)
                     /locus_tag="Dred_0307"
     CDS             complement(322287..322688)
                     /locus_tag="Dred_0307"
                     /note="PFAM: pyridoxamine 5'-phosphate oxidase-related,
                     FMN-binding;
                     KEGG: gme:Gmet_2130 pyridoxamine 5'-phosphate
                     oxidase-related, FMN-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxamine 5'-phosphate oxidase-related,
                     FMN-binding protein"
                     /protein_id="ABO48855.1"
                     /db_xref="InterPro:IPR011576"
                     /translation="MQEVVRFLNENSTGFLATAEEGKPKVRPFQFMLEDDGKLYFCTA
                     NTKDVFKQLKVNPFVEFSASTPQFAWIRLSGEVKFSNDLGIKEKILERSALVKSIYQT
                     ADNPVFEAFYIEHGTAVIADFSGQPPKVVEF"
     gene            complement(322805..323239)
                     /locus_tag="Dred_0308"
     CDS             complement(322805..323239)
                     /locus_tag="Dred_0308"
                     /note="PFAM: regulatory protein, MarR;
                     KEGG: dsy:DSY3632 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, MarR family"
                     /protein_id="ABO48856.1"
                     /db_xref="InterPro:IPR000835"
                     /translation="MRKGNALSIISRIREKATKLIIRELESHGVEGIVPSHGDILVIL
                     FHGEKFTMKELAAKIHRTKPTVTVLIEKLVQYGFVEKEKSHTDSRVTYIKLTKKGFEL
                     KPIFDDISAKLNGILYGDLTEEESEALERLLNDVNSRFDAQK"
     gene            323929..324441
                     /locus_tag="Dred_0309"
     CDS             323929..324441
                     /locus_tag="Dred_0309"
                     /note="KEGG: tte:TTE1725 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABO48857.1"
                     /translation="MMVSQLITTNQLETMSRQQRRNLERKYQKKLNSLQHQTSKSDLP
                     LRFDNSSVTAYGSFGILEAFKKAVDLPGMLKRVSLKRHHNCKYSDTELLDTIIDALSL
                     GLLRFSHMNALQTDPGYQKIKEVTQVPDESTLRNFVSLICEQEALDQLSLVNQELLSL
                     KAKCDQSREV"
     gene            324622..325383
                     /locus_tag="Dred_0310"
     CDS             324622..325383
                     /locus_tag="Dred_0310"
                     /note="KEGG: sec:SC089 transposase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABO48858.1"
                     /translation="MEFLKETLEILANQNILVKGIRMDKGFFDEDNFAYLEEQGIEYI
                     CKAKLTSNMKKVIKYLDDQERWQPLSNHYAAAEITLPLPKWSKARRFVFIRETQEPKV
                     SGEQLNFDLKTFDYQVIITSSDEYNPEEVWHQYNKRCNIENKIDELKVGLGFEKMSQA
                     ELDRNIAFMWLKVLSYNILNWFRLVLLDGKDSRAEVPTIRRKILNVPGNIVGNDRYRH
                     IKLAPNPWLQKVLKNAKEKLQEFLCTQAWVAVSSG"
     gene            complement(325566..326975)
                     /locus_tag="Dred_0311"
     CDS             complement(325566..326975)
                     /locus_tag="Dred_0311"
                     /note="PFAM: transposase, IS4 family protein;
                     KEGG: mgm:Mmc1_3053 transposase, IS4 family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase, IS4 family"
                     /protein_id="ABO48859.1"
                     /db_xref="InterPro:IPR002559"
                     /translation="MKKIRNKKIKTKNRDDDRLTIFEIEQGDKELTTHSGLALIGALL
                     TNTKIKTRLNNTMSAEQKKPHISNGSVGIAYIGLLCQGKSDFDHIEPFREDNFFAISL
                     NIKETPSSPTLRQRLDMVAKDKQWNNILLEESAGLIKKTNAPLTPVYLGLENRTYLPL
                     DIDVSPFDNSNTKKEGVSRTYKGTDGYAPIFAYLAKEGYCVNTELRQGSEHCQKNTSE
                     FVAESIRYARKITQLPLLLRMDSGNDSASNIEICLNDDTKADFIIKRNLRKETPEGWL
                     LLAKNNKDIYCQEREGKKVYYGSMMKYKKELKREIRVVYKITERTFGKDGQIFLVPQV
                     EAETYWTSLPDPPHVIERLYHEHGTSEQFHSELKTDLDLERLPSGKFDTNNLILHFGV
                     VAYNLLRMIGQSTTRMQHVPLRKQAERRRIRTVIQNLITLASRLVSHARKKKLRFGKH
                     SPWFETFNLKSESSFPSLT"
     gene            327164..327610
                     /locus_tag="Dred_0312"
     CDS             327164..327610
                     /locus_tag="Dred_0312"
                     /note="KEGG: lin:lin0441 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABO48860.1"
                     /translation="MKDISPSIFTNSVIYFFIGLTVLLGINFFDYRRLKVYGFNLYAG
                     TIFIWLMLLGLGKTFINGKPYLNLGFININYIDVTPVLLTIAVAGIFLNKDWAKPNWF
                     VSTVFLLIVPNILYIGSSSVASAIIYTVVYLILMVLSGARKNSMLA"
     gene            327628..328161
                     /locus_tag="Dred_0313"
     CDS             327628..328161
                     /locus_tag="Dred_0313"
                     /note="KEGG: chy:CHY_0358 peptidoglycan biosynthesis
                     protein, FtsW/RodA/SpoVE family"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidoglycan biosynthesis protein,
                     FtsW/RodA/SpoVE family"
                     /protein_id="ABO48861.1"
                     /translation="MFVFALFQESYRLNRLLTFINPHNDPMGSGYIYIQSIEAIKSAG
                     LWGQGFTFSGNLPEIHTDLIFSYMVYTFGWVAGAIVIMLALALIAIMTGVFRQIKDKF
                     GKLLVAGLTSILGLHFLCNILMTVGFAPISGISLPFFSYGGSQTVINMAMMGVVLSIY
                     RRKNLVTNPIQINKHQL"
     gene            328528..329328
                     /locus_tag="Dred_0314"
     CDS             328528..329328
                     /locus_tag="Dred_0314"
                     /note="KEGG: mta:Moth_2002 biotin/lipoyl attachment"
                     /codon_start=1
                     /transl_table=11
                     /product="biotin/lipoyl attachment"
                     /protein_id="ABO48862.1"
                     /translation="MNRLIVIKGAGDLATGIAHRLHCSGFSVVTTELPQPTVIRRTVS
                     FAEAIYTGTVVVEGITAVKTSMERTLQVVEEGKIPVVVDPTGVMIKQLQPWAVVDAIL
                     AKRNVGTQITDAPIVVGVGPGFTAGVDVHAVVESMRGHYLGRVIHAGQAIPNTGIPGE
                     LGGYAKERILRAPCAGVFRAERQISDLVSAGETVAWVNEQPVVVAISGVLRGLLKEGL
                     SVEPDMKIGDVDPRCQPEHCFTISDKARSIGGGVLEALLYYAARAHQG"
     gene            329303..330112
                     /locus_tag="Dred_0315"
     CDS             329303..330112
                     /locus_tag="Dred_0315"
                     /note="KEGG: mta:Moth_2006 xanthine dehydrogenase
                     accessory factor"
                     /codon_start=1
                     /transl_table=11
                     /product="predicted sulfurylase large subunit,
                     molybdopterin cytosine dinucleotide biosynthesis"
                     /protein_id="ABO48863.1"
                     /translation="MPPGHIKDRGDKMTLFKRLLAATERGEAVQMVTLVGVPEDNASS
                     LGQMLLLFPDGRVEGALLNAAFTEKVLEIQQRQWERPKVLSITHDQQEYRVFWNSLVN
                     KMRAVILGGGHISQPLALFLSQLDYEVTVIDDRPEFANRQRFPKADRIICEDFDKALE
                     HITFDDNTAVIIVTRGHRYDLACLRSIAGKKAGYIGMIGSFRRVKAVLQLLKEEGVST
                     QWLNALKTPIGLDLGAQSPAEIALSIVAEMVAQFKGGRYLPLSILGGRQNG"
     gene            330105..330434
                     /locus_tag="Dred_0316"
     CDS             330105..330434
                     /locus_tag="Dred_0316"
                     /note="PFAM: protein of unknown function DUF182;
                     KEGG: swo:Swol_1138 xanthine and CO dehydrogenases
                     maturation factor XdhC/CoxF family-like protein"
                     /codon_start=1
                     /transl_table=11
                     /product="predicted sulfurylase small subunit,
                     molybdopterin cytosine dinucleotide biosynthesis"
                     /protein_id="ABO48864.1"
                     /db_xref="InterPro:IPR003777"
                     /translation="MDRLILQRVCELQAKGEPFALITILSTKGSTPRKAGAVMLMERI
                     GRTVGTIGGGCGEAEVKQRALLAMDEQTSCIHRVNMVNDVAAEEGMVCGGSMEVFIQV
                     FAGFPCQ"
     gene            330693..330947
                     /locus_tag="Dred_0317"
     CDS             330693..330947
                     /locus_tag="Dred_0317"
                     /note="TIGRFAM: putative endoribonuclease L-PSP;
                     PFAM: Endoribonuclease L-PSP;
                     KEGG: bha:BH0063 translation initiation inhibitor"
                     /codon_start=1
                     /transl_table=11
                     /product="putative endoribonuclease L-PSP"
                     /protein_id="ABO48865.1"
                     /db_xref="InterPro:IPR006056"
                     /db_xref="InterPro:IPR006175"
                     /translation="MVEGGVEAQTKQVLENLTAILNNQGLGLDAVVKTSVFIKDMNDF
                     QKINAVYGEYFKSEAPARACVEVARLPKDVLVEIEAIAVV"
     gene            331998..332687
                     /locus_tag="Dred_0318"
     CDS             331998..332687
                     /locus_tag="Dred_0318"
                     /note="PFAM: ABC transporter related;
                     SMART: AAA ATPase;
                     KEGG: fnu:FN0827 ABC transporter ATP-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter related protein"
                     /protein_id="ABO48866.1"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /translation="MKHNVNCVIDANNLIKIYQNGSEELKVLDDVSIQVYRGDFMVIL
                     GPSGSGKSTLMNILGCLDLPTSGQYTLDGLNVLEASDNELAEIRNKKIGFIFQKFNLL
                     PRLTALQNVMLPLLYRGVKEEEALEAAKEKLTILGLGARLFHRPNELSGGQQQRVAIA
                     RAIVGNPQLLLADEPTGNLDSKSSEDAIRIFKELNQQGNTIVIITHDVEVAQQVKKIV
                     YIRDGKLYENH"
     gene            332674..333927
                     /locus_tag="Dred_0319"
     CDS             332674..333927
                     /locus_tag="Dred_0319"
                     /note="TIGRFAM: efflux transporter, RND family, MFP
                     subunit;
                     PFAM: secretion protein HlyD family protein;
                     KEGG: bmb:BruAb1_1658 HlyD family secretion protein"
                     /codon_start=1
                     /transl_table=11
                     /product="efflux transporter, RND family, MFP subunit"
                     /protein_id="ABO48867.1"
                     /db_xref="InterPro:IPR003997"
                     /db_xref="InterPro:IPR006143"
                     /translation="MKIIRDWGLKEFIKQKSKKSLGIALIVAIALTGGTTYWLQRQSA
                     DKSSEPQYEQAQVKKEDIIVGLDSDGTIDFSKVKLRFGVRGTIAEILVAEGDEIQKGQ
                     IIARLDDRDYQDQYQLALAKLQDAQDDDTISLLDSELKIKSMEADLEKLRDEYKEMET
                     ISDAYSTNELKMKKLELDNKEMEYQNLLKKYQLDKSKGLDQNELQVKMAKEDLEDTIV
                     YAPVSGVLLNLANKAGESLTDEDDFATIHENKTIKAITKVIEYDIGQIKVGQKVYVNV
                     EALPDKKFTGVVSKINALPEEDSSGLVNYSVEMTIKDPGPELKDGMTCSVSFVLKEVA
                     DCLTVPYKAVKMVNGKQMVTVVDEKGQQVERQIKTGFTDGTSVEVLEGLKNGETVIYA
                     KPITTKTNATQQKTNSTSQTKRVIF"
     gene            333924..335111
                     /locus_tag="Dred_0320"
     CDS             333924..335111
                     /locus_tag="Dred_0320"
                     /note="PFAM: protein of unknown function DUF214;
                     KEGG: ppd:Ppro_3235 protein of unknown function DUF214"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF214"
                     /protein_id="ABO48868.1"
                     /db_xref="InterPro:IPR003838"
                     /translation="MKLKQLLKMIFSNITQNKVRTFLTTLGVIVGTATIFLVVAIGKG
                     AEAQVNQQYSKLNVGTIIVMPATRGKVADPLTKKDAQLFLESENITQAFPMLRGNGDI
                     NYNNYSTSGSFMAIQPAFQGSNNLTIEQGRAFEEEDEQKRNKCVVIGAELANTLTENN
                     PSELLGQSVSINNRKFEVIGIYNRVGDSGSGMSYDDAAFVPYSAGERFLLGTRANPTI
                     NVQAKDIDSVQSAIEDITNILNDNHRAGGADQFRIMDAGSRLAAAQESAKSMSLLLLA
                     VAAVVLVVSGIGIMNVMFVTVRERTREIGTLKAIGAKKQEILNQFLIEAVIISLAGGI
                     IGVIMGFLALPVLRYFGQNVIASVNGVLFGLVFSVVTGVFFGFYPAWKAADLSPLEAL
                     RYE"
     sig_peptide     333924..334067
                     /locus_tag="Dred_0320"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.930 at
                     residue 48"
     gene            335123..336268
                     /locus_tag="Dred_0321"
     CDS             335123..336268
                     /locus_tag="Dred_0321"
                     /note="KEGG: tbr:Tb927.8.4950 kinesin"
                     /codon_start=1
                     /transl_table=11
                     /product="Outer membrane protein-like protein"
                     /protein_id="ABO48869.1"
                     /translation="MNKKLILILSILLALGSFSTSYAAEEPTATETIITLEEAKAKAY
                     DNSRSLKKYEISVDKAKYQKQQTEYDYNNTLNEYNSLGSSLESNDYSESILEKMQQQY
                     EKIESSSESVNDSENNYTDAQKEKENYRKQLDYIVEELYTNILSQEDSLQSLNKEYEL
                     KQYSLNMERKKLQMGSSSQAEVDQLAAEVIKLNRSILEQRSQIKINKGQLNDMMGRGY
                     DEALQLTSFEVSVKVNIPEYDQLLSSATQSYYTLSQLKRDLDDLDDDLDDEDDYYQSL
                     IIRQNIKEKELQVEDEKITISEKVNNLVANVRSKQESYQLAITNYITAQQSYEWAKKR
                     FELGQISKLTLLQSELDYLTAKNTKAANGYALQLAQQSLMLAQEGIV"
     sig_peptide     335123..335194
                     /locus_tag="Dred_0321"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.997 at
                     residue 24"
     gene            336431..336982
                     /locus_tag="Dred_0322"
     CDS             336431..336982
                     /locus_tag="Dred_0322"
                     /note="KEGG: mta:Moth_1011 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, Fis family"
                     /protein_id="ABO48870.1"
                     /db_xref="InterPro:IPR002197"
                     /translation="MLKISKKIVGLAIGGMFLAGSIAGNAFADSDTKNELDQKREQYY
                     QKFVADFATNLGVSQDQVTAALKATKKQMVQAEVQQGKITQAQADKILEQKEIGFSFG
                     FGMGGPRHDRGDLTQNTNFLNDAASALGITADELKSELQSGKKLDQVITDQGMTMEQF
                     RQKMPQPKFNKKDAATKNISNQS"
     sig_peptide     336431..336517
                     /locus_tag="Dred_0322"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 1.000 at
                     residue 29"
     gene            337349..338032
                     /locus_tag="Dred_0323"
     CDS             337349..338032
                     /locus_tag="Dred_0323"
                     /note="PFAM: response regulator receiver; transcriptional
                     regulator domain protein;
                     KEGG: dsy:DSY4317 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="two component transcriptional regulator, winged
                     helix family"
                     /protein_id="ABO48871.1"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR001867"
                     /translation="MKQLKGIRILLVDDESNILQFLEIGLQNEGFEVQTAQDGMSAIT
                     LMKQFQPHVVILDVMMPGMDGFEVCRMLKKTENVAVIMLTARDEVDDRVKGLNLGADD
                     YMVKPFSFEELLARIYARIRNQFPNLFGKVVVGPFQIDDRRKEIQFENRVLELSHTEY
                     ELLKFLVLNHGLVLSKTMILDKVWGYDFGGEENIVEVYIRSLRDKLNDKNHQIIRTLR
                     RSGYRVDLS"
     gene            338029..339471
                     /locus_tag="Dred_0324"
     CDS             338029..339471
                     /locus_tag="Dred_0324"
                     /note="PFAM: ATP-binding region, ATPase domain protein
                     domain protein; histidine kinase, HAMP region domain
                     protein; histidine kinase A domain protein domain protein;
                     KEGG: dsy:DSY4316 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="integral membrane sensor signal transduction
                     histidine kinase"
                     /protein_id="ABO48872.1"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR006162"
                     /db_xref="InterPro:IPR008358"
                     /translation="MKNKKTSWFKICAPNSLRIQLLSRSLLILAVLLGLIGLLQYVFM
                     QEVIYRNKAASLQSQVMSISRHFWQDFSLESEKNRSPRFFIPEADLAFVDTAGNYFVL
                     SERHGNIRPPQLNIQEYLASFEGRPRLNYKIIKDDSGVEQLVVLQRVFDHGKVLGVVQ
                     INTMTGPLKELLFRQLFTFLFLSLIALLMGLLSFSPIIKRTLVPLFNMVDTAEQIDAG
                     NLTKRFPTQQGQMEIDRLADSFNGMLDRLEASFEAERETKEQMRRFIGDASHELRTPL
                     TSIHGFLEVLLRGAANQPDQLNKALKSMYGESERMNKLVHDLLLLTKLDHAPRLEVKE
                     GFLDTVIQEMEPQLCILAGNRRLQLMVDSNIECKFDTDKMKQVILNLFHNAVQHTDPE
                     KGEIKISLYKRTDGVQLSVEDNGPGIKDFHLPKVFDRFYRIDASRTRRHGGAGLGLAI
                     TKAIIDAHGGTINVESLEGTGSTFHIWLPA"
     gene            339628..340080
                     /locus_tag="Dred_0325"
     CDS             339628..340080
                     /locus_tag="Dred_0325"
                     /note="PFAM: regulatory protein, MarR;
                     KEGG: btl:BALH_0603 transcriptional regulator, MarR
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, MarR family"
                     /protein_id="ABO48873.1"
                     /db_xref="InterPro:IPR000835"
                     /translation="MTDKNMKEYAKRIETAFSKIMKKLGPEMSKLAEGLTPPQFFVLK
                     LLQTNGRTVTEIAELMNVQPSAITAILDRMYRNGFIIRERNETDRRVVLVQITEKGKE
                     AFVKSQQKRQDVMLHFLSYLEKEDLDALLAIYEKMAKIVERHSNKTSS"
     gene            340153..341772
                     /locus_tag="Dred_0326"
     CDS             340153..341772
                     /locus_tag="Dred_0326"
                     /note="TIGRFAM: drug resistance transporter, EmrB/QacA
                     subfamily;
                     PFAM: major facilitator superfamily MFS_1;
                     KEGG: chy:CHY_0814 drug resistance transporter, EmrB/QacA
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="drug resistance transporter, EmrB/QacA
                     subfamily"
                     /protein_id="ABO48874.1"
                     /db_xref="InterPro:IPR001411"
                     /db_xref="InterPro:IPR001958"
                     /db_xref="InterPro:IPR004638"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR007114"
                     /db_xref="InterPro:IPR011701"
                     /translation="MNTDSRRNILLIGLILGMFFSALDQTIVGTAMPRIIGELGGLEI
                     LTWVTTAYMLSSTTIVPIAGKLADLFGRRILYVTGIFIFMLGSALCGTSQNMTELIIF
                     RGLQGLGGGIMMPMAMTIVGDIFPPEKRGKWQGLMGALFGFSSIIGPTIGGWFVDYAS
                     WRWVFYVNLPVGILAAVTIYIGLQGEKRLKDKVVIDYWGVATLVIGIVSLLLGLSLGG
                     KDYPWSSWQIIGLLSTAFVFLFTFIFIEKRAVEPILSLDLFSNKVFLVTNIIGFLMGL
                     GMFGTMMFLPLFLQGVVGVSATSSGNTMIPMMLAMMITSMLAGQLISRVSFRTLFATG
                     MAIMTVGFYLLSTMTVHTTQWEAIANIIVLGIGMGLVMPILTIAVQQAFPAEQRGVAT
                     SATTFFRSIGGTLGMTVLGLVMNHQSVELLKKDFFPVVQKIPGLQSGPFSGMLTKAES
                     DPQGLFNALLSPETLSKIPVQLQEIILPPLKIALSDSLHLVFLVAMGITMLGIIVSLF
                     MGNERVVGTKEKVLDITGGLKNASESALHET"
     sig_peptide     340153..340242
                     /locus_tag="Dred_0326"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.937) with cleavage site probability 0.361 at
                     residue 30"
     gene            complement(341879..342127)
                     /locus_tag="Dred_0327"
     CDS             complement(341879..342127)
                     /locus_tag="Dred_0327"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABO48875.1"
                     /translation="MKSNLQEYNERLRRIEEQKSAGKIKLWHLMNHEERISVMRLLYI
                     KENLLEEDIAHLLETEPTELQKFRRRQGTLFFQKPHPE"
     gene            complement(342698..343153)
                     /locus_tag="Dred_0328"
     CDS             complement(342698..343153)
                     /locus_tag="Dred_0328"
                     /note="PFAM: protein of unknown function DUF6,
                     transmembrane;
                     KEGG: mmp:MMP0210 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF6, transmembrane"
                     /protein_id="ABO48876.1"
                     /db_xref="InterPro:IPR000620"
                     /translation="MSAKRVYILMVLAALFWSGAFITGKLAVREFPPFALTFFRFSFA
                     LPFVLWEKPLTYLPNATTEGWLAILYMAVFASVLGYLFQLIAIQNIGAPKAAIFINLV
                     PVFTIMQSLLFLGEPFSWFKMLSACIIVTGVYLTTRPESGVKEAAGIKA"
     gene            343485..343817
                     /locus_tag="Dred_0329"
     CDS             343485..343817
                     /locus_tag="Dred_0329"
                     /note="KEGG: gka:GK1922 D-serine dehydratase"
                     /codon_start=1
                     /transl_table=11
                     /product="D-serine dehydratase"
                     /protein_id="ABO48877.1"
                     /translation="MRGWWRTGGCNLWFKTSGVYTVDDDELYLLLSSLIDTEDIRLEP
                     SALAGVAGPVRLFKEPAGQKYLEANNLKHKTSNATHIAWATGGSMVPAEVMASYYKKG
                     LNIPVTRK"
     gene            complement(343886..345508)
                     /locus_tag="Dred_0330"
     CDS             complement(343886..345508)
                     /locus_tag="Dred_0330"
                     /EC_number="2.7.3.9"
                     /note="KEGG: tte:TTE2334 phosphoenolpyruvate-protein
                     kinase (PTS system EI component in bacteria);
                     TIGRFAM: phosphoenolpyruvate-protein phosphotransferase;
                     PFAM: PEP-utilizing enzyme; PEP-utilising enzyme, mobile
                     region; PEP-utilising enzyme domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoenolpyruvate--protein phosphotransferase"
                     /protein_id="ABO48878.1"
                     /db_xref="InterPro:IPR000121"
                     /db_xref="InterPro:IPR006318"
                     /db_xref="InterPro:IPR008279"
                     /db_xref="InterPro:IPR008731"
                     /translation="MLRGIGVSTGLGIAKAVIYQKEDLIIPKVKLVENDLEAEVKKFE
                     QAQASAKQELLQIKERVSQTAGKEKADIIEAQIMFLEDPTVVSEIINIIKAGNNAAYA
                     VNQAVEAQARMLESLPVPEMQERAVDMRDMGHRLINILLDRNEVSLAELTEQTVLIAH
                     DLTPSDTAQLSRERVAAIVTEVGSGTSHTAILARSLGIPAVVGIPGIVEQVSSGVLVA
                     VDGSTGEVFIDPDQVKLGSLKQKLEQFVAEQRDLQGLVNEKAVTANGIPVRLAANIGK
                     LSDIIEAQKVGVKEIGLFRTEFLYMDRNSLPTEEEQYQSYKQVVEAFPHRVIIRTLDI
                     GGDKELPYLKLAKELNPFLGKRAIRLALTEKGLFKTQLRAILRASRHGNIGIMFPMIA
                     TLEELQAAKELLAAAKAELVAEGVELANPVEVGMMMETPAAALAADIFAKEVDFFSIG
                     TNDLIQYTMAADRMNEQVAYLYQPTHPAICRLLEGIVQAGHNAGIWVGMCGEMAGNPE
                     YTEHLLKMGLDELSMTRGAVLRVKQKIRQISL"
     gene            complement(345524..345787)
                     /locus_tag="Dred_0331"
     CDS             complement(345524..345787)
                     /locus_tag="Dred_0331"
                     /note="TIGRFAM: phosphocarrier, HPr family;
                     PFAM: phosphocarrier HPr protein;
                     KEGG: oih:OB2344 PTS system, histidine-containing
                     phosphocarrier protein (HPr protein)"
                     /codon_start=1
                     /transl_table=11
                     /product="Phosphotransferase system, phosphocarrier
                     protein HPr"
                     /protein_id="ABO48879.1"
                     /db_xref="InterPro:IPR000032"
                     /db_xref="InterPro:IPR001020"
                     /db_xref="InterPro:IPR002114"
                     /db_xref="InterPro:IPR005698"
                     /translation="MIKQVVTIVNPTGIHARPAAHIAKLAAQFDAAIKLAYKGKEIDA
                     KSIIGVMSLAAQAGEELLVSAEGNQAEAAVNALANLLSKPFTE"
     gene            complement(345821..347689)
                     /locus_tag="Dred_0332"
     CDS             complement(345821..347689)
                     /locus_tag="Dred_0332"
                     /note="TIGRFAM: PTS system, glucose subfamily, IIA
                     subunit; PTS system, glucose-like IIB subunint;
                     PFAM: sugar-specific permease, EIIA 1 domain;
                     phosphotransferase system PTS, EIIB protein;
                     phosphotransferase system, EIIC;
                     KEGG: cno:NT01CX_0332 PTS enzyme II, ABC component; TC
                     4.A.1.1.6; TC 4.A.1.1.6; TC 4.A.1.1.6"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system D-glucosamine-specific IIB component,
                     Glc family / PTS system D-glucosamine-specific IIC
                     component, Glc family / PTS system D-glucosamine-specific
                     IIA component, Glc family"
                     /protein_id="ABO48880.1"
                     /db_xref="InterPro:IPR001127"
                     /db_xref="InterPro:IPR001996"
                     /db_xref="InterPro:IPR003352"
                     /db_xref="InterPro:IPR011535"
                     /db_xref="InterPro:IPR013013"
                     /translation="MKKAFKYLQMVGQSLMLPVSVLPAAGLLLRFGEKDLLNMPAMKE
                     AGLAIFANLPLIFAVGVAIGFSGGQSVAALAAVVGQLILLAVLKAVDPSINMGVFSGI
                     IMGITAALLYKRFYQIKLPQYLGFFAGKRFVPIITAVAGVVIALISAVVWPSIQNVID
                     AVGQVAVSSSFGPALFAAGKRLLIPVGLHHVYYPSFLYEFGQYVTAAGEIVKGDFNRY
                     FAGDPTAGTFMASEFPIMMFGLPAAAFAIYRNARPERKKAIAGLMASAAFTSFLTGIT
                     EPIEFSFIFVAPVLFVFHVLMAGVSGFVTNLLDIHLGFTFSASFIDYLLSYKYGHNQL
                     LLWPVGLVVGGLYFVVFNTAIKMLNLKTPGREDEITAVENQGTGSDLAHKVLDALGGA
                     NNIEILDACITRLRVTVKDPDMVKKDVFKALGASGVMEMGKNLQIIFGTQSDSLKEEI
                     RSLMTNTVSATAEGAKPLPELNVSASKTMIKAPASGKVIPLEQVPDETFKQKLLGNGV
                     AIEPVEGTFIAPVAGTVVQVFPTNHALTIKTENGIEILLHVGINTVSLKGQGFKALVS
                     EGQKVTVGQKLLEVDLKQIEKAGLSTITPVIIIGSEDMEITPANEVTSGEDTILQI"
     gene            complement(347939..348787)
                     /locus_tag="Dred_0333"
     CDS             complement(347939..348787)
                     /locus_tag="Dred_0333"
                     /note="PFAM: CAT RNA-binding domain protein; PRD domain
                     protein;
                     KEGG: bld:BLi01597 transcriptional antiterminator
                     essential for the expression of the ptsGHI operon;
                     RBL02128"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional antiterminator, BglG family"
                     /protein_id="ABO48881.1"
                     /db_xref="InterPro:IPR004341"
                     /db_xref="InterPro:IPR011608"
                     /translation="MQTPHGPFTIQRVLSNNAVIAHTPKGQDVILLGKGMGFGRKSGD
                     ILSNPKYEKIYVVPEGVTDQKALALMEQVDPAVINVTQNIIELAKAQLGEGLHPRVHV
                     ALADHINFTLIRLAQGMEIKNPFLAEIEAMYPKEFSIAKQGAVLILEKMNIFIPPEEI
                     GFIALHLHSARHNRHVSQSLKHAEVINRAVKYIESQFGPIKEHGGLEYTRLLSHLQSC
                     IHRLVNKTTIENPFLDKLKQEFSNSYEIARQMSNILEEGLGIPVPEDEIGYLAMHIER
                     IRRNKT"
     gene            349131..349469
                     /locus_tag="Dred_0334"
     CDS             349131..349469
                     /locus_tag="Dred_0334"
                     /note="KEGG: sma:SAV7387 tellurium resistance protein"
                     /codon_start=1
                     /transl_table=11
                     /product="tellurium resistance protein"
                     /protein_id="ABO48882.1"
                     /translation="MSINLIKGQKIDLYKMKPGVRSISMGITLCGPINNFFVTAILTG
                     SSGKVEDTKNFIFYDNLSNHDGSVLMTKDTPPQVNVHLDRVPLGLTELIHMLKIGRKM
                     NSKKTRCHLE"
     gene            349506..350015
                     /locus_tag="Dred_0335"
     CDS             349506..350015
                     /locus_tag="Dred_0335"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABO48883.1"
                     /translation="MDENIFIRILTMCFYYLSSPEDKNYLVNRMNPFLSKKRIQGSLT
                     LNTLAKEAPLFSSAQKLLLMTYSHMYILLRDRNLLEDTSLKQIRQIFSVSEDFVAFYM
                     RSMRRAHYRQWIHEDNLLECILNPCEDFRKWAEDTTFGAIQEGCRGYPEGTVLLAWRR
                     NTAKGTGIL"
     gene            350740..351312
                     /locus_tag="Dred_0336"
     CDS             350740..351312
                     /locus_tag="Dred_0336"
                     /note="PFAM: stress protein;
                     KEGG: ctc:CTC02234 tellurium resistance protein terD"
                     /codon_start=1
                     /transl_table=11
                     /product="stress protein"
                     /protein_id="ABO48884.1"
                     /db_xref="InterPro:IPR000223"
                     /db_xref="InterPro:IPR003325"
                     /translation="MAVNLQKGQKVDLTKGRSNLSKVVVGLGWDTNKFDGPDFDLDAS
                     AFLLGENGKCASADDFVFYNNLKHVSGSVMHMGDNLTGDGDGDDEQITIDLSKVPAHI
                     HKIAITVTIHMAKERNQNFGLVSNAFVRVVDDSNGSELLRYDLSEDYSIETALVFAEL
                     YRHGSEWKFAAVGQGFNEGLQGLVNLYGLA"
     gene            351329..351931
                     /locus_tag="Dred_0337"
     CDS             351329..351931
                     /locus_tag="Dred_0337"
                     /note="PFAM: stress protein;
                     KEGG: bld:BLi00354 YceC"
                     /codon_start=1
                     /transl_table=11
                     /product="stress protein"
                     /protein_id="ABO48885.1"
                     /db_xref="InterPro:IPR003325"
                     /translation="MINLQKGQKIDLTKTNPNLSKIMVGLGWDPVKSGGGGFLGGLFG
                     GGSPNIDCDASVYLLNANGKLAKDKNLVYFGNKTSPCASVRHAGDNVTGQGDGDDEQI
                     FIDLTQVPADVHRLVFVVNIYDCVARKQHFGMIQNAFIRVVNSANGQELCKFNLSEGY
                     EGKTSLITGEVYRHNGEWKFAAIGEATTDPGLKSLTQRYL"
     gene            351961..352539
                     /locus_tag="Dred_0338"
     CDS             351961..352539
                     /locus_tag="Dred_0338"
                     /note="PFAM: stress protein;
                     KEGG: bsu:BG12768 similar to tellurium resistance protein"
                     /codon_start=1
                     /transl_table=11
                     /product="stress protein"
                     /protein_id="ABO48886.1"
                     /db_xref="InterPro:IPR003325"
                     /translation="MISLAKGQKIDLTKSNPGLSKILVGLGWDTNKYDGGHEFDLDVV
                     AFLVNAEGKATGDSAFIFYNNKQDASGSVILSGDNRTGEGDGDDEYIKINLSGVPAEV
                     DKIAVCINIHDAATRSQNFGQVSNAYVRVVNDETNEELMRYDLGEDYSIETGLVACEI
                     YRHNGEWKFNAVGSGFQGGLASLAATYGLNAG"
     gene            352717..353484
                     /locus_tag="Dred_0339"
     CDS             352717..353484
                     /locus_tag="Dred_0339"
                     /note="PFAM: Integral membrane protein TerC;
                     KEGG: bsu:BG12770 similar to tellurium resistance protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Integral membrane protein TerC"
                     /protein_id="ABO48887.1"
                     /db_xref="InterPro:IPR002345"
                     /db_xref="InterPro:IPR005496"
                     /translation="MEAVTTFLTGLVANYGHFFSWQDIHRVMTDPVSWGIVFWLVILE
                     GLLSCDNALVLAVVVNKLPKHQQKKALLYGIWGAYFFRFIAIGLGTYLVKIKWVQILG
                     AGYLLWMAGKFFLSKGEEADEGDGEAKVSGFWLKMVGPFWATVITVELMDITFSVDSI
                     LAAFAMSNEVWVLFMGGILGILMMRGVATIFIKLLEKYPELEASAYVLIALIGGKLMG
                     QAFGYHIPHGIFFSIMAAVLLGTIVLHHLREGGNKAA"
     gene            353523..354668
                     /locus_tag="Dred_0340"
     CDS             353523..354668
                     /locus_tag="Dred_0340"
                     /note="KEGG: ctc:CTC02238 putative ATP/GTP-binding
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ATP/GTP-binding protein"
                     /protein_id="ABO48888.1"
                     /translation="MFFIPPVELREDHDKDTLAHALGATLYMPGTANRAIDKVINNEI
                     PGLTSTVLCLEDAVDDREVEDAEENLALQLGTLLAMAEKGSSLPFIFVRVRNVEQFKR
                     LTQVLGESIHVLTGFVFPKFDMMAGQEYFAHLTTINKTTKKTIYGMPILEGPSVIHLE
                     SRVREMLKIKELLDQYKELVLNVRMGATDLSGLYGLRRSPELTIYDVSVIRDFIADMV
                     NIFGRPQDGYVISGPVWEYFNNTARMLKPQLRKTPFQEQYGRAGESFRLELLGRYIDG
                     LMREVMLDKANGLVGKTIIHPSHILPVQAMYVVTHEEYCDAKDILANGGNGGVTKSVY
                     GNKMNEAKPHINWAKKIMILAKIYGVLNERYDYTSIIYEGEKLQNIG"
     gene            354607..355983
                     /locus_tag="Dred_0341"
     CDS             354607..355983
                     /locus_tag="Dred_0341"
                     /note="KEGG: bca:BCE_5092 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABO48889.1"
                     /translation="MRGMTIQALSTKEKNYKILDNLMVGIRMEENPYSLTIDSIFSMA
                     ARNNPKRSFLFVSKLIGKHIPVLPNVPLITGFLLASRLAELWGLSVGKETIRHAVASL
                     SAGVNNEFHPPSYSFPGKALFIGFAETATALGHAVFSSCTGNINFLHTTRENLEGNHD
                     TIYFTEDHCHAPDQRCLICQGSIMKDNDLLVLVDDEITTGNTCLNIIETLQQKYPQKR
                     YVILTILDWRSDEAMAKYRQVEGVLGVKIDVLSLLKGRFWYQGEAPVIPQSPIAPEEG
                     MPCVRSLYKEMGFQVATVLPDGSKVSYLGYTGRFGVGVKETKQALLRAKEIGYELLQV
                     RKGKKTLCLGTGEFMYIPCLIAKYMGEGIMVQSTTRSPVHPYLGTDYAVKYAINFEDP
                     HNPDVKNYIYNIPPNYYDEVFVFWERKVVPEQVKPFVQALHKLGIENIVFVYFTDGAG
                     GVSNRTNC"
     gene            355925..357142
                     /locus_tag="Dred_0342"
     CDS             355925..357142
                     /locus_tag="Dred_0342"
                     /note="KEGG: bca:BCE_5093 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABO48890.1"
                     /translation="MYLFTSLMVREVFLIEQIADFDRYGTLNAYPKVPDPRPLGSYSS
                     QDVIFLLKDIGPYIQEQGNEAREKAIQSGKHYSEMLPIEYEPTQEYIDLFHKSLKETG
                     YRLALATAIVAETILKKRGKNLVLVSLARAGTPIGVLIKRYIQQFHGVKAPHYSISII
                     RDKGIDKNALIYILQQHPGCEVQFLDGWTGKGAITMELIKSVSEFEKEFKMPPDTISK
                     DMAVLADPGYCANIFGTRDDFLIPSACLNSTVSGLMSRTVCREDLLGPLDYHGVKFYR
                     QLQIKDLSNYFVDVVSDYFAKAQTKAKTILQHNPQFGIDESPAWLGQKDTTRVQLEYG
                     IKSINYVKPGVGETTRVLLRRIPWKILVRDMNSPDIKHVLLLAKDRGVTVEEHPNLSY
                     SCYGLIKNLEDRK"
     gene            357139..357918
                     /locus_tag="Dred_0343"
     CDS             357139..357918
                     /locus_tag="Dred_0343"
                     /note="KEGG: bca:BCE_5094 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABO48891.1"
                     /translation="MIFASDLDRTLIYSGKFLTEFQGKVKAVETGKYYSYMTERAAEL
                     LKQVAARITFVPCTTRTIEQYRRIQFFQGEIVPQFAIVSNGANILLEGTEDSTYRNHI
                     TRILANECLAGDEILKEINKLLSAKWAQPMRQADGVFHYCIIDRDKAPLEELIAFSQW
                     ASTQKWNVSIQGRKLYLVPLVINKWSALERVASIIGDTRVFAAGDSLLDLPLMQGAHY
                     AVSPAHGELYEQFSELGKWTFTETSGIRAGEQILEMVLEKM"
     gene            357936..358619
                     /locus_tag="Dred_0344"
     CDS             357936..358619
                     /locus_tag="Dred_0344"
                     /note="PFAM: protein of unknown function DUF124;
                     KEGG: nca:Noca_1500 protein of unknown function DUF124"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF124"
                     /protein_id="ABO48892.1"
                     /db_xref="InterPro:IPR002838"
                     /translation="MKHKILYPGAFPLVQLNLEQGESVKAESDAMVAMSSTIDVEGKM
                     DGGLLGGLARMVAGESFFFQTLTARRGAGEVLLAPAVPGDIIDVELDGSYSLMVQKDG
                     FLAGSAGIQVSTKMQNLSQGLFSGEGFFVVKVSGQGIVFINTYGGIHVINLEPGQEFV
                     VDNSHLVAWPEYMNFSIEKASSGWISTFTSGEVAVCKFRGPGPVIIQTRNPRGFGNWI
                     RQFIPPSRN"
     gene            358583..359281
                     /locus_tag="Dred_0345"
     CDS             358583..359281
                     /locus_tag="Dred_0345"
                     /note="KEGG: aci:ACIAD1958 tellurium resistance protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Uncharacterized protein involved in stress
                     response-like protein"
                     /protein_id="ABO48893.1"
                     /translation="MDTSIHTSFQKLKRTVQDVRGMSYKHLIRFNMGRNFNAETAIVV
                     AELYRYKGEWKFNPIAMGYQGGLAALCGSFGIDVSDNPTNQPAQAQAAPTIEREPQPK
                     PVPPQPKINLSKIELKKKGEKINLEKKVNNRLGEILINLNWSRKPINQGGGGFFASIF
                     GSGNKGIDLDLGCMIETKDGRKTVVQALDNDFGDLDFWPFVSLNPRNSFFVSRCKDVC
                     MNEEAGKIKKANSS"
     gene            361113..361317
                     /locus_tag="Dred_R0027"
     rRNA            361113..361317
                     /locus_tag="Dred_R0027"
                     /product="5S ribosomal RNA"
     gene            362048..363454
                     /locus_tag="Dred_0346"
     CDS             362048..363454
                     /locus_tag="Dred_0346"
                     /note="PFAM: sigma-54 factor, interaction
                     domain-containing protein; helix-turn-helix, Fis-type;
                     ATPase associated with various cellular activities, AAA_5;
                     SMART: AAA ATPase;
                     KEGG: swo:Swol_0456 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="ABO48894.1"
                     /db_xref="InterPro:IPR002078"
                     /db_xref="InterPro:IPR002197"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011704"
                     /translation="MNDRKRIEREFRENPVLAGVLIDNPYEGFIVVNKDGFVTFISNL
                     YLDTINLTREDTIGKHITEVHENTKLTQVLETGKPISYDYWETKGMTLIVVRFPILNN
                     AGDLIGAVGKAVFVDIPSGKTLANKLKQLEKEVEFYRQELYKFYNAKYTFNDMIGESD
                     AIKKVKKIAQKIALSESTVLITGESGTGKELFAQAIHNASYRSRFPFVRINCAAVPEN
                     LLEAELFGYAEGAFTGAKKGGKPGKFELAQGGTIFLDEIGELPLSMQSKLLNVLQERE
                     IERVGGIRTVSVDFRVIAATNRNLEDMVKEGTFRDDLYYRLNVISLKIPSLRERQDDI
                     PLLVNYFTDKLNNKLKCSVERFTEEAMLVLSKHYWPGNIRELQNTLERVFILSDDNII
                     SVNHLPFSIKMRKGNIIQSKRLTLDEMIDQTEKRIILDTLSNVKDDRIAAAELLGIHL
                     SSLYRKMKKHGIKKSFTS"
     gene            363990..366413
                     /locus_tag="Dred_0347"
     CDS             363990..366413
                     /locus_tag="Dred_0347"
                     /EC_number="1.1.1.35"
                     /note="PFAM: Enoyl-CoA hydratase/isomerase;
                     3-hydroxyacyl-CoA dehydrogenase domain protein;
                     3-hydroxyacyl-CoA dehydrogenase, NAD-binding;
                     KEGG: chy:CHY_1609 3-hydroxyacyl-CoA
                     dehydrogenase/enoyl-CoA hydratase/isomerase family
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="3-hydroxyacyl-CoA dehydrogenase"
                     /protein_id="ABO48895.1"
                     /db_xref="InterPro:IPR001753"
                     /db_xref="InterPro:IPR006108"
                     /db_xref="InterPro:IPR006176"
                     /translation="MNRSINKAAVLGAGVMGATIAAHLANVGIPTYLLDIVPNKLTPE
                     EEKKGLTLDSPQVRNRFSINGLNDLQKSRPAAFYVSENAALITPGNFEDNINVLAECD
                     WIIEVVVERLDIKQSLFKKVEAYRKPGSIVASNTSGISINKICEGLSQEFKEHFLGTH
                     FFNPPRYMKLLEIIPCNETLPEVISFMQDFSERVLGKGVVICKDTPNFIANRIGVHGM
                     CTVIKTMLEFSLTTEEVDVLTGQAICRPKSASFRTLDMVGLDVMVHVAKNVYDVAVEP
                     NEKAIFETPEFIKKMLEMGLLGDKTKQGFYKKVKTDKGRETLVFDYNSMVYRPKQKAR
                     FASLEAAKQAGKPLNQMKALLFGKDKGAQFAWRVQRDSLVYAANLLGEISDDIPSIDN
                     AMKWGFNWDFGPFEIWDALGVQEVAERIKAEGGTVPKVVEDLLASGRTSFYSKKDGYR
                     YIYAQNTEEDVQERIPNGVIYLNPLKEQKKVIKSNKGASLIDIGDGVVCLEFHSKANA
                     IGDDIISMINTAVTEVEKNYDGLVIGNYGKNFSVGANLFFILMEAENEEYEELGLMVH
                     SFQQANMRLKYCNKPVVAAPHGMVLGGGCEVILHSHRVNTAAEAYIGLVEVGVGLIPG
                     AGGCKEMAFRAAELATPKSQITTGGTNGIQPMINRAFENIAMAKVSTSGPEAIKLGYL
                     RSNDCFSPDRDRIIGDAKRMVLEMAATGFRPGQPKKMQALGDAGYAAIELGIYSMLWG
                     KMISEHDAKIAKEIAYVLTGGPVTPGTIVSEQDLLDLERQAFLSLLGEPKTLERMRHM
                     LKFNKPLRN"
     sig_peptide     363990..364055
                     /locus_tag="Dred_0347"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.861) with cleavage site probability 0.722 at
                     residue 22"
     gene            366426..367604
                     /locus_tag="Dred_0348"
     CDS             366426..367604
                     /locus_tag="Dred_0348"
                     /EC_number="2.3.1.16"
                     /note="KEGG: chy:CHY_1608 acetyl-CoA acetyltransferase;
                     TIGRFAM: acetyl-CoA acetyltransferases;
                     PFAM: Thiolase"
                     /codon_start=1
                     /transl_table=11
                     /product="3-ketoacyl-CoA thiolase"
                     /protein_id="ABO48896.1"
                     /db_xref="InterPro:IPR002155"
                     /translation="MREAVIVSAVRTAVGKAPRGKLKNTRPEFMGAEVIKELIKRTPG
                     LNPAEIDDAVFGCAFPEGEQGMNMARLLLLKAGIPIDVSGLTINRYCSSGLESIAIGA
                     TRIMTGLADVYICGGVESMSVVPMGGNKVAPDPELMVTYPEAYMGMGYTAENVAEKYC
                     ISREEQDQFAVDSHAKAARAITEGCFKDQIVPLTIREKTWSKGKLLIKESVFDTDEGV
                     RADTKIEGLAKLKPAFKQGGSVTAGNSSQTSDGAAAVMVMSSEKAKSLGLKPMAVFRS
                     YAVGGCAPELMGIGPTVAIPKALKLAGITKEQVDLFELNEAFAVQALACIKDLELDPT
                     KINVNGGAIALGHPLGCTGAKLTTQLLYEMKRQQAHYGVVSMCIGGGMGAAGVFEIVN
                     "
     gene            367760..369043
                     /locus_tag="Dred_0349"
     CDS             367760..369043
                     /locus_tag="Dred_0349"
                     /note="PFAM: transposase, IS111A/IS1328/IS1533;
                     transposase IS116/IS110/IS902 family protein;
                     KEGG: tte:TTE2638 transposase"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS116/IS110/IS902 family protein"
                     /protein_id="ABO48897.1"
                     /db_xref="InterPro:IPR002525"
                     /db_xref="InterPro:IPR003346"
                     /translation="MNYKQKQRIEQLTESTLIIGADIAKSKHVARAQDFRGIELGKRL
                     VFDNTRAGLTKLMHWIRTLMVEHGKDHALVGIEPTGHYWLPMAEFLRKEGVPVVVVNP
                     LHVKRSKELDDNSPTKNDIKDARVIAQLVKDGRYSEPNLPTGVYAELRVGMVQRDRLN
                     QDLNRVKGRIHNWLDRYFPEYTSVFKDWEGKASLMILNTCPLPREVIKTGTEAIVTLW
                     KTEIKRAVGIKRANKLMQVARESIGLSTGIEFARHEIRMLLEQYDILCKQMEILMEAV
                     QELLQQIPGSTEMMTIPGVGLVTVAGFLAEVGDLKGYEHGQQIIKLAGLNLKENSSGK
                     HKGQSRISKRGRPRLRALLFKTVLVMVAKNREFKAIHQYLITRHGNPLKKKQSIVALC
                     GKLIRILFTIGSKQTPYDAEQVLGVVRQEQLQEAA"
     gene            complement(369058..369321)
                     /locus_tag="Dred_0350"
     CDS             complement(369058..369321)
                     /locus_tag="Dred_0350"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABO48898.1"
                     /translation="MVGGGVANQRLRLILQIMVAQWISTCTLVVYPPTSHGVQYMALT
                     FLRSTSQGVEARYAPLLGHARMEILVPGFSVLRLSIQFIVNKC"
     gene            369436..371196
                     /locus_tag="Dred_0351"
     CDS             369436..371196
                     /locus_tag="Dred_0351"
                     /note="PFAM: acyl-CoA dehydrogenase domain protein;
                     Acyl-CoA dehydrogenase, type 2, C-terminal domain;
                     KEGG: chy:CHY_1607 acyl-CoA dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase domain protein"
                     /protein_id="ABO48899.1"
                     /db_xref="InterPro:IPR006089"
                     /db_xref="InterPro:IPR006090"
                     /db_xref="InterPro:IPR006091"
                     /db_xref="InterPro:IPR006092"
                     /db_xref="InterPro:IPR013107"
                     /translation="MELQKGAFYLIEDIDPEKIFTAEDFSDEQRMIESMVADFTQNEI
                     IPNLEEIDHQKEGLSRSLLAKAGELGLLSADVPEEYEGGEMGKISSAIITENISAGGS
                     FSVSFSAHTGIGSLPIVLFGTEEQKKRYLPDLATGRKIAAYALTEPMAGSDALAAKTK
                     AVLTEDGKYYVLNGEKIFITNASFADVFVVYAKIDGEKFTAFIVDRDTPGFSIGPEEK
                     KLGIKGSSTCSLIFEDAKVPVENLLGEIGKGHVIAFNILNIGRYKLGLGSVGLSKSAI
                     SYATKYALERQQFGIPIAKFGMIQNKLAQMAAKTYASESLIYRLVGNIEEALHGKVDG
                     REIGAAIEEYAVECSISKVHCSESLAYVTDEAVQIYGGYGYTQEFPAERMYRDARINR
                     IFEGTNEVNRLIIPATLLRLGMKGQLPLLQAAQDLAGQLISLQVKTSSGGEVPLEVEF
                     DMLNRAKKLFLLIGGTAAQKYMKKLAKEQEIIEIMANMCIEIYAMESALLRAKKALAK
                     DAASAETKIELAMAYIYDAFPKLENWAKQAIAYMFESNEEVRTNLSIAKRLSKYQPIN
                     IIDIRQKIAKKVLEAGKYVV"
     gene            371423..372766
                     /locus_tag="Dred_0352"
     CDS             371423..372766
                     /locus_tag="Dred_0352"
                     /note="PFAM: acetyl-CoA hydrolase/transferase;
                     KEGG: dsy:DSY1711 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA hydrolase/transferase"
                     /protein_id="ABO48900.1"
                     /db_xref="InterPro:IPR003702"
                     /translation="MSKYIEMYKSKLVSPEKAVSVVKSGDWVEWGSFACRPLVLDRAL
                     AQRKDELQNVKVRAVCTAYGVPEIVKVDPTREHFCYNNWHFSVIDRKLSDKGLCSYVP
                     QLYREAVGYFNNYIQVDVAMLQVTPMDQHGYFNFGPSVSHAYATCNNAKIVILEINEN
                     IPRALGGNSESIHISEVDFIVEGENTPLQQTPVIPFSEEDRMIANHIMEEIEDGSCIQ
                     LGIGGMPNVVGKMLAESDLKDIGVHTEMLVDAFVDMYEAGALTGRKKNIDQRKIVYTF
                     ALGSQRLYDFINNNPMCATYPVNYTNNPNIIAQNDKVVSINNAVEIDLFGQVNSETSG
                     VRQISGTGGQVDFIDGAYNSKGGKSFICLTSTYRDKNGKNISRIKPFLSNGSIATTHR
                     AAVQYVITEYGKAVLKAKTTWQRAEALIAIAHPDFRDELIKEAEKNGIWRRSNMR"
     gene            373144..373914
                     /locus_tag="Dred_0353"
     CDS             373144..373914
                     /locus_tag="Dred_0353"
                     /note="PFAM: alpha/beta hydrolase fold; Thioesterase;
                     KEGG: dsy:DSY2637 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase fold protein"
                     /protein_id="ABO48901.1"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR001031"
                     /db_xref="InterPro:IPR003089"
                     /translation="MPLVTLNSIQYYYDTNVPTLEKPRQRILFVHGAGGSHRHWRLQL
                     AHLSKEYQAIAVDLPGHDLSEGNPFNRVAEYSRFIKDFVDCLLDVPFILVGHSMGGAI
                     AMDFALKNSHRLAGLVLVGTGSRLRVMPQLLESFKKNKFFAGLEQFLYSPDSSADMFS
                     RAKKELESVPPSVFFADFTACDNFNVGDRLGEITAPTLIISGEKDVMTPVKFGQLLFD
                     QIPGAQISVIPKAGHMMMMERPREFNRVVEAFVKGLIE"
     gene            complement(373904..374614)
                     /locus_tag="Dred_0354"
     CDS             complement(373904..374614)
                     /locus_tag="Dred_0354"
                     /note="PFAM: OmpA/MotB domain protein;
                     KEGG: dsy:DSY0295 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="OmpA/MotB domain protein"
                     /protein_id="ABO48902.1"
                     /db_xref="InterPro:IPR006665"
                     /translation="MAKHREQHEEHIDESWLIPYADLLTLLLALFIVLFASSTIDNQK
                     FNAMKESLNAALNSGAGIMESKSLSDQLIDKTEVKTDTVVELQELKKQLDQYIKENNM
                     TTEVETNIINNHLTLTIRDRALFDSGSAVVKPQSRKIIKAMGSILQQYPKFEVLVAGH
                     TDNQPIYNNTFESNWDLSSKRALNCMKIMLTNKNLDPRRLVAIGYGEYRPIAENTTTE
                     GRAKNRRVEVIINQKVIQ"
     gene            complement(374589..375395)
                     /locus_tag="Dred_0355"
     CDS             complement(374589..375395)
                     /locus_tag="Dred_0355"
                     /note="PFAM: MotA/TolQ/ExbB proton channel;
                     KEGG: dsy:DSY0294 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="MotA/TolQ/ExbB proton channel"
                     /protein_id="ABO48903.1"
                     /db_xref="InterPro:IPR000540"
                     /db_xref="InterPro:IPR002898"
                     /translation="MEKSTIIGLFLGITAISVGMVLKGAHLSSLWNPAAIMIIFVGTA
                     ASLFIAFPMSELKKIPRLLKITLQEPKLMAKREVVNTFVALASTARREGLLSLESQLE
                     SIDDPYLRGGMQMIIDGSDAEFVKFVMEEEIYATEERHRSGALIFTQAGTYAPTLGVL
                     GAVVGLIAALGNLSDIEKLGHSIAAAFVATLLGIFSGYVLWHPIANKLKRISKKEMEI
                     KQMIVEGVLAIQTGRSPIAIEQQLLVYLSPSERSSSKEEAENDGKAQRAA"
     sig_peptide     complement(375321..375395)
                     /locus_tag="Dred_0355"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.671) with cleavage site probability 0.659 at
                     residue 25"
     gene            complement(375811..377793)
                     /locus_tag="Dred_0356"
     CDS             complement(375811..377793)
                     /locus_tag="Dred_0356"
                     /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
                     protein;
                     KEGG: chy:CHY_0930 heterodisulfide reductase, subunit A,
                     selenocysteine-containing"
                     /codon_start=1
                     /transl_except=(pos:complement(377209..377211),aa:Sec)
                     /transl_table=11
                     /product="4Fe-4S ferredoxin, iron-sulfur binding domain
                     protein"
                     /protein_id="ABO48904.1"
                     /db_xref="InterPro:IPR001450"
                     /translation="MNRIGVFVCWCGSNIGSVVDVPRLATEAAKFPGVVFSTDYKYMC
                     SVPGQDLIVQKISEYRLDKVVIASCSPRLHEQTFRKTLERAGLNPFMMRIANIREQCA
                     WVHSRQKDGATEKAIALVRRAVAKANNTEPLYEERIPVTKRALVIGGGIAGIQAALDI
                     ADAGHEVVLVEREPTIGGKSAMLDKTFPTLDCSGUIVTPKMVAVVQHPNIKLYTFAEV
                     CEVSGFIGNFNVRIKQKPKYVDHNKCTGCGTCWEKCPAKVPSEYNLHLGQRKAIYISS
                     PQAVPNKPIIDPKGCRMLLSGKCGVCQKVCQAEAINYKDTEQFFEEQVGAVVMATGYD
                     LFDWAGSYGEYGHSKYPDVISSLQFERLLNSSGPTGGKILRPSDSKEPKSIVFIKCVG
                     SRDESKGKSYCSRACCMYTAKHAQQILEKIEGARVYVFYMDVRTPGKGYEEFYQRSVN
                     EGACYIRGRVSKIYPKGEKLVVRGADTLLGRPVEVETDLVVLATAMTPSRGSDELAKV
                     VGFTTDKDGFYQEAHPKLKPVETNTGGIFLAGCCQGPKDIPDTVSQASAAAAKVIVLL
                     SKDELATNPMVSQIDERRCTGCMACRDVCPFNAIEEKLITDKSMGQGVQRTVAAINTG
                     LCQGCGACAATCRCGAADLKGFTNQQVMSEIIALCI"
     gene            complement(377816..378670)
                     /locus_tag="Dred_0357"
     CDS             complement(377816..378670)
                     /locus_tag="Dred_0357"
                     /EC_number="1.8.98.1"
                     /note="PFAM: protein of unknown function DUF224,
                     cysteine-rich region domain protein;
                     KEGG: chy:CHY_0929 putative succinate dehydrogenase,
                     subunit C"
                     /codon_start=1
                     /transl_table=11
                     /product="CoB--CoM heterodisulfide reductase"
                     /protein_id="ABO48905.1"
                     /db_xref="InterPro:IPR004017"
                     /translation="MKIAYYPGCSLQTMAKDYDMSARVVSEFLGIELVEIPDWNCCGA
                     SAAHASSKYLPIALCARNLHMVEQMGLDVTSPCAACYQSLSYANWKLTGDPDLREKIN
                     DATGQPYQGGVKIQSFIQVFSKLTAEKIQSQVVQPLEGLKVAVYYGCLLVRPSNVVEI
                     DDPEDPQILDNLIRATSAETVDWTHKVECCGGSLSVTNEDISLKLARDILSSAAEAGA
                     HCIITACPQCHFNLDMKQNKMNKVFNTDLKLPVFYFTQLLGLSLGIEPNCLGMDLMTA
                     KAMLSRIS"
     gene            complement(378672..379235)
                     /locus_tag="Dred_0358"
     CDS             complement(378672..379235)
                     /locus_tag="Dred_0358"
                     /note="KEGG: chy:CHY_0927 putative heterodisulfide
                     reductase, C subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="putative heterodisulfide reductase, C subunit"
                     /protein_id="ABO48906.1"
                     /db_xref="InterPro:IPR001450"
                     /translation="MEVITFNDAGEKVNQLINKFGQNIQHCYQCGKCTAGCPVAFAMD
                     IAPNQIIRMLQLGLLDEALRSETIWLCATCSTCSTRCPKGFDLAKLMDSLRSYALQQG
                     IKPNGRGRNVSLFNQLFLDSLRKYGRTYEMGLMLKYNLNLHTPFKDAMLGLDMFSRGK
                     LKLAPERIKGSKDILQIMENIKKLEMK"
     gene            379559..381355
                     /locus_tag="Dred_0359"
     CDS             379559..381355
                     /locus_tag="Dred_0359"
                     /note="PFAM: DNA mismatch repair protein MutS domain
                     protein;
                     KEGG: dsy:DSY2437 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein MutS domain protein"
                     /protein_id="ABO48907.1"
                     /db_xref="InterPro:IPR000432"
                     /translation="MEQHIKKIYQKNKERYEIELDGLKKTDNTFVFSRSVVALSVVGL
                     LLYAYLKGLSYLYLSTVPLVFLFLVMVNKHQRVKKQMTQLESLVQINERALLRLCGQW
                     TGFQQRGEEYIASEHPYSGDLNIFGQGSLFQYLNAANLVTGNEALAKLLSAEEPCYEQ
                     IRPRQSAIKDLAARLDWRQLLQAMGMGSGYKPEDAIKLWNWAREKPLFLHGKLIYLLW
                     LLPITTLILLILMSQRLVPSYVPLILLILQVILVTASQAIISRKFKDTERSAAELARL
                     SRLLKYIEGEEFQAPLLVELQNRLIQKKQTASQQVKALEKIAALINLRYSVVYHFINA
                     LIFCDLYTLRTLEQWKSQYGTHLEQWFRVIGQFEALSSLATLAHDNPHWAFPEVTKAG
                     PYLTATTLGHPLINAETRVSNDVSLPQPGTVHIITGSNMSGKSTLLRTVGINLVLAYA
                     GAPVCASFLSCSLMSIYTSMRIQDNLEESTSSFYAELKRIKLVIEATRQGKSLIFLLD
                     EIFRGTNSRDRITGARTVIKNLALQPAIGFVTTHDLELSTLENEYPQHIKNYHFTDEI
                     IENKITFDYRLKEGVSQTTNAIALMKMVGIDV"
     gene            complement(381358..382299)
                     /locus_tag="Dred_0360"
     CDS             complement(381358..382299)
                     /locus_tag="Dred_0360"
                     /note="PFAM: regulatory protein, LysR; LysR,
                     substrate-binding;
                     KEGG: dsy:DSY4967 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, LysR family"
                     /protein_id="ABO48908.1"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /translation="MRLKQLQYILEVSKQKSITKAAKQLFISQPSLSSAISNLEQELN
                     IKIFIRTHDGVEPTEIGRFLIEKASRIFQEVEEINNMCANSSVCLNGNLTVSTLPAIS
                     NHILLETLSIFKEKHPQVNISFNEDDTSNIMREIKVGNIDIGILALWDYEKEAFLFNQ
                     CKNNIHYEELFIDNFCLFTATDHILSQKQQVHIEDIQNYPLVVFKNNISDKDIEVFMK
                     LKDINVMRFNDRESMKKVIARGNAVALLPRVMSLNDIYVQSGKIRPLTISHFKTNIHI
                     GFVYRKDYLQIAQKKFILTLRDTVNTLLKDLPQLPAN"
     gene            382550..384007
                     /locus_tag="Dred_0361"
     CDS             382550..384007
                     /locus_tag="Dred_0361"
                     /note="KEGG: dsy:DSY0400 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABO48909.1"
                     /translation="MTYPSIFPTGATIYNPEKCWNGYTIIQVEDLGALLINMNGGEVK
                     LWKNLHGFPNKLLPGGQVFGHTGERSIAFGVQDGIDLIQVDWDGNVVWKFNQYEFIED
                     PGEKPQWMARQHHDFQRAGNPVGYYVPGMEPQVDKGNTLILCHKNLVNPKISDKLLAD
                     DAIIEVDWEGNIVWEWVCSEHFDEYGFREEAKNILARDPNMRAAGPGMGDWMHINSMS
                     VLGPNKWYDAGDERFHPDNIIWDARESNIIAIISKQTGKVVWKVGPYYDTSEELKKLG
                     WIIGQHHAHMIPRGLPGEGNILVFDNGGWAGYGAPNPGSPTGTKNALRDYSRVLEFDP
                     TTLEIKWQYTPSEAGYLQPVDSNRFYSPFVSGAQRLPNGNTLITEGSGGRIIEVTPDH
                     EIVWEYISPYWGESFPMNLLYRAYRVPYEWVPQLETPKEVPIERIDVKTFRVPGAAPI
                     GCSDVTEVEGVLPYQADNTLCVAAGDEFEHKEKNS"
     gene            384136..385548
                     /locus_tag="Dred_0362"
     CDS             384136..385548
                     /locus_tag="Dred_0362"
                     /note="PFAM: sodium/sulphate symporter; Citrate
                     transporter;
                     KEGG: dsy:DSY4285 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="sodium/sulphate symporter"
                     /protein_id="ABO48910.1"
                     /db_xref="InterPro:IPR001898"
                     /db_xref="InterPro:IPR004680"
                     /translation="MEQAINSKNKNINYIQWAITILVPIIIYLFTPLDYAGKTFLAIT
                     ATCVILWVFALIPENITGLLIPISFVLFGVAEPEVAFKPWAQILPWLVVAGMILSEVM
                     LDTGLAKRLAYKSLLMTGGSGKGIVLGFIITSFVLPLLVPSSVWAKMFIMAPIGIAIC
                     KALDFKPMSKEATGIMLMACFVAISSGFSFQTGDETMVWISQVISEVSNGQITISWLA
                     WLKYMLLPGLSWSVFSILTAYYLLVKKAFDNKGNVKSVLEVEYKEMGSLSGKEIKTLL
                     IVLLILLNFIFETYHKMNAAFIMVALVSLFFIPGISLMKREKLQSVNLWILFFVTGAM
                     SVGMVAGSVGVTKVVADSLLPIIKEMGPFGATMMAFTFGVIMNFIMTPLGAMAAFITV
                     ISGLAVQAGIHPLPVSLAFAVGLDIYVFPYEVAPVLYFFSLGYMSLQEAIKVLAVRTV
                     LAFLVVAVVFGGYWYTLGLM"
     gene            385591..385992
                     /locus_tag="Dred_0363"
     CDS             385591..385992
                     /locus_tag="Dred_0363"
                     /note="TIGRFAM: glycine cleavage system H protein;
                     PFAM: glycine cleavage H-protein;
                     KEGG: dsy:DSY4282 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="glycine cleavage system H protein"
                     /protein_id="ABO48911.1"
                     /db_xref="InterPro:IPR002930"
                     /db_xref="InterPro:IPR003016"
                     /translation="MTKSAEELTFLDNIHYYKEHTWAMVEGNQLKIGITDFAQDNLGN
                     IIFVELPNAGESFDKGEEFGQAESAKTVSALYMPISGEIIDVNNQLEDAPQNVNEDPY
                     GTGWMIIVKPNNISEVSELLTKEEYINLINQ"
     gene            386044..386892
                     /locus_tag="Dred_0364"
     CDS             386044..386892
                     /locus_tag="Dred_0364"
                     /note="KEGG: dps:DP0065 related to pyruvate formate-lyase
                     activating enzyme"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABO48912.1"
                     /translation="MSYTIYTATGCTRCKIVKQCMKERGIDFVEQDMKAEGKEAFRKF
                     YSANRKSIFRGPDGVEFPILTDGSTICQGIGTSIAFLHAGNKLDGFFGVGTLHKEWVD
                     GIYVSAGNPKYVTEFMEVLRYLKGNNMKLQLETNGLNSNILQQVLDEGLADVVIMNVL
                     GPRELYSRILGQEVDMNEVEKTIPTVTKFPEYRFQTTVVPVIRQESEPNEISFLTAKE
                     IGETAKLIADGTGSMKNPYLIRLWNPKLTTDQRFKAVKAMSINDMFSYRTSARCHQVL
                     TEIEKE"
     gene            386969..388345
                     /locus_tag="Dred_0365"
     CDS             386969..388345
                     /locus_tag="Dred_0365"
                     /EC_number="1.8.1.4"
                     /note="TIGRFAM: dihydrolipoamide dehydrogenase;
                     PFAM: FAD-dependent pyridine nucleotide-disulphide
                     oxidoreductase; glucose-inhibited division protein A;
                     pyridine nucleotide-disulphide oxidoreductase dimerisation
                     region; HI0933 family protein;
                     KEGG: mta:Moth_1763 dihydrolipoamide dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrolipoamide dehydrogenase"
                     /protein_id="ABO48913.1"
                     /db_xref="InterPro:IPR000103"
                     /db_xref="InterPro:IPR000815"
                     /db_xref="InterPro:IPR001100"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR002218"
                     /db_xref="InterPro:IPR004099"
                     /db_xref="InterPro:IPR004792"
                     /db_xref="InterPro:IPR006258"
                     /db_xref="InterPro:IPR012999"
                     /db_xref="InterPro:IPR013027"
                     /translation="MIYDAVVIGGGPGGYVAAIRIAQKGGKVAVIEKDQLGGTCLNRG
                     CIPTKALIASVDKLKAVEEASEFGIEVGKPVIDFRKVQARKAEIVDKLVSGIKYLFDK
                     NKIDHLNGTGKIKTANIVEVNNADKTYELQCKNIIVATGSSPSLIQSLGYNGTTIITS
                     EEALKLTEVPKSLLIIGAGVIGCEFAHIFGSMGTQITMVEAAPSILSIQDKDISRRMQ
                     TVFKKKKFNIKTNVAITKMEQTGAGIQAELENGDIIKAEKALISIGRQLNTKNLGLED
                     IGVQLGEKGQILVNDRLETNIKGIYAVGDVISKYQLAHVASAQGIVAAENIMGKESTM
                     DYNAVPSCIFTSPEISSVGITEQQAKDRKIPVKTGKFNFMANGKALSMGEGEGFVKIV
                     AHKETDVVLGVHIIGPHASDLIAEATLAVRKGLTTKELAVTIHAHPTLAEVIMEAAEN
                     VHGLNIHG"
     gene            388532..388771
                     /locus_tag="Dred_0366"
     CDS             388532..388771
                     /locus_tag="Dred_0366"
                     /note="KEGG: bcz:BCZK4765 membrane protein; possible DMT
                     superfamily transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="ABO48914.1"
                     /translation="MGLGLLGGVIPTFLLAKGVPQVGAGMSTILCSSELPVALLASAL
                     ILAEKSTLLQWCGVVLIILGISTPYISLLRHQHRV"
     gene            389031..389819
                     /locus_tag="Dred_0367"
     CDS             389031..389819
                     /locus_tag="Dred_0367"
                     /note="PFAM: electron transfer flavoprotein beta-subunit;
                     KEGG: tte:TTE0546 Electron transfer flavoprotein
                     beta-subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="electron transfer flavoprotein beta-subunit"
                     /protein_id="ABO48915.1"
                     /db_xref="InterPro:IPR000049"
                     /translation="MNIVVLIKQVPGTDNVKLDPKTGVMIRSGRDTIINPLDENALEE
                     AIRIKNSREGVKVTAVSMGPESAVKALKEAVAMGADAGVLISGRAFAGSDTIATAKAL
                     AAVIKKLSPVDLVICGERATDGETGQTGAMIANYLDFPVQTYVSAVEAKEDRVMVKRT
                     VEGGFERVEVSYPVLLTVNKDINEPGFPTLKGKLKAKQVDISIWSSEELDLDKSELGL
                     QGSPTRVVKVFSPKLSRDTILYQADGTSKPVDELMKFLNAKEVL"
     gene            389835..390851
                     /locus_tag="Dred_0368"
     CDS             389835..390851
                     /locus_tag="Dred_0368"
                     /note="PFAM: electron transfer flavoprotein beta-subunit;
                     electron transfer flavoprotein, alpha subunit;
                     KEGG: cno:NT01CX_1204 electron transfer flavoprotein,
                     alpha subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="electron transfer flavoprotein, alpha subunit"
                     /protein_id="ABO48916.1"
                     /db_xref="InterPro:IPR000049"
                     /db_xref="InterPro:IPR001308"
                     /translation="MVSQDISQYKGVFVLGEQRDGKIQSVTFELLTRGRALAEELQCE
                     LGCILLGEEIDNIEEVIQRGADKVFFIKNPVLANFLPKPYCNAICQLIEEEKPEIIVA
                     AATTTGRTVMPLVAAKANTGLTADCTELTIDTEAKILLQTRPAIGGNIMATIKTPNHR
                     PQMATVRPKSAKPAQADPNRKGEIIIKEYTGALFVTPENFLEYIKDTTQEVSIEEADI
                     IVAGGKGMKNAEGFKMVEELAHLLGAGVGATRDAVELGWTTYPHQIGLSGKTVSPKLY
                     MALGLSGKIQHLAGMQTSDVVIAVNKDPEAQIFKVADFGIVGDVFEIVPMLIEAVKKM
                     KATA"
     gene            390865..392271
                     /locus_tag="Dred_0369"
     CDS             390865..392271
                     /locus_tag="Dred_0369"
                     /note="PFAM: FAD linked oxidase domain protein;
                     KEGG: tte:TTE0224 FAD/FMN-containing dehydrogenases"
                     /codon_start=1
                     /transl_table=11
                     /product="FAD linked oxidase domain protein"
                     /protein_id="ABO48917.1"
                     /db_xref="InterPro:IPR004113"
                     /db_xref="InterPro:IPR006094"
                     /translation="MQFNKVTDGIVQELKAILGEGNVLIEEEKLDMYSRDEVSDKLWE
                     KMPEVVVKPENVEQVSEIVKLANRELLPITPRGGGTGLAAGAVPLSGGLVLSLEKMNK
                     ILEVDTENLFMVVEPGVTTGEVQKTAKAQGLLYAGDPCSADSSFIGGNVATNAGGNKA
                     VKYGVTSRHIYGLEVVMPNGDIVTFGGKNVKDVTGYDFVHLMVGSEGTLGVVTKIWLK
                     LMPLPKYVADLLVPFADMQSAIQVVPKIMTAGIIPTCLEFMDSLSIKAAEMYLNKKLP
                     YSDAGAYIICEIDGTSETQVQDDYETIGKVCQDNGALEVFVADNMSTQERIWKSRKCY
                     AEAIRMLSPVYCMEDVVVPVSNIPKALEAIERIAKKYECKIPSCGHAGDGNIHATVLR
                     EDRDDHEWHDLKDKVLEELYEEVYQLGGNLSGEHGIGAKRAGAMDKHMTEAQLNVLRS
                     IKKALDPKGIMNPGKVLV"
     gene            392461..392536
                     /locus_tag="Dred_R0028"
                     /note="tRNA-Gln1"
     tRNA            392461..392536
                     /locus_tag="Dred_R0028"
                     /product="tRNA-Gln"
     gene            392546..392621
                     /locus_tag="Dred_R0029"
                     /note="tRNA-Lys1"
     tRNA            392546..392621
                     /locus_tag="Dred_R0029"
                     /product="tRNA-Lys"
     gene            392779..393693
                     /locus_tag="Dred_0370"
     CDS             392779..393693
                     /locus_tag="Dred_0370"
                     /note="PFAM: phage integrase family protein;
                     KEGG: btl:BALH_1136 integrase"
                     /codon_start=1
                     /transl_table=11
                     /product="phage integrase family protein"
                     /protein_id="ABO48918.1"
                     /db_xref="InterPro:IPR002104"
                     /translation="MTNQELVKTFLMYQETKNLSKRTIEWYQFTLNKLIDYCKENNIS
                     IESMTTPQARQYVFSLQKSISRTGKKYADNGINGYIRSVKIMFNYLFEDEYIEKNPFA
                     KVKQIKTDKVIIETFEVEEVKRMLNQFNKKVYTEFRDALLIQILYDTGIRISEAINLK
                     ISDIDTDKNMFKVFGKGHKERMVPFGRSIKREILKYLPKRNKEVDKELDEGYLFSTRN
                     GTALTIRNVHRKIVEVGTKAKIKGKRLSAHTFRHTFAKTYLVNGGNLFSLQTIMGHND
                     LSTTRKYVHLLTEDIQKQHRQFSPLDNL"
     gene            complement(393972..395390)
                     /locus_tag="Dred_0371"
     CDS             complement(393972..395390)
                     /locus_tag="Dred_0371"
                     /note="PFAM: Ig domain protein, group 2 domain protein;
                     KEGG: swo:Swol_1304 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Ig domain protein, group 2 domain protein"
                     /protein_id="ABO48919.1"
                     /db_xref="InterPro:IPR003343"
                     /translation="MNLFSPNENDFNFILADAGRDILINGIATRALISNLKVKSDYDD
                     KYISTLTELSQGDRIEYNGLYWLIVSEVNGKRYEKYKGVMRACNFDIKFNFAGNIKTF
                     PAIVESKVFDIETGQYMTLPVGKILMTIQDNSDTKNIILNQRIIKMDSAWKVIGIDKT
                     KNGLVILHLEKDSFGSSDDKENEIANRWQYEHIYKLTINEGESANILKDDTLQLSVKL
                     TDNGVAVDSPSITYVSSDANICNIDNNGLITGIAEGKAIITAQMTGKPDVKDTISINV
                     KVNHNYVLTITNESATLNIGDNLQLNYTLTDNGVIVDNPNVIFTSSDNNIATVNSSGL
                     ITGISIGTVTITAQMADRPEIYDILEVTVQEVPISHNYSISINGGATIKLNQTLSYTA
                     TFYDNGVEVADQSGTWSITSPNPDGTTNVYATIQSQTGNSVSIKATSTSSYVNKYLEL
                     VCTLNSDNTIKASKQIQVKSLF"
     gene            complement(395429..395776)
                     /locus_tag="Dred_0372"
     CDS             complement(395429..395776)
                     /locus_tag="Dred_0372"
                     /note="KEGG: swo:Swol_1305 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABO48920.1"
                     /translation="MTNIERLNLEIKGIDLTIDELSIYLQEQNLESNIEYNPTSNTNK
                     RNILKTALAILESIANQPQLMKSYKQDDITVSQFHENLQSRIDQLERKIREIPNDEKV
                     YEDGASFFYMFSS"
     gene            complement(395748..396209)
                     /locus_tag="Dred_0373"
     CDS             complement(395748..396209)
                     /locus_tag="Dred_0373"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABO48921.1"
                     /translation="MLNSYFRKPFYTNIPKTAEERKQEQEQKIQEAKLRAEQQNTQFL
                     ERYQDFVDTFNCLYPDIKHKYIIEKVMAGYGLYPFIYINLKNLTNKKETKFHLNHETN
                     QWHITRNNCLWDDSKYEILEPLTTKDQMDTIIEELNKELIINHDQYRTLKP"
     gene            complement(397103..398425)
                     /locus_tag="Dred_0374"
     CDS             complement(397103..398425)
                     /locus_tag="Dred_0374"
                     /note="PFAM: phage portal protein, SPP1;
                     KEGG: swo:Swol_1309 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="phage portal protein, SPP1"
                     /protein_id="ABO48922.1"
                     /db_xref="InterPro:IPR006428"
                     /translation="MNLQEYINVVHDGKPDWFVSECNSYYHQSRINNIIDIKEYLSGS
                     HLINNRPAEMWNGKVFEPRRIVLQYAKTVLNFSTSYLLKNPVTITGEENDVKVMKKVY
                     KQGKFNRTDLDIMDKLVKYGAIYEYIFVDKDGKIKSKLINPEDAYPIYNEQGEMICFI
                     EHYTTDYNVSYYNIFTDSTVQKWSDAGGDFNFLGVFNNPSGLPCVYKNLNELDNTDGR
                     SDLEDFINIIDNMEDLISKYTDSIYKFLNPIPVVIGQRLNIKDGKGEIPTNLVGVGLN
                     LDDGADMKFIHGQLDFESFESVWKVLKQSLLDISNTPAVSMNNTDISNLSEVSIKLLF
                     SLADIKAGLNERYIREGFEQRFKKIEKLLRLQGIEINSDNIDVVFQYARPLNETDIID
                     NIKVLKELGVMSLQSAIENCPMIYDVGSEMERLGKERNGLDNTDIVNS"
     gene            complement(398514..400094)
                     /locus_tag="Dred_0375"
     CDS             complement(398514..400094)
                     /locus_tag="Dred_0375"
                     /note="KEGG: swo:Swol_1310 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABO48923.1"
                     /translation="MARTVKSTSDKLKIINADFKLWAKNFVKIVDNNGDEIPFILNEQ
                     QDYFYQNMDKFNIISKSRQLGFTTYSLAYCLWLACTRANTNCLIVSYNVESTQSIFER
                     LKQMYASIPDKYKPAEKRNNRIELLLENNSRIIVKTAGNKSLGRGMTLQYVLLSEFAF
                     YPDDQQRDSLVSLEQALAKNNDSKIVIETTSNGYNYYQKLFMSAYKGNSKYKSFFFPW
                     FSSAISKQFKHEIELAEKWFRANNKGHRMEPEHLERDEVALREKGISFKLLMWRRWKL
                     EDIDTEDFQQEYPSTPEESFKATSRSVFDTQKITERINYILLPLRVNEVNKKLSQTLD
                     SYLNKSFFIYRNVKSNERYFIGVDTSSGSGGDYSAVSVFDSQGEQIATFYDNKIPVYK
                     FAQVVYDIGMYFNYGFLVVEKNSFGQSVIEKLRTEFGYLNMYKMKQFDERGRKRYKIG
                     WVTTSVTKPKLISDYKEQFEMDLILLNDNETLEEMKIFTSYENGKTGNIRGEGFHDDM
                     VIASALAIQGMKSGKWYV"
     gene            complement(400105..400503)
                     /locus_tag="Dred_0376"
     CDS             complement(400105..400503)
                     /locus_tag="Dred_0376"
                     /note="KEGG: swo:Swol_1311 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABO48924.1"
                     /translation="MARYRNDLEEALSKISEKKRKYFRFKFNIPFQGRPMKQTTLEEI
                     CKYIGVRNLQYFDDWEATDEYKNLVNIYLNSKTANDLLEIYNSVSEKAKQGDAKAIDT
                     LLKLQKEIQANIKSAKRKEKDIADDDGLEL"
     gene            complement(400651..402690)
                     /locus_tag="Dred_0377"
     CDS             complement(400651..402690)
                     /locus_tag="Dred_0377"
                     /note="KEGG: pfa:PFL1645w hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABO48925.1"
                     /translation="MNIKCIIDNICYSSKPQGKECGAVTNRMTLDTAKEYSIEEIKDS
                     ILQGKTIRPSYCGTKEEQWKSQQMFMIDIDNEANLSDDIILNDYVKLVEGKKNKVRFL
                     VGSEQHRSYNDIINYCKEINLIPNFVYTSFNHKEEQHKMRLVYVLDNVITDKDTAKRI
                     QLYLMDCIGDIDIQCKNLNRFYYAGKEIVFDSGNILDSNDIIELSKDISIVSTPSKAN
                     KDNGSEKCPHNNNYVLNNKHIYYCGDENPPANDKKVKDNNYNIKAIKNRDIKYLKEKL
                     NHPHMVFNNNQEFCDYIFKEINLGELLEFHYPKNIRCIFHDDNNNSAGIIKQPDGTWI
                     YKCHSASCGVSYNLLGVIEVLGKFRSRPKAYKFIREIFNLEIAETEWQKEQKEIIEQN
                     LRAIDTGELEKKCPQAYKNIKSNIKYLRQLLYIAKDNVTTEKMTDDEDNVLFFASTRF
                     ICNSMGIKEGNIKEISKKNTLFAYHKLLNKVDNSEVPEDLLKRSQAISINSPDDKNKK
                     YRHVNYYSIPSYNNMLFPEIEQQGQAWKENNYTIKGLSREMFFRKEGQKTADWLYPQY
                     KQVYDKQQETIVDRTTTYRSDKRTEIIVHIIMWYFDEINYCLEKDIVCEIVLDQELRI
                     KRSEAERQLKKSLPEILDAYGLSRIRANKQIKEKLGIVAEGYPFIIVKNDALETL"
     gene            complement(402784..403617)
                     /locus_tag="Dred_0378"
     CDS             complement(402784..403617)
                     /locus_tag="Dred_0378"
                     /note="KEGG: swo:Swol_1313 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABO48926.1"
                     /translation="MKSNIKEMFPVWVNDNKYYDLILSNDLDSFFSCQLLEMIKGWKV
                     NFFNSDFKALGITENASNESDVIGVDLSLCSGKTFDNHVVMMNQDDDYNYNSANFNII
                     DRISRENYFSKYCGSTLLTIWSLYNIPLPKSEEAKMILLCIDSTFKGFYSPYPMPKEA
                     NKKYLVDYMDFPELYECLQRHKQYEFLNLISKYNLAGKIKPKQGYLHTDINLKALREV
                     FDLPFLLPKNRFYKKEEYETYVNRLPRNDYRLVKDDISECMYSIALTNRDFISYSERI
                     E"
     gene            complement(404147..405004)
                     /locus_tag="Dred_0379"
     CDS             complement(404147..405004)
                     /locus_tag="Dred_0379"
                     /note="KEGG: swo:Swol_1314 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABO48927.1"
                     /translation="MFTQDKFVAGQSIDMKDVLIQTTPILTPFTTLLLPKTVKAENAT
                     LNWIEEAINESAAVTLGEGADAPNPVDDTLAPISNYCELIGATATVSNTAQATNAKGI
                     SDLLAHEIVKKTKAMKIKMENILINGTKGYVSATKTYTTDGILAQINPVNQVTNATFT
                     KTKFEEVVSKMYDAGVNDEMLCFLPAQMKIQLNSFSNVEFLARDMFLGFDTERYVTPY
                     GIVTFVLSEKLNNKLFIVNPNYLELAELIPFHATVEPVSGSKQSIYLETQFGLKLLNT
                     KAAASFAIS"
     gene            complement(405036..405455)
                     /locus_tag="Dred_0380"
     CDS             complement(405036..405455)
                     /locus_tag="Dred_0380"
                     /note="KEGG: swo:Swol_1315 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABO48928.1"
                     /translation="MEWTPEQQQEINKMLVDAKNKWIEDELNPLKNQVKELEQFKPKE
                     KSDAEKALEQKEIELWQKEKNLILKENNLHEFADFFNAKNIEQLNKDIKKLNKILEAK
                     KLNNNYVPDGHKGKADSYTQAKKNNDTLGMVKALFSK"
     gene            406914..406986
                     /locus_tag="Dred_R0030"
                     /note="tRNA-Lys2"
     tRNA            406914..406986
                     /locus_tag="Dred_R0030"
                     /product="tRNA-Lys"
     gene            407452..409188
                     /locus_tag="Dred_0381"
     CDS             407452..409188
                     /locus_tag="Dred_0381"
                     /EC_number="2.7.1.40"
                     /note="PFAM: pyruvate kinase; PEP-utilising enzyme, mobile
                     region;
                     KEGG: chy:CHY_1144 pyruvate kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate kinase"
                     /protein_id="ABO48929.1"
                     /db_xref="InterPro:IPR001697"
                     /db_xref="InterPro:IPR008279"
                     /translation="MRKTKIVCTIGPASERLETINEMIKAGMNVARLNFSHGSHEEHA
                     KRITTIRCAAQEMGQNIAILLDTKGPEIRLGDFQEQPVLLEAGQSFFLTTEPIIGDQH
                     GVSVTYEDLSKDVKRGDRILVDDGLIELVVEAVEEKKIVCRVMNGGKVSNRKGVNLPD
                     IHVNLPAVTEKDIADIKFGIEQQVDFIAASFVRKAGDVLAIRKILEDDGAKIDIIAKI
                     ESREAVDNLDEIIQASDGIMVARGDLGVEIPAEEVPIIQKKIITICNQVGKPVITATQ
                     MLDSMIQNPRPTRAEASDVANAIFDGTDAIMLSGESANGKYPVEAVRTMDRIARRSEQ
                     ALSDGAKTYTNCFSVTDALGQAVCTVANQLDAAAIITATTSGYTAKMISRYRPQSAIV
                     AVTPDRGVMRRLSLVWGVVALPSPKLTNTDQMIATAVDTAVEQKVVKGGDLVVITAGV
                     PVGLQGTTNLMKIHTVGTIVSSGTGIVAQAVSGPVRVCNDAEEAARLEPGEILVTNGT
                     DAGFVPFLKNAAAIVAEEGGLTSHAAILGLELKVPTIVGAKGASGIFKNGEIITVDGQ
                     SGVIYRGNAKVF"
     gene            410002..411348
                     /locus_tag="Dred_0382"
     CDS             410002..411348
                     /locus_tag="Dred_0382"
                     /note="PFAM: acetyl-CoA hydrolase/transferase;
                     KEGG: dsy:DSY1711 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA hydrolase/transferase"
                     /protein_id="ABO48930.1"
                     /db_xref="InterPro:IPR003702"
                     /translation="MFESEYREKLVTPEEAVKVVKSGDWVDYMFFNGYPKALDRALAR
                     RKDELYGVHIRSGISLPPLPEVPQVDPTMEHFQWDSWHFGAFEAKLGDRGICSFSPLL
                     YHEVPGYYRRREVEVDVAMVRVCPMDKYGYFNLGINTSHIEAVCENARIVIVEENESM
                     PYVFGGNGNQLHISEVDFVVRGENEPMASIPAIEPTKSEIKIAEHILKEINDGCCIQL
                     GIGGLPNYLGKKIAEAGFRDLSVHTEMMADAYLEMWEKGCITGRKKEIDRKKMVCTFA
                     LGSPRLYEFMDRNPMIATYSVDYTNNPAVIAQISNMISINSCLEVDFYGQVTSEMQGT
                     RQLTGTGGQWDFVYGAYHSPGGKSFLCMPSTYLDKTGTLQSKIKPFLTPGAACTVSRQ
                     LTHYIVTEYGKALMKCQSVWKRTENLINIAHPDFREELIKEAEKLGFWKRTNRIEP"
     gene            complement(411459..413699)
                     /locus_tag="Dred_0383"
     CDS             complement(411459..413699)
                     /locus_tag="Dred_0383"
                     /note="KEGG: swo:Swol_0011 putative PAS/PAC sensor
                     protein;
                     TIGRFAM: PAS sensor protein; diguanylate cyclase;
                     PFAM: GGDEF domain containing protein; metal-dependent
                     phosphohydrolase, HD sub domain; PAS fold-3 domain
                     protein; PAS fold-4 domain protein; PAS fold domain
                     protein;
                     SMART: PAS domain containing protein; PAC
                     repeat-containing protein; metal-dependent
                     phosphohydrolase, HD region"
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase with PAS/PAC sensor"
                     /protein_id="ABO48931.1"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR000160"
                     /db_xref="InterPro:IPR000700"
                     /db_xref="InterPro:IPR001610"
                     /db_xref="InterPro:IPR003607"
                     /db_xref="InterPro:IPR006674"
                     /db_xref="InterPro:IPR013655"
                     /db_xref="InterPro:IPR013656"
                     /db_xref="InterPro:IPR013767"
                     /translation="MEYYQKTPPRKIPIQTKDSLLKIISELEQRLQQITNNMLDLYTE
                     TDLAGIIRYVGPSHKTILGYDPKALKGTSVFSRIHPKDISKVTDAFQTALNSASEIIV
                     EYQLQHATGHYLWVESVGRCLVEGDRRTGVVISTRNITKRKEFENALRESEFRFRQIT
                     ENMRDIIIQIDKCGTLTYVGPSVKFLLGYQPERLLGKKVFELLHSEDYDKTTKLFANS
                     LANYTEGEFECRCRHADGRYLWLECAGKILSNSHGQATGAIITARDITDRKMTKQALL
                     ASEERISRITENMLDIMVELNSEGITQYVSPSVKTVLGFDPKDLLGVPVFKNVHPEDL
                     DRVLEAYEKSINHWSCMRVDFRYKNAQGYYRWLELIGNILQDEHGSVSTSILCLRDIT
                     ERKWAELQTKYFSMHDPVTGLYNRTHFELEMRRLENSSEPVGLIVADLDGLKLINDTM
                     GHEVGDNALRAVANILKISYREEDIVARIGGDELAVILTNVSMDTLKVAVSRLEKNIK
                     DYNMENPGSHLSLSIGYALREPPTKPLNEVFKEADYYMYRAKLHHAKSTRSSLVQTLM
                     KALEARDFITEGHGDRMKSLVVNIGKALGLPENKIYDLQLFAHFHDIGKVGISDKILF
                     KPTKLTPDEHNEIKRHCEIGYRIAQASPELLPIADWILKHHEWWNGQGYPLGLKGEQI
                     PLECRILAIADAYDAMTSDRPYRKAISHQEAIRELERNAGIQFDLFLLPMAVKVIEQS
                     LAFSVD"
     gene            414092..416026
                     /locus_tag="Dred_0384"
     CDS             414092..416026
                     /locus_tag="Dred_0384"
                     /note="PFAM: histidine kinase, HAMP region domain protein;
                     Cache domain protein; chemotaxis sensory transducer;
                     KEGG: cac:CAC2821 methyl-accepting chemotaxis protein"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis sensory transducer"
                     /protein_id="ABO48932.1"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR004010"
                     /db_xref="InterPro:IPR004089"
                     /translation="MKSIKFIIVTITISITVLIFAAQTGLGFYHFKSILSTQIESSLK
                     TDVEKEAGFLNGKLDNVGKLARILAADLESLPQYNIELYEPIIKKYIQEEDLALGSGY
                     WLEPFIYNEQTEYYGPYIYKDNGNLQLTLDYSNQEYNYFQYDWYKNALNSDKKLCWSE
                     PYLDTVTNLTMMTISSSIKKDGRLIGATTVDVELKELQDYVSKIKVGQRGYAFIITSS
                     GYYMAHRDESKNLKVKITEEKDPQVQAMGNTIINATVSGTTENSINNSKYMVSYAPIG
                     QTGMKLVMVLPKEEATSVLAKFYTTNGISLLIALILFSVVLFLFINKVLTAPLKLIVL
                     EAQRISGGDLTIDAQGKLNRLSLLKNEIGQLAEAFQVMSHNVREIVSQIIDKSNTLAA
                     SSQQLNANAQQTSAGANETAVTITKIASTVGTVSENSQEVSQQAGQVVDYANNGYQGI
                     KSINKQMDIISSGSLQVNHSVVSTNNSINKINQFVEVIMKIADQTNLLALNAAIESAR
                     AGEAGKGFAVVADEVRKLAENTSQSTKEIQQLISEIAVESQNAVKAIEESEKEVRKGN
                     EIVNEVGNSFTEIITAINNLNEQIKHIALSTEQLNSGVENVAATTEEQTAAIEEVSAT
                     STQLSVIAEELTKLTNRFKI"
     sig_peptide     414092..414157
                     /locus_tag="Dred_0384"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.986) with cleavage site probability 0.959 at
                     residue 22"
     gene            416573..417394
                     /locus_tag="Dred_0385"
     CDS             416573..417394
                     /locus_tag="Dred_0385"
                     /note="PFAM: chemotaxis sensory transducer;
                     KEGG: cac:CAC0741 methyl-accepting chemotaxis protein"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis sensory transducer"
                     /protein_id="ABO48933.1"
                     /db_xref="InterPro:IPR004089"
                     /translation="MNSQKLQVLSEVLETIKDIFPMDCMISLTDREKFLKYLPGDKID
                     VKVKAGDKLAQGDAIDASLSTGKKSEVMVPVEVFGYPFKAVALPVIENGEVIGSVGVG
                     FDISAQEEVASVSETLAASTEEISSSVEEMAASAQQLTAMQTQLSAVAQETNSRLQKT
                     DEILKFIKDIAGQTKLLGLNAAIEAARAGEAGRGFHVVADEIRKLSDRSAVSVKDIAD
                     IVHEIRNNTNKLLEFVEKTNQISEGQSEATQYIAKAIEENARLAENLSNVSKNML"
     gene            complement(417644..418555)
                     /locus_tag="Dred_0386"
     CDS             complement(417644..418555)
                     /locus_tag="Dred_0386"
                     /note="TIGRFAM: pseudouridine synthase, RluA family;
                     PFAM: pseudouridine synthase;
                     KEGG: bce:BC1200 ribosomal large subunit pseudouridine
                     synthase D"
                     /codon_start=1
                     /transl_table=11
                     /product="pseudouridine synthase, RluA family"
                     /protein_id="ABO48934.1"
                     /db_xref="InterPro:IPR006145"
                     /db_xref="InterPro:IPR006224"
                     /db_xref="InterPro:IPR006225"
                     /translation="MVCANNQVVLCVEASQNGKFLRDFLKHKDISDRALKKLRNEGEI
                     LCNGAKVTWRTIVNTGDKVVLIYPIPPRNQYLPPEPLDLSIISEDEDIALVNKQPGMC
                     VHPTLAYPSGTLANGLVYHWLENNPAPTFHAVNRIDRNTSGLVLVAKNSYSAQKLFLQ
                     RKRKQLARSYVALVHGKIVQRNGYIDLPLEKCEGKTTKRQISSTGQQALTRFEVLQYI
                     TDCTLIRLMPETGRTHQIRVHLSHLGHPLVGDTLYGGSIAQIGRHCLHADKISFLHPR
                     TGHPMSFQIPLAEDMLQVITEMGRAKL"
     gene            complement(418539..419912)
                     /locus_tag="Dred_0387"
     CDS             complement(418539..419912)
                     /locus_tag="Dred_0387"
                     /note="TIGRFAM: MATE efflux family protein;
                     PFAM: multi antimicrobial extrusion protein MatE;
                     KEGG: bha:BH0860 multidrug resistance protein NorM"
                     /codon_start=1
                     /transl_table=11
                     /product="MATE efflux family protein"
                     /protein_id="ABO48935.1"
                     /db_xref="InterPro:IPR002528"
                     /translation="MKKTFSTKEKILQFMTILWPILITQISLSAMVMLDTVMSGNAGA
                     RDLAGVAIGSSLWVPISTGITGILLAVTPIIAQSVGAGRRDHVPFTVIQGSYLAIAIS
                     IIVLICGAIALKPVLNTMHLESPVRDIARRYLVGLSFGITPLFIYTIFRCFIDALGQT
                     RVSMFITLLSLPINILLNYVLIFGKLGFPRLGGVGAGYATAITYWCVFFIALYVLHRV
                     EPFSCYNFFKKWLGISFSAWRTQLKLGIPIGFSIFFETSVFSGVTLLMSQYNTVTIAA
                     HQAALNFASFLYMVPLSISMALTITIGFEVGAQRYSDAKQYSLLGLGIAVGMAVCCGI
                     GLLLFGDQVAGLYTKDQTVFKLTQQFLVYALFFQLSDAIATPVQGILRGYKDVNVSFI
                     VALASYWVIGLPLGHILSLYTPLAAFGYWVGLIVGLAIGATSLLIRMVIVQRNAAMGG
                     KKIGLCK"
     gene            420057..421196
                     /locus_tag="Dred_0388"
     CDS             420057..421196
                     /locus_tag="Dred_0388"
                     /note="PFAM: purine catabolism PurC domain protein;
                     KEGG: cac:CAC1426 possible transcriptional regulator from
                     leucine-rich protein (LRPR) family"
                     /codon_start=1
                     /transl_table=11
                     /product="purine catabolism PurC domain protein"
                     /protein_id="ABO48936.1"
                     /db_xref="InterPro:IPR012914"
                     /translation="MGVSIRDTLSLDILKGAKVIAGQRGFNRLIKRVSVIECPDCQDY
                     KELLREGDFFLTSFYAVKDDPGLLAITVSTIIESGSSGLCLLDLYMEDLPEEIKALAN
                     RKNFPIIMISKDLPYAEIITEIMDLIIQNKENIIVEMQVDKLLLEKDGSSIKGLALQI
                     NNKFCNNVAAIFITSKQGVKRRLLNLKESFQGQESWSVISYKRGILLLISTPYQVENH
                     QSIKELNSIIQTIEGTTKNYYLGISRHYSGLENLGLCIKEAMHANELGEKVLEQKITM
                     YKDLGVYRVLSVVKETPELKEFHDEIILPLQEYDRKNNMNLFKTAVSYIENDGDVNKT
                     AQELFQHRNTIRYRLMKIKEILKMEGLEGSFYEQLSVAIKIHKML"
     gene            421425..423008
                     /locus_tag="Dred_0389"
     CDS             421425..423008
                     /locus_tag="Dred_0389"
                     /note="PFAM: extracellular solute-binding protein, family
                     5;
                     KEGG: chy:CHY_1128 oligopeptide/dipeptide ABC transporter,
                     peptide-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="extracellular solute-binding protein, family 5"
                     /protein_id="ABO48937.1"
                     /db_xref="InterPro:IPR000437"
                     /db_xref="InterPro:IPR000914"
                     /db_xref="InterPro:IPR001680"
                     /translation="MSNKRTKLMVAIVLLVFALTVVTGCGGGNQGGSGGQKAKIAYYA
                     FNSEPVLDWDPSVEFSNGIAVMNNIYETLLRFDPEQNKIIPILAEEYSKSEDGLTWVF
                     KLRKGVKFHDGTEMKADAVKYSIERTKKINKGAAYIWDSVKEINIKDDYTVEFKLSYA
                     APVDLIASCGYAAFIMSPKIAEQPEGWFSQGNEAGTGPYKLQSTKKGEEVVLTRFDEY
                     WKGWEGNHFDKVIVKKVPETASRRQLVEKGEADVTIELPYEDVEALKNNADVQILDAP
                     AFQNLFFCFNTEKEPLNNKLVRQALSYAFPYEDVVKYAMGNYATQAKGPIPYGHWGHG
                     DNLFQYKHDLNKAKELLAQAGIPNGGFKLLLTYMSGDEAEKKTAELYKAELAKLNIEL
                     EVRGMPWDSQWELAKSKDAKSRQDILGMYWWVDYASPYSWLYSLYHSEKDPLFNLNYY
                     KNEKFDQLIDEANSKSGIDRAAAEQMYIEAQKMLIEDAPSIFTYDKKYVWVHNKQFKG
                     LKSNAAYPNTIFFYDTYRE"
     sig_peptide     421425..421532
                     /locus_tag="Dred_0389"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.351 at
                     residue 36"
     gene            423125..424135
                     /locus_tag="Dred_0390"
     CDS             423125..424135
                     /locus_tag="Dred_0390"
                     /note="PFAM: binding-protein-dependent transport systems
                     inner membrane component;
                     KEGG: sbo:SBO_1571 putative transport system permease
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport systems
                     inner membrane component"
                     /protein_id="ABO48938.1"
                     /db_xref="InterPro:IPR000515"
                     /translation="MRSFILKRLGLGVLVLLGVITVTFFITRVIPSDPAAKWVGPRAT
                     PQQIEAARVELGLDQPLFIQFGKYVTDLSQGDFGKSLRSHQPVAEELKAYLPATIELV
                     VLSTIIAIFVGIPLGVLSARRKDQLVDHFSRIFSVGAVSLPTFWVGLFLQLLFYRHLG
                     FLPLGDQLSTDIKLLYEVPHITGFLLFDSFITGNFVILQDVLIHMILPGITIALYPLG
                     LVARMTRSALLEILNEDYISAARSYGLPEGLVLWKYALKNSLGPTVTVVTLSIGYTLV
                     NTFLIEAIFSWPGIGSYISSAVISLDYPAIMGVTIFSAIAYVFLNLVADFIIALDPRV
                     RT"
     sig_peptide     423125..423223
                     /locus_tag="Dred_0390"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.565 at
                     residue 33"
     gene            424148..425035
                     /locus_tag="Dred_0391"
     CDS             424148..425035
                     /locus_tag="Dred_0391"
                     /note="PFAM: binding-protein-dependent transport systems
                     inner membrane component;
                     KEGG: mlo:mlr6673 peptide ABC transporter, permease
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport systems
                     inner membrane component"
                     /protein_id="ABO48939.1"
                     /db_xref="InterPro:IPR000515"
                     /translation="MSLTVVKALKPRIKEMRFSLYLLNRNKLTRLSLIIVLALLVMAM
                     VAPLIVPYPQHISLETNPHDKLLAPSAQYFFGTDELGRDIFSRVLYGTRISLQTALLA
                     VGLALCIGIPLGAIAGFFGGFIDELIMRITDIFLSFPPLLLAITIAAFMGPSLHNAML
                     AIALSWWPWYTRLIRGQAVSIRERQFVKAARAIGTPPFKIIFNHIVPNCIAPVIVQAS
                     MDIGGVILTIASLSFLGLGAQPPTPDWGLMVSTSRNYFLNAWWYSIFPGLAIFITVLV
                     FNLLGDGLREIMDPKTRKL"
     sig_peptide     424148..424279
                     /locus_tag="Dred_0391"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.939) with cleavage site probability 0.602 at
                     residue 44"
     gene            425048..426022
                     /locus_tag="Dred_0392"
     CDS             425048..426022
                     /locus_tag="Dred_0392"
                     /note="KEGG: cte:CT0655 peptide ABC transporter,
                     ATP-binding protein;
                     TIGRFAM: oligopeptide/dipeptide ABC transporter, ATPase
                     subunit;
                     PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
                     transporter, C-terminal domain protein;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="oligopeptide/dipeptide ABC transporter, ATPase
                     subunit"
                     /protein_id="ABO48940.1"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010066"
                     /db_xref="InterPro:IPR013563"
                     /translation="MNHYFEIKDLKVGFKTFEGQKRVLDIEHLAIQKGEAYGLIGESG
                     SGKTVLALTILKLLTMPPAIVESGKILFNGMDLITKSEHDMRLIRGKKISMIFQDPMS
                     TLNPVFTVGEQLRQVIQHNRGVAKKEAAKIALETIDLVKLPDAKSIIDKYPHELSGGQ
                     RQRIIIAIALSCGAELLIADEPTRNLDVTIQAGILKLIAELQRELKVSVLFIANNPGL
                     VSAVCNHVAILQEGKIVEKGTVRDVLRNPIHPYTTALLNTIPKSKKEKIDLKKLIATD
                     GAECNGGCTYYARCLKRQGNCQNQSPTLHPIEGTHFVACHLGLEGSEP"
     gene            426022..426993
                     /locus_tag="Dred_0393"
     CDS             426022..426993
                     /locus_tag="Dred_0393"
                     /note="KEGG: sth:STH2823 oligopeptide ABC transporter
                     ATP-binding protein;
                     TIGRFAM: oligopeptide/dipeptide ABC transporter, ATPase
                     subunit;
                     PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
                     transporter, C-terminal domain protein;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="oligopeptide/dipeptide ABC transporter, ATPase
                     subunit"
                     /protein_id="ABO48941.1"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010066"
                     /db_xref="InterPro:IPR013563"
                     /translation="MSTPLLQVKDIKKHFPLRGDFLAKPTAWVKAVDGISFELEKGEV
                     LGLVGESGCGKTTLVNVLLRLEEPTAGEVCFEGKNIFALNQKELRKLREHLQIVFQDP
                     FWSLNPRLLIRDIVGEPLKVHGNPSTEELAEKVAELLEMVGLPRDGVYKYPHEFSGGQ
                     RQRIAIARSLALRPKFIVLDEPTSSIDVLSQAQILDILKDIKDQFGLTYILISHDLSV
                     VNYMSDKIAVMYLGKLVEYGSADEVFNNPAHPYTRALFAAIPDIETEGVDSLVTLDEN
                     VPSAINPPAGCRFHTRCPEATPICQSKEPVLKNLGNQHLAACHKNNN"
     gene            427026..428069
                     /locus_tag="Dred_0394"
     CDS             427026..428069
                     /locus_tag="Dred_0394"
                     /note="KEGG: pho:PH1046 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABO48942.1"
                     /translation="MAKFYEYELQKAADVLMRHMFNLKPGETIVITADSESDERVVNA
                     TASSAFAVGAKPMVIWLPAPQGVGKAADPMLPVEALAGALSHADAWVEFNNQWLLYST
                     PFEMAFEKNKKLRYICLVGMDVDMMVRVIGRVDAKALSLFQHRVTDITAQAKRMRITT
                     PAGTDLEYEFVPSRKIICDDGDVSTPGVHMLGGQISFFPDSESINGTLVFDGSLVPPC
                     GLLKEPVVMKVDKGRVVEISGGQQAMEFKAWLESFDDPNMFRVAHGCYGFNPGAKLTG
                     NILEDERVWGCTEWGLGYLSAEDGPPDGINAKSHCDGICLNSSVWLDGEQIMDKGAIV
                     HPELKEMAERIKK"
     gene            428088..429197
                     /locus_tag="Dred_0395"
     CDS             428088..429197
                     /locus_tag="Dred_0395"
                     /note="PFAM: protein of unknown function DUF917;
                     KEGG: pat:Patl_3468 protein of unknown function DUF917"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF917"
                     /protein_id="ABO48943.1"
                     /db_xref="InterPro:IPR010318"
                     /translation="MKKLSKQDLYDILYGCTILGTGGGGALQEGLTMIDDALDRGKEF
                     ILVDLSEVPDDAYIATPYMCGAISPLTEEEERKYVGLAVLDEEPSLRAFRAMEEYMGK
                     EFYGVVSTELGGGNTAKAFYVGAMAGKYIIDADPAGRSVPELQHSTYYINNLPIAPMA
                     VANEFGDVVILKEVANDLRAEALVRAMAVVSKNSIGVVDHPASAKDLRKAVIPGAITY
                     ALKLGQAYREAREENNDLAEALCKAGKGYLLFKGTVKDFGWDTIDGFTVGETYLEGTG
                     DYTGSTYKIWYKNEHIIAWRNGEVDVTVPDLICMVCEDNKEPVTNPNYQIGMNVAVFA
                     LPAPAEWRTEKGLDCFGPKHFGYNIEYLPVEKKIG"
     gene            429213..430229
                     /locus_tag="Dred_0396"
     CDS             429213..430229
                     /locus_tag="Dred_0396"
                     /note="KEGG: mta:Moth_2293 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABO48944.1"
                     /translation="MIKTEEIRSGVVSMFKVNMGLKTGEKVLIVNDVPRPEEWQMNYG
                     EISDMATRSLFARKVYDIAREEFTGNQIDYMVFPSTGQSGKEPSQDVAERFLEYDVII
                     LLTSHSLSHTNTRERATQRGARVASMPGIEYAMFLADGPMAVDYEEIRRETETIAAML
                     TKAKTARVTTDLGTDLTFSIENREGGPDSGIYDVKGEWGNLPGGEAFTAPVEGTANGK
                     LVVPKGWYPGLEEDMVLEFKDGYVVSLQGGGKVGEEFTKLFSFGDESFKHRRNCAELG
                     IGTNPKAKKPDNVLEAEKIKGTIHIAVGDSSHMGGVTESDLHEDFVLPHPRLYLDGAL
                     VIGK"
     gene            430589..431017
                     /locus_tag="Dred_0397"
     CDS             430589..431017
                     /locus_tag="Dred_0397"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ABO48945.1"
                     /translation="MVLNISQTLLVNKKIIVHGTVFGIINTLGVYVIHSVRTDKSLLF
                     LVFGMLLIILNSWFYMIYCYKHGHYLADKEKCILGILYIGILAVSNIISGNKLLFYQV
                     ALDITPFSVLMQLAVIPILSCMVTMLLCKQEYLIKEEDCQ"
     gene            431235..432833
                     /locus_tag="Dred_0398"
     CDS             431235..432833
                     /locus_tag="Dred_0398"
                     /note="TIGRFAM: peptide chain release factor 3; small
                     GTP-binding protein;
                     PFAM: protein synthesis factor, GTP-binding; elongation
                     factor Tu, domain 2 protein;
                     KEGG: cac:CAC0630 peptide chain release factor RF-3"
                     /codon_start=1
                     /transl_table=11
                     /product="bacterial peptide chain release factor 3
                     (bRF-3)"
                     /protein_id="ABO48946.1"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR004548"
                     /db_xref="InterPro:IPR005225"
                     /translation="MSDFQKEIQRRRTFAIISHPDAGKTTMTEKLLLYGGALRLAGTV
                     KSRKSKQHAVSDWMELEKQRGISVTSSVLQFEYKDCKINILDTPGHQDFSEDTYRTLM
                     AADSAVMLIDAAKGVEEQTKKLFHVCRKRGIPIFTFINKMDRHGKEPLDILDELEKVL
                     DIKSYPMNWPIGRGKEFRGIYERATSKIELFTGAGHGTTIVPTKVGDLSDPAIVETMS
                     ESVYELLKEDLELLDLAGDAFNMDLVSRGELTPVFFGSALTNFGVGAFLDSFIKMAPA
                     PHEKESSVGVIQPNQSEFSGFVFKIQANMDPAHRDRIAFVRICSGVFHRGMTVKHVPS
                     GKTIRLAQSKQFMAQDATTIDEAYPGDIIGIFDPGIFRIGDTLTEKSSFSYEAIPKFQ
                     PELFARVHLRDAMKRKQFVKGIEQLTNEGAAQRFRNPDIGLESPIIGAVGVLQFDVLE
                     HRLTHEYGVDISLEHLPFTLARWAVGVNLTPRDLKSMDNMVVQDDDDNFVVLFRNEWA
                     FNWEAERHKEVSYLEHPPTKGTAL"
     gene            432994..435081
                     /locus_tag="Dred_0399"
     CDS             432994..435081
                     /locus_tag="Dred_0399"
                     /note="KEGG: swo:Swol_1487 sigma-L-dependent
                     transcriptional regulator;
                     TIGRFAM: PAS sensor protein;
                     PFAM: CBS domain containing protein; sigma-54 factor,
                     interaction domain-containing protein; PAS fold-3 domain
                     protein; PAS fold-4 domain protein; PAS fold domain
                     protein;
                     SMART: PAS domain containing protein; AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="putative PAS/PAC sensor protein"
                     /protein_id="ABO48947.1"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR000700"
                     /db_xref="InterPro:IPR002078"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR013655"
                     /db_xref="InterPro:IPR013656"
                     /db_xref="InterPro:IPR013767"
                     /translation="MKVREINTLHSIALSPEQTVQEVVGIFLKHQVDGAPVIDAEGKI
                     MGLFTKDQIYRLVNEGLNVNTSVAELMIPADKIGHLDDELEDLLNEDFEWLPIVDEDR
                     VTSMITRSNLSKVFFDFYRAISCELETIINSTINLIVSVDKEGKINVFNKAAEKFLGK
                     EAQEVKGKNIAEIFPNSGLAEVVRTGNVELLQKVKLNDNDYISNRSPIIKDNKVIGAV
                     AVLQCISEMEKVSRELESVKELNEELQAIIESSFDGLYITDGKGLTLRLNKAYERITG
                     LKAQEFLGRYAEDIMKEGVVSESVAVLALKRRETVSIIQEYRAGKTTLATGNPVFDKN
                     GNIFRVVCNVRDITELNQLNKELEQARGLSQHYQSQLRTMSYFGSDRIVIKSEKMKDL
                     LGLIIRLAGVDSTILITGESGTGKELIAETLYINSNRRDGPFIKLNCGAIPENLLESE
                     LFGYESGAFTGASKEGKAGYFELANGGTLFLDEIGELPLNLQVKLLRVLQSREIVRVG
                     GKKPLKINIRILAATNRNLKDMVDKKEFREDLYYRLNVVPVNVPPLRERKEEITSFVT
                     HFMLIFNRKYKVNKRITPEVVDLFLRYDWPGNIRELENLIERLIVITTGNLLTINDLP
                     ANIKGNNPDNLASVQVSCLMPLKDAVESVEKQVLERAYAEFRTIRQMAETLKVSAATV
                     VRKAAKYGITQEL"
     gene            435752..436930
                     /locus_tag="Dred_0400"
     CDS             435752..436930
                     /locus_tag="Dred_0400"
                     /EC_number="2.3.1.9"
                     /note="KEGG: chy:CHY_1604 acetyl-CoA acetyltransferase;
                     TIGRFAM: acetyl-CoA acetyltransferases;
                     PFAM: Thiolase"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA acetyltransferase"
                     /protein_id="ABO48948.1"
                     /db_xref="InterPro:IPR002155"
                     /translation="MKETVIVSAARTPFGRFGGGLKSLKAVDLGGIAIAEAIRRAGVS
                     SEQIDYVYMGQVLQGGCGQVPSRQATRKAGLPWEVPSITVNKVCSSGLITVSLADKAI
                     RLGEIDIAVAGGMESMSNAPYFLPGMRWGSRMMNSSAVDLMVNDGLWCSFYDRHMAIH
                     GSEVASEFGLSREAQDEWALRSQLYASDAIKAGRLKEEIVPVELKSKKGTTIVDTDEG
                     PRADTTMEGLAKLPPVFDKNGTVTAGNAPGVNDGAGALVLMSRDKAMELGIKPLATIV
                     GHAEVSQEARYIATVPGLSTMKLLQQKGMSIDDIALIEANEAFAAVALTSGKITNWDT
                     KRVNVDGGAIAFGHPIGASGARILMHLAFALRARGGGYGIACICSGAAQGDAMMIKVE
                     "
     gene            436982..437764
                     /locus_tag="Dred_0401"
     CDS             436982..437764
                     /locus_tag="Dred_0401"
                     /EC_number="4.2.1.17"
                     /note="PFAM: Enoyl-CoA hydratase/isomerase;
                     KEGG: ctc:CTC02427 putative crotonase"
                     /codon_start=1
                     /transl_table=11
                     /product="short chain enoyl-CoA hydratase"
                     /protein_id="ABO48949.1"
                     /db_xref="InterPro:IPR001638"
                     /db_xref="InterPro:IPR001753"
                     /translation="MEWNTLFLEKEGNIALLTINRPKALNALNPEVLTELGQAVDVIT
                     ADDEIFVVILKGAGEKAFVAGADITAMKDMTALESRAFGILGQEVFKKLEYMPKPVIA
                     AINGFALGGGCELAMACDIRVATEKSKFGQPEVGLGVTPGFAGTQRLPRLVGKGRAKE
                     LLYTADMISAADAHRIGLVNHVVAEDQLLEFCKSMAKRIATKGQIAVRLCKAAVDQGL
                     EMDVDKSMAFEADIFALCFATSDQKEGMTAFVEKRKPNFIGK"
     gene            437819..438961
                     /locus_tag="Dred_0402"
     CDS             437819..438961
                     /locus_tag="Dred_0402"
                     /note="PFAM: acyl-CoA dehydrogenase domain protein;
                     Acyl-CoA dehydrogenase, type 2, C-terminal domain;
                     KEGG: chy:CHY_1602 butyryl-CoA dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase domain protein"
                     /protein_id="ABO48950.1"
                     /db_xref="InterPro:IPR006089"
                     /db_xref="InterPro:IPR006090"
                     /db_xref="InterPro:IPR006091"
                     /db_xref="InterPro:IPR006092"
                     /db_xref="InterPro:IPR013107"
                     /translation="MDFRLNDEQQMFRDTIRKFAQKEIAPIAAQTDSTHQFPLETLKK
                     LADMGLMGLPIPEEYGGAGSDYVTFAILVEEIAKVCASTAVILSVHTGLGCMSTYMFG
                     NEEQKERYLKPLCEGKMLGAFALTEPQAGSDAAALKCTAVRKGDKYILNGSKIFITNG
                     GYADMYVTFVRTDPSTKNYNGVTCLIVDKDTPGLVIGKPEEKMGLNGSATVTLTFEDA
                     EVPVENRLLEEGKGFNVAMGLLNGGRITIGAQGLGIAQGALDLTIPYVKGREQFGKPL
                     SAQQGIQFMLADMATEIDASRLLIYRAAWLKSNGLEHAMEASMAKRFATDTAMRVTTD
                     CVQLFGGYGYCKEYQIERYMRDAKITQIYEGANQIQRLVIAKQLLK"
     gene            439009..439989
                     /locus_tag="Dred_0403"
     CDS             439009..439989
                     /locus_tag="Dred_0403"
                     /EC_number="2.8.3.12"
                     /note="PFAM: coenzyme A transferase;
                     KEGG: dsy:DSY1569 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Glutaconate CoA-transferase"
                     /protein_id="ABO48951.1"
                     /db_xref="InterPro:IPR004165"
                     /translation="MAKTNKRMSLTEAISMINDGDMLTFSGFTIWRRPMAAIYEIVRQ
                     QKKNLHLVEVNSGTHSEVLIGAGCVKVWESCWIGHELFGKLGANLARKVKTGELIVND
                     YSHVHMVLRLMAGAMGVPYLPTAASMGTDILNPEFDTLANNGLRNGENPKIPAQKYEF
                     AKDNFFDMGELLHIPAARPDVCIMLVQQVGEEGTVRISGQKYTDEEAAKAADKVIVIA
                     EEVVPEEYLRREPDRNLLPPYMVDAIVELPMAGHPTGCYGRYEVDGDFMRNFYSSTKT
                     QEGFDAWAKEWIFDVKDHFEYLEKLGVKRLEALRANSALSYSNKVKRGAR"
     gene            439990..440799
                     /locus_tag="Dred_0404"
     CDS             439990..440799
                     /locus_tag="Dred_0404"
                     /EC_number="2.8.3.12"
                     /note="PFAM: coenzyme A transferase;
                     KEGG: swo:Swol_1481 glutaconate CoA-transferase"
                     /codon_start=1
                     /transl_table=11
                     /product="Glutaconate CoA-transferase"
                     /protein_id="ABO48952.1"
                     /db_xref="InterPro:IPR004165"
                     /translation="MSSHEFAKPGEYKIIDLLAVSAAREVNDGEVVFAGTGLPMLAIM
                     LAQKTTSPGAYCIYEAGSVDGRPIHLPASVGDARCVYGGAIASGLFDVFNQLHRGKVD
                     LAFLGGAEIDKYGNVNTTAMGDYLKPSARLTGSGGNADINSLAKRTVFMMVQEKRRFV
                     DNVSYVTSPGWKIPKFPGREFVPKQEIYGKFHRGGPSAVITNMGVFRFDQETGKMYLD
                     TVHPGFSAQDVKDNCSFDLDISRVSGETKPPTYHELELLYKVIDPEGIFLP"
     gene            441378..442989
                     /locus_tag="Dred_R0031"
     rRNA            441378..442989
                     /locus_tag="Dred_R0031"
                     /product="16S ribosomal RNA"
     gene            443221..446812
                     /locus_tag="Dred_R0032"
     rRNA            443221..446812
                     /locus_tag="Dred_R0032"
                     /product="23S ribosomal RNA"
     gene            444586..444939
                     /locus_tag="Dred_0405"
     CDS             444586..444939
                     /locus_tag="Dred_0405"
                     /note="PFAM: S23 ribosomal protein;
                     KEGG: chy:CHY_0463 intervening sequence, 23S rRNA"
                     /codon_start=1
                     /transl_table=11
                     /product="S23 ribosomal protein"
                     /protein_id="ABO48953.1"
                     /db_xref="InterPro:IPR008815"
                     /translation="MIKDYHDLEVYKRGYKLALQIHKTTKGFPQHELYEIGSQIRRAT
                     VSIPLNIAEGYGRKNYVDDFKRFLINALGSCNEVAVLLDMIKDLGYISDQYEGFKEEY
                     DYLGRQLNKLIQTWK"
     gene            447000..447116
                     /locus_tag="Dred_R0033"
     rRNA            447000..447116
                     /locus_tag="Dred_R0033"
                     /product="5S ribosomal RNA"
     gene            447503..448507
                     /locus_tag="Dred_0406"
     CDS             447503..448507
                     /locus_tag="Dred_0406"
                     /EC_number="4.4.1.15"
                     /note="KEGG: pol:Bpro_2169 pyridoxal phosphate-dependent
                     deaminase;
                     TIGRFAM: pyridoxal phosphate-dependent enzymes, D-cysteine
                     desulfhydrase family;
                     PFAM: Pyridoxal-5'-phosphate-dependent enzyme, beta
                     subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="D-cysteine desulfhydrase"
                     /protein_id="ABO48954.1"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="InterPro:IPR005966"
                     /translation="MNLAKFTRRRYTEGQTPIEFLPNFTKALEGPNIYIKRDDQLGLT
                     SGGNKTRKLEFLVADALAQGADTLITCGAVQSNHCRLTLAAAVKEGLKCRLVLEERVP
                     GSYKPEASGNNFLFNLLGVEKVKVVSGGSDMMKEMQIVADELAAEGRKAYIIPGGGSN
                     EIGSLGYVACAQEIFAQLFEKGLKIDHIVTPSGSAGTHTGLVTGFYGNNCNIPITGIS
                     VSRKKHDQEELVYSVIQKTAALLEIKQEIPREAVSVYDDYVGPGYSLPTPEMVEAVQL
                     LARTEGILLDPVYTGKAMSGLIGLVRKGFFKKDQNVLFIHTGGSPALYAYTSTILGND
                     "
     gene            448685..449725
                     /locus_tag="Dred_0407"
     CDS             448685..449725
                     /locus_tag="Dred_0407"
                     /note="TIGRFAM: TRAP dicarboxylate transporter, DctP
                     subunit;
                     PFAM: TRAP dicarboxylate transporter- DctP subunit;
                     KEGG: dps:DP1510 DctP (periplasmic C4-dicarboxylate
                     binding protein)"
                     /codon_start=1
                     /transl_table=11
                     /product="TRAP dicarboxylate transporter, DctP subunit"
                     /protein_id="ABO48955.1"
                     /db_xref="InterPro:IPR000437"
                     /db_xref="InterPro:IPR004682"
                     /translation="MSKITKMFSLMLILVFGVFSLVGCTSGGKEQAGGDKAKESEPVV
                     IKLAHENVPKHPMGQAFIKFKELVESRSNGAIKVDLYDSGKFGNAREIVEGLQTGQIQ
                     MGSSSTPNLAPFSKDFLIYDLPFLFPDYESTDKVTDGPIGKKAAAALESSNIKGLGYI
                     EIGFRHIFNNAKPVNTMADLKGLKIRSTASKAHIATLKGLGANPTPVAWGEVYTALQQ
                     KTVDGIDIDLNLAWFNNFQEVNKNLTLVNSIYSPHLVMINKAFFEKLTPENQKIVTEA
                     FEEIKVYERKLIRDNEKMIIGKMKEAGVNVVELTPEERQKWADATAGVYDEFGGDIGK
                     DLIEQVRETVKK"
     sig_peptide     448685..448783
                     /locus_tag="Dred_0407"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.734 at
                     residue 33"
     gene            449805..450332
                     /locus_tag="Dred_0408"
     CDS             449805..450332
                     /locus_tag="Dred_0408"
                     /note="PFAM: Tripartite ATP-independent periplasmic
                     transporter, DctQ component;
                     KEGG: dps:DP1511 DctQ (C4-dicarboxylate permease, small
                     subunit)"
                     /codon_start=1
                     /transl_table=11
                     /product="Tripartite ATP-independent periplasmic
                     transporter, DctQ component"
                     /protein_id="ABO48956.1"
                     /db_xref="InterPro:IPR007387"
                     /translation="MSTSKLKLIYNRIDEYLSSAFLCGMILIIAMQVFNRYVLQHSLD
                     WSEELGRYLFIWSVYVGCSYAMKEDRHLEVTIFRHMFGPKVERGLITVAYSLTIAFCL
                     FCVVYGIKMLLFLLETGQLSPALEISMFWIYLAIPVGMGLMAIRTFERIWGMYFNSDI
                     KFYNEADEFIDREVK"
     gene            450336..451619
                     /locus_tag="Dred_0409"
     CDS             450336..451619
                     /locus_tag="Dred_0409"
                     /note="TIGRFAM: TRAP dicarboxylate transporter, DctM
                     subunit;
                     PFAM: TRAP C4-dicarboxylate transport system permease DctM
                     subunit;
                     KEGG: dps:DP1512 DctM (C4-dicarboxylate permease, large
                     subunit)"
                     /codon_start=1
                     /transl_table=11
                     /product="TRAP dicarboxylate transporter, DctM subunit"
                     /protein_id="ABO48957.1"
                     /db_xref="InterPro:IPR004681"
                     /db_xref="InterPro:IPR010656"
                     /translation="MTIALVFISLAIFLLLSIPIGISIGLSVLVGMIVGQDLPTAFLI
                     QKMIASLDSFPLLAVPFFIMAGEIMQKGSMAQRLLAVSRTLVGHITGGMAHISVLTCM
                     FYGALSGSAPATVAAVGGIMIPSMEKEGYDKPFSTAVNTAAGCLGVMIPPSVPLIIYG
                     TTAGVSVGDLFIAGVIPGLFVGMFLMATSYIISKKKGYKGSGQRSNFKDMLKALNEAK
                     FALVVPVIVLGGIYGGLTTPTEAGVIAVIYAFLAEGFIHRALNWSKVYEVIRGSALTT
                     ASIFLVVATATGLGQILMFYNVPDLLVNFLVGISENKYVLMPIILLFLVVMGTFMDAL
                     ANILILTPLLLPVVQKIGIDPVHFGIVMIVVISMGFLTPPVGVNLFVGCGISKLRIEV
                     LSKAVIPFLIAMFIAVLALAFIPQITLWLPSLMVS"
     sig_peptide     450336..450443
                     /locus_tag="Dred_0409"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 0.906) with cleavage site probability 0.649 at
                     residue 36"
     gene            451753..452988
                     /locus_tag="Dred_0410"
     CDS             451753..452988
                     /locus_tag="Dred_0410"
                     /note="KEGG: dps:DP1513 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ABO48958.1"
                     /translation="MKVSLSREKKGILAVAGHVGCGHCHGHGNQAQDDSAGLATVLKL
                     FQEATDVSLIIKDIRIKTGLNGYIEVETEDGGYGKSVPRRGITPNEARLAKTLIGRKA
                     FCSQTLVLEAFGRFYGQGISETPVSLQTAISNAALDTFVKCYPSEFKFGYEDLDGSCG
                     LIAGAVLDFDGIPVSVLGTVNASINGIGPNEDMEGNSAIGKKGEIMAELGMVTLPTVV
                     IEAKVHNELFSKVLNEGTFLVKADKQQDNPFVAHSIFNAANDLNFPVIIREDVMARVP
                     GGMEKQTRELANKIVCLGENLKNAQFSQEKLNILAELALLISQDGGGISFMSNKLHEI
                     IGGAGTLQGTSAVINYCVPSEYYKEYLIPFITEDDLQKYVMLTKQAVKELFKVLPDAV
                     EHAQKHCCSSSLEDLVLKS"
     gene            453221..454147
                     /locus_tag="Dred_0411"
     CDS             453221..454147
                     /locus_tag="Dred_0411"
                     /note="PFAM: regulatory protein, LysR; LysR,
                     substrate-binding;
                     KEGG: mta:Moth_1877 transcriptional regulator, LysR
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, LysR family"
                     /protein_id="ABO48959.1"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /translation="MLLSLYQFHIFKTVADKKSFSGAAQALYISQPAVSMHIKALEDH
                     FRTKLFDRNTQQVTITEAGRILYKYADKILNLIDQAENDISRFTGNIEGPLSIGASFT
                     VGEYVIPKILGTFNKEHPQVRALLQVTNTEQIVNLVLKQEIDLGLIENQVNKTELVAK
                     PFLQDELIIVIPPDYPLSEHQFISMEDLVALPLVMREQGSGTRKITEARLIEEGVDLN
                     TLNIVMELGSTEAVKEAVEAGFGTTIISKWAVQKELKLGTLVPVRFKDISLFRKFYLI
                     YHRDKFQTTVVEEFITFLISFCSGITSIKTSS"
     gene            454527..454910
                     /locus_tag="Dred_0412"
     CDS             454527..454910
                     /locus_tag="Dred_0412"
                     /note="TIGRFAM: putative endoribonuclease L-PSP;
                     PFAM: Endoribonuclease L-PSP;
                     KEGG: cpr:CPR_1089 putative endoribonuclease L-PSP"
                     /codon_start=1
                     /transl_table=11
                     /product="endoribonuclease L-PSP"
                     /protein_id="ABO48960.1"
                     /db_xref="InterPro:IPR006056"
                     /db_xref="InterPro:IPR006175"
                     /translation="MTKKIIKTQNAPGAIGPYSQATLVGDFLFVSGQLPINPENGQMP
                     DGDVQAQTRQSIKNIKGIIEAAGGTLQNVVKTTVFLKDMNEFALMNEVYAEFFSENPP
                     ARAAVEVARLPKDARVEIEAVVYLG"
     gene            454986..455990
                     /locus_tag="Dred_0413"
     CDS             454986..455990
                     /locus_tag="Dred_0413"
                     /EC_number="3.5.99.7"
                     /note="KEGG: pol:Bpro_2169 pyridoxal phosphate-dependent
                     deaminase;
                     TIGRFAM: pyridoxal phosphate-dependent enzymes, D-cysteine
                     desulfhydrase family;
                     PFAM: Pyridoxal-5'-phosphate-dependent enzyme, beta
                     subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxal phosphate-dependent enzyme, D-cysteine
                     desulfhydrase family"
                     /protein_id="ABO48961.1"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="InterPro:IPR005966"
                     /translation="MNLAKFTRRRYTEGQTPIEFLPNFTKALGGPNIYIKRDDQLGLT
                     SGGNKTRKLEFLVADALAQGADTLITCGAVQSNHCRLTLAAAVKEGLKCRLVLEERVP
                     GSYKPEASGNNFLFNLLGVEKVKVVSGGSDMMKEMQIVADELAAEGRKAYIIPGGGSN
                     EIGSLGYVACAQEISAQLFEKGLKIDHIVTPSGSAGTHTGLVTGFYGNNCNIPITGIS
                     VSRKKHEQEELVYSVIQKTAALLEIKQEIPREAVSVYDDYVGPGYSLPTPEMVEAVQL
                     LARTEGILLDPVYTGKAMSGLIGLVRKGFFKKDQNVLFIHTGGSPALYAYTSTILGND
                     "
     gene            456069..456228
                     /locus_tag="Dred_0414"
                     /pseudo
     gene            456296..457180
                     /locus_tag="Dred_0415"
     CDS             456296..457180
                     /locus_tag="Dred_0415"
                     /note="TIGRFAM: pyridoxine biosynthesis protein;
                     PFAM: Vitamin B6 biosynthesis protein;
                     KEGG: mta:Moth_0009 vitamin B6 biosynthesis protein"
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxal phosphate synthase yaaD subunit"
                     /protein_id="ABO48962.1"
                     /db_xref="InterPro:IPR001852"
                     /translation="MQEQGTWTLKKGLAEMLKGGVIMDVTTPEQARIAENAGACAVMA
                     LERVPADIRAAGGVARMADPTVVLRIMDAVTIPVMAKARIGHFVEAQILEGLGVDYID
                     ESEVLTPADELFHINKNTFKVPFVCGCRNLGEALRRIGEGAAMIRTKGEPGTGNVVEA
                     VRHFRQVNSEIKKIMNLPEEELMTVAKEIGAPFELVKVVHQTGKLPVVNFAAGGIATP
                     ADAALMMQLGVDGVFVGSGIFKSGDPMKRAKAIVAATTYYNDPQVLAEVSKDLGEPMV
                     GIEIHNIKAEERMQDRGW"
     gene            complement(457301..458041)
                     /locus_tag="Dred_0416"
     CDS             complement(457301..458041)
                     /locus_tag="Dred_0416"
                     /note="PFAM: regulatory proteins, IclR;
                     KEGG: gka:GK1968 transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="regulatory protein, IclR"
                     /protein_id="ABO48963.1"
                     /db_xref="InterPro:IPR005471"
                     /translation="MNSIEKVLWILNRLGEEPYEMNLTALANEMNTVKSGVHKTLGIM
                     MKQGFILQNPETKKYSIGPTMYRLGNVYNNRVGIWEIAKPIIMQVAEVTHETVSIGIR
                     EGDNAFLAYKIDSPLPVRYFEDIGTQFPMNASAVGKVLAAYHDTERVKELLKSNTFKK
                     HTPNTIVKPDAILQEYQKIREQGYAISDEERFLESFGIAVPIINSSKDVWSCLCITGP
                     KARFTPDKVNNWVELLKSKANEISSVLA"
     gene            complement(458439..458549)
                     /locus_tag="Dred_0417"
     CDS             complement(458439..458549)
                     /locus_tag="Dred_0417"
                     /note="KEGG: maq:Maqu_3518 glutamine amidotransferase of
                     anthranilate synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine amidotransferase of anthranilate
                     synthase"
                     /protein_id="ABO48964.1"
                     /translation="MGIRHKIYPVEGIQFHPESIMTEKGLELLRNFFNMT"
     gene            complement(458599..458829)
                     /locus_tag="Dred_0418"
                     /pseudo
     gene            459037..459477
                     /locus_tag="Dred_0419"
     CDS             459037..459477
                     /locus_tag="Dred_0419"
                     /note="PFAM: regulatory protein, MerR;
                     KEGG: bld:BLi01027 YhdQ"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator, MerR family"
                     /protein_id="ABO48965.1"
                     /db_xref="InterPro:IPR000551"
                     /translation="MYRIGQFAKLAGVSRRTVDYYTKLGLLEPVRSESNYRYYNQDAL
                     IRLKLIEMLKSQRLTLEEIKGQIEYISNVMNSDKKKYSQRAIDIQYLKDQFKVLETQL
                     GQLQPMVTNMEAGQAAAMTKQVLIQSMTIIQSLLLYINEAALFL"
     gene            459510..460475
                     /locus_tag="Dred_0420"
     CDS             459510..460475
                     /locus_tag="Dred_0420"
                     /note="PFAM: SpoOM family protein;
                     KEGG: gka:GK0215 sporulation-control protein"
                     /codon_start=1
                     /transl_table=11
                     /product="SpoOM family protein"
                     /protein_id="ABO48966.1"
                     /db_xref="InterPro:IPR000209"
                     /db_xref="InterPro:IPR009776"
                     /translation="MFKKLMASFGVGAAKVNLLLEKGSYRVGETVNGKVIVEGGNVDQ
                     DIQSLDVDVLMRVIIKGKEIKRVLDTFQVAQEFHVRAKETKEIAFEYPIPIHYPISKG
                     SLSYSLITRMDISQAVDTDDSDPLVVLPTRDMQLVFDAFKNLGFKDKIGSGKIEQYGQ
                     QFEFIPGSLFNEQLKELELKFYSDPHGVKLLMEIEMNGGYMRNGIEHHTELTLPADLL
                     SSGSVQQLADHIKVFLENELTVISVQGPRMAPSYHNYQQTTQHGSGIGGFMGGMVTGM
                     LGGVLLGSLFDGGEEEDSSGMIAGDDENGFDFGLGDFMDFGDDEF"
     gene            460502..461341
                     /locus_tag="Dred_0421"
     CDS             460502..461341
                     /locus_tag="Dred_0421"
                     /note="PFAM: peptidase M48, Ste24p;
                     KEGG: chy:CHY_0108 peptidase, M48 family"
                     /codon_start=1
                     /transl_table=11
                     /product="Heat shock protein, Metallo peptidase, MEROPS
                     family M48B"
                     /protein_id="ABO48967.1"
                     /db_xref="InterPro:IPR001915"
                     /translation="MNTMKVWLLMGGLSILLVLMGSAVGGQTGAVVFFLIAMAMNFFG
                     YFYSDTMAIKMTGSYPVSEAEAPELYAIIRRLSQRAGLPMPKVYIQPSDQPNAFATGR
                     NPSHSAVAVTEGILRILNPSELEGVLAHELAHIKNRDILVGTIAAALAGAISMMANAL
                     QWGAIFGMGRSDDEEGGSMAGGLIMAFIAPIAAMVIQMAISRSREYMADATGAKIAGS
                     PDGLSNALLKLESAAHRIPMGVSPATSHLFIVNPLSGESLARLFSTHPPIQDRVNRLH
                     GMR"
     sig_peptide     460502..460582
                     /locus_tag="Dred_0421"
                     /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.944 at
                     residue 27"
     gene            complement(461402..462052)
                     /locus_tag="Dred_0422"
     CDS             complement(461402..462052)
                     /locus_tag="Dred_0422"
                     /note="TIGRFAM: channel protein, hemolysin III family;
                     PFAM: Hly-III family protein;
                     KEGG: swo:Swol_1904 membrane prote