LOCUS       GU937742              235404 bp    DNA     linear   VRL 12-OCT-2016
DEFINITION  Human herpesvirus 5 strain Toledo, complete genome.
ACCESSION   GU937742 AY156044 AY169798 AY446860 AY446871 AY446873 GQ227784
VERSION     GU937742.2
KEYWORDS    .
SOURCE      Human betaherpesvirus 5 (HHV-5)
  ORGANISM  Human betaherpesvirus 5
            Viruses; dsDNA viruses, no RNA stage; Herpesvirales; Herpesviridae;
            Betaherpesvirinae; Cytomegalovirus.
REFERENCE   1  (bases 1 to 235404)
  AUTHORS   Davison,A.J., Akter,P., Cunningham,C., Dolan,A., Addison,C.,
            Dargan,D.J., Hassan-Walker,A.F., Emery,V.C., Griffiths,P.D. and
            Wilkinson,G.W.
  TITLE     Homology between the human cytomegalovirus RL11 gene family and
            human adenovirus E3 genes
  JOURNAL   J. Gen. Virol. 84 (PT 3), 657-663 (2003)
   PUBMED   12604818
REFERENCE   2  (bases 1 to 235404)
  AUTHORS   Akter,P., Cunningham,C., McSharry,B.P., Dolan,A., Addison,C.,
            Dargan,D.J., Hassan-Walker,A.F., Emery,V.C., Griffiths,P.D.,
            Wilkinson,G.W. and Davison,A.J.
  TITLE     Two novel spliced genes in human cytomegalovirus
  JOURNAL   J. Gen. Virol. 84 (PT 5), 1117-1122 (2003)
   PUBMED   12692276
REFERENCE   3  (bases 1 to 235404)
  AUTHORS   Dolan,A., Cunningham,C., Hector,R.D., Hassan-Walker,A.F., Lee,L.,
            Addison,C., Dargan,D.J., McGeoch,D.J., Gatherer,D., Emery,V.C.,
            Griffiths,P.D., Sinzger,C., McSharry,B.P., Wilkinson,G.W. and
            Davison,A.J.
  TITLE     Genetic content of wild-type human cytomegalovirus
  JOURNAL   J. Gen. Virol. 85 (PT 5), 1301-1312 (2004)
   PUBMED   15105547
REFERENCE   4  (bases 1 to 235404)
  AUTHORS   Davison,A.J.
  TITLE     Human cytomegalovirus RL11 gene family: variation, recombination
            and transcription
  JOURNAL   Unpublished
REFERENCE   5  (bases 1 to 235404)
  AUTHORS   Davison,A.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (26-FEB-2010) MRC Virology Unit, Church Street, Glasgow
            G11 5JR, UK
REFERENCE   6  (bases 1 to 235404)
  AUTHORS   Davison,A.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (12-OCT-2016) MRC Virology Unit, Church Street, Glasgow
            G11 5JR, UK
  REMARK    Sequence update by submitter
COMMENT     On Oct 12, 2016 this sequence version replaced GU937742.1.
            The original gene nomenclature has been retained. Genes presumably
            inherited from the common ancestor of alpha-, beta- and
            gammaherpesviruses (core genes), from the common ancestor of beta-
            and gammaherpesviruses (betagamma genes), or from the common
            ancestor of betaherpesviruses (beta genes) are indicated. A
            standard protein nomenclature has been applied so that orthologs
            have the same name in all herpesviruses.
FEATURES             Location/Qualifiers
     source          1..235404
                     /organism="Human betaherpesvirus 5"
                     /mol_type="genomic DNA"
                     /strain="Toledo"
                     /isolation_source="urine from a congenitally infected
                     infant"
                     /host="Homo sapiens"
                     /db_xref="taxon:10359"
                     /country="USA"
                     /collection_date="1984"
                     /note="passaged several times in human fibroblasts;
                     contains inversion of 14336 bp region (genes UL128 to
                     UL133); 3 genes are mutated (RL13, UL9 and UL128);
                     acronym: HCMV; acronym: HHV-5"
     repeat_region   1..1191
                     /note="TRL"
                     /rpt_type=inverted
     repeat_region   1..748
                     /note="'a' sequence"
                     /rpt_type=direct
                     /rpt_type=terminal
     misc_feature    1192..194037
                     /note="UL"
     gene            1244..2176
                     /gene="RL1"
     CDS             1244..2176
                     /gene="RL1"
                     /note="RL1 family"
                     /codon_start=1
                     /product="protein RL1"
                     /protein_id="AAR31232.2"
                     /translation="MPATDTNSTHTTPLHPEYQHTLPLHHSNTQPPIQTSDKHANEEH
                     RTQMELDAADYAACAQARQHLYAQTQPQLHAYPNANPQESAHFSTENQHQLTHLLHNI
                     GEGAALGYPVPRAEIRRGGGDWADSASDFDADCWCMWGRFGTMGRQPIVTLLLARQRD
                     GLADWNVVRCRGTGFRAHDSEDGVSVWRQHLVFLLGGHGRRVQLERPSAGEAQARGLL
                     PRIRITPISTSPRPKPPQPTISTASHPHATTRPHHTLFPIPSTPSATVHNPRNYAVQL
                     HAETTRTWRWARRGERGAWMPAETFTCPKDKRPW"
     gene            complement(2362..4874)
                     /gene="RNA2.7"
     ncRNA           complement(2362..4848)
                     /ncRNA_class="other"
                     /gene="RNA2.7"
                     /product="RNA2.7"
     regulatory      complement(2379..2384)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="RNA2.7"
     regulatory      complement(4869..4874)
                     /regulatory_class="TATA_box"
                     /gene="RNA2.7"
     gene            complement(5263..5550)
                     /gene="RL5A"
     CDS             complement(5263..5550)
                     /gene="RL5A"
                     /note="RL11 family"
                     /codon_start=1
                     /product="protein RL5A"
                     /protein_id="AAR31233.1"
                     /translation="MDMGKLNTSQGRNLTIVDDRRRFSIGWERWDDGGWSLCNVTSNG
                     TTVVNTTARVSSCLHTSLVVCSVTQQTDSLYGVGHRLNDEEDGELWRVSVS"
     gene            complement(5900..6235)
                     /gene="RL6"
     CDS             complement(5900..6235)
                     /gene="RL6"
                     /note="RL11 family"
                     /codon_start=1
                     /product="protein RL6"
                     /protein_id="AAR31234.1"
                     /translation="MTLIYVDADNTRNELKATTGSNLTITHGKDPLTTKWKTVFGNNG
                     DQWLCNVTGIGNATVNSNATICVSSCGHNTLDLCNLKSGDSGFFDLSRWFGENMDEYS
                     GDVWHLEVS"
     gene            complement(6634..7684)
                     /gene="RNA1.2"
     ncRNA           complement(6634..7654)
                     /ncRNA_class="other"
                     /gene="RNA1.2"
                     /product="RNA1.2"
     regulatory      complement(6652..6657)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="RNA1.2"
     regulatory      complement(7679..7684)
                     /regulatory_class="TATA_box"
                     /gene="RNA1.2"
     gene            complement(7785..8057)
                     /gene="RL8A"
     CDS             complement(7785..8057)
                     /gene="RL8A"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein RL8A"
                     /protein_id="AFP95538.1"
                     /translation="MPHGHLRQALSPTSWTCEGLLLLLGLLVLFFHHHNQSAVERRRR
                     VSFIEADRLPHESGWYSSDDDGDQDGDEETGESHNRNSVGLSAVFS"
     gene            complement(8123..8266)
                     /gene="RL9A"
     CDS             complement(8123..8266)
                     /gene="RL9A"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein RL9A"
                     /protein_id="AFP95539.1"
                     /translation="MSLDAAGHQPEARRLLDSALVRRVLACMIIVIMIAISIWILTYV
                     LFL"
     gene            8477..8983
                     /gene="RL10"
     CDS             8477..8983
                     /gene="RL10"
                     /note="type 1 membrane protein; possibly related to RL11
                     family"
                     /codon_start=1
                     /product="envelope glycoprotein RL10"
                     /protein_id="AAR31235.1"
                     /translation="MYPRVMHAVCFLALGLISYVTVCAETMVATNCLVKTENTHLACK
                     CNPNSTSTNGSKCHAMCKCRVTEPITMLGAYSAWGAGSFVATLIVLLVVFFVIYAREE
                     EKNNTGTEVDQCLAYRSLTRKKLEQHAAKKQNIYERIPYRPSRQKDNSPLIEPTGTDD
                     EEDEDDDV"
     gene            9012..9719
                     /gene="RL11"
     CDS             9012..9719
                     /gene="RL11"
                     /note="type 1 membrane protein; binds IgG Fc; involved in
                     immune regulation; RL11 family"
                     /codon_start=1
                     /product="membrane glycoprotein RL11"
                     /protein_id="AAR31236.1"
                     /translation="MQTYSNSLTLVIVTSLFLFTAQGSLSNAVEPIKKPLKLANYRAT
                     CENRTRTLVTRLNTSHHSVVWQRYDIYSRYMRRMPPLCIITDAYKETTRQGGATFTCT
                     RQNLTLYNLTVKDTGVYLLQDQYTGDVEAFYLIIHPRSFCRALETRRCFYPGPGRVGV
                     VTDSQEADRAIISDLKRQWSGLSLHCAWVSGLMIFVGALVICFLRSQRIGEQDVEHLR
                     TDLDTEPLLLTVDGNLE"
     gene            9723..10973
                     /gene="RL12"
     CDS             9723..10973
                     /gene="RL12"
                     /note="type 1 membrane protein; RL11 family"
                     /codon_start=1
                     /product="membrane protein RL12"
                     /protein_id="AAR31237.1"
                     /translation="MRNTCRRCDNFTYRQTVYTIIVFCMLHKVTCNSTANSTASITLS
                     NTASTTFVTNIYSTPNNNTSTTPHTSVTSQASTIGNITNVTSDLSTFTTVYSTFNTSF
                     ANISNTAVTTELISTNTNTISSFTNVTANATSSYNTTITVTVTSDETSHNVSTNNALI
                     STPWPTNCSATTYTTYNLTNSSNACHTETTIIRFKETNTTGIEGSNVTIKGNSTWDCL
                     SVAWIRHYNRSTHGHHLGYRKNAHTQSWYWLRILTSHTVCHSQHERPSLYHDLCRSCN
                     NTELHLYDLNITNSGRYSRRCFKENYFTGHHEDENFYLLVTPKNHTEAINATFVCPRY
                     NTDIENEDREKGSQHTNNTHHHKRNLYHSSQRSRTVWTIVLVCMACIVLFFARRAFNK
                     KYHMLQDTVSESEFIVRYHPEHED"
     gene            11085..11714
                     /gene="RL13"
     CDS             11085..11714
                     /gene="RL13"
                     /note="type 1 membrane protein; RL11 family; contains 279
                     nt deletion causing in-frame deletion"
                     /codon_start=1
                     /product="truncated membrane protein RL13"
                     /protein_id="AAR31238.1"
                     /translation="MDWRFTVTWTVTCDGFNYTVHKRCDRSYEVINVTGYVGSNITLK
                     KCNQTEKWHNVDWIHYEYPTHKMCELGNYHQTTPRHDICFDCNDTSLTIYNLTTKNAG
                     KYTRRHRDNGQEENYYVTVLIGDTTLFTLGTCPVRYKESTNTENTIGSSIIETIEKAN
                     IPLGIHAVWAGVVVSVALIALYMGSHRIPKKPHYTKLPKYDPDEFWTKA"
     gene            11821..12495
                     /gene="UL1"
     CDS             11821..12495
                     /gene="UL1"
                     /note="type 1 membrane protein; RL11 family"
                     /codon_start=1
                     /product="membrane protein UL1"
                     /protein_id="AAR31239.1"
                     /translation="MGMQCNTKLLLPVALIPVAIILIGTLVPILLHEQKKAFYWRLFL
                     QSQHVEAPITVTQGDTVYLDASNNPCNYSSFWYHGNCELCGWNGYLRNVTHYYTNTSC
                     SPQFICINETKGLQLYNVTLNDSGAYTEHVYECDLSCNITTNNEYEILNYFDNCNYTI
                     NSTKHIITVVSSRHSKQTNSHVSTHAGWAVAVVTVIMIYVLIHFNVPATLRHKLRTRN
                     NVNRIA"
     gene            complement(12876..13058)
                     /gene="UL2"
     CDS             complement(12876..13058)
                     /gene="UL2"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein UL2"
                     /protein_id="AAR31240.1"
                     /translation="MAEDSVAILIVEDDNDAYPSFGTLPASHAQYGFRILRGIFLITL
                     VIWTVVWLKLLRDALL"
     gene            13485..13937
                     /gene="UL4"
     CDS             13485..13937
                     /gene="UL4"
                     /note="contains signal peptide; RL11 family"
                     /codon_start=1
                     /product="envelope glycoprotein UL4"
                     /protein_id="AAR31241.1"
                     /translation="MMLRTWRLLQMVLLAAYCYYVFATCSISTTTAPVEWKSPDRQIP
                     KNITCANYSGTVNGNVTFRGLQNKTEDFLYWLLGWGHKSICSFFPKLQGNYDEQHYRY
                     EVANLTYNCTYNRLTLLNLTTENSGKYYFKREDANFTFYYSCYNLTVS"
     gene            14028..14528
                     /gene="UL5"
     CDS             14028..14528
                     /gene="UL5"
                     /note="contains potential transmembrane domain; RL11
                     family"
                     /codon_start=1
                     /product="protein UL5"
                     /protein_id="AAR31242.1"
                     /translation="MFLGYSDCVDPGLAVYRVSRSRLKLMLSFVWLVGLRFYDCAAFE
                     SCCYDITEAESNKAISRDEAAFTSSVSTRTPSLAIAPPPDRSMLLSREEELVPWSRLI
                     ITKQFYGGLIFHTTWVTGFVLLGLLTLFASLFRVPQSICRFCIDRLRDIARPLKYRYQ
                     RLVATV"
     gene            14632..15474
                     /gene="UL6"
     CDS             14632..15474
                     /gene="UL6"
                     /note="type 1 membrane protein; RL11 family"
                     /codon_start=1
                     /product="membrane protein UL6"
                     /protein_id="AAR31243.1"
                     /translation="MNGWAGVCLITHCLNTRSRTYVALNMLAFARTPRGVPSCLFNKV
                     WVSRYALVLILMVCASESSTSWAVTSNGLPNCSTVTRTAGQDAELHGPAPLSCNVTQW
                     GRYENGSTPVLWCTLRGSSMRVSLGHRVAFGCSWKTFFIYNVSESSGGTYYQKGYNCT
                     DKHITLSCFNLTVVPRAVQSTTTVMTPTLVTNSTFSVSLVPLRLTTNSSAFGHAIYQR
                     QQRVENGTLSKNITNLAFTYGSWGVAMLLFAAVMVLVDLGLPQSAWRRWRSHVDDEER
                     GLLM"
     gene            15532..16608
                     /gene="UL8"
     CDS             join(15532..16116,16219..16608)
                     /gene="UL8"
                     /note="type 1 membrane protein; RL11 family"
                     /codon_start=1
                     /product="membrane glycoprotein UL8"
                     /protein_id="AAR31245.2"
                     /translation="MASDVGSHPLTVTRFRCRVHYVYNKLLILTLFAPVILESVIYVS
                     GPQGGNVTLVSNFTSNISARWFRWDGNDSHLICFYKRGEGLSTPYVGLSLSCAANQIT
                     IFNLTLNDSGRYGAEGFTRSGENETFLWYNLTVKPKPLETTPASNVTTIVTTTSTMID
                     AKSNVTGNASLAPQLRAVAGFSNQTPLENNTHLALGEGFVPTMTSPGLSASENYDGNY
                     EFTETANTTRTNRSDWTTLETSALLLKNTETAVNLSNATTVIPQPVEYPAGEVQYQRT
                     ATHYSWMLIIVIILIIFIIICLRAPRKIYHHWKDSKQYGQVFMTDTEL"
     gene            15532..16200
                     /gene="UL7"
     CDS             15532..16200
                     /gene="UL7"
                     /note="type 1 membrane protein; modulates cytokine
                     production; involved in immune regulation; RL11 family"
                     /codon_start=1
                     /product="membrane glycoprotein UL7"
                     /protein_id="AAR31244.1"
                     /translation="MASDVGSHPLTVTRFRCRVHYVYNKLLILTLFAPVILESVIYVS
                     GPQGGNVTLVSNFTSNISARWFRWDGNDSHLICFYKRGEGLSTPYVGLSLSCAANQIT
                     IFNLTLNDSGRYGAEGFTRSGENETFLWYNLTVKPKPLETTPASNVTTIVTTTSTMID
                     AKSNVTGNASLAPQLRAVAGFSNQTPLENNTHLALVGVVVFLVLIVVCIMGWWKLLCG
                     KPEL"
     misc_feature    16614..17311
                     /note="similar to UL9; contains 4 nt deletion causing
                     frameshift; RL11 family"
     gene            17439..18215
                     /gene="UL10"
     CDS             17439..18215
                     /gene="UL10"
                     /note="type 1 membrane protein; RL11 family"
                     /codon_start=1
                     /product="membrane protein UL10"
                     /protein_id="AAR31246.1"
                     /translation="MRRLINHIVNHDLFRWSVVTAMIFYRYSETCMEVTVRVGDPVTL
                     GSGHGYHPGQKVHWYNQSCVGIGNGENTHPICTYDPPKPGRQKTMKTTPLPSPLLYEC
                     HNSTLSILHVNVSDPKNYCRRKCPPKGNCEFPTCFTLSLISRTTTTRKPGQKTTLLRL
                     KTTPNKHTQHKRSTRRTSPKDYNVTGLPKGFADSFTGNVEAHRTKDAAHSAWILIIII
                     IIIVVILFFFKIPQRLREKWDTRGYLYKGTDGLPTTDYLS"
     gene            18308..19126
                     /gene="UL11"
     CDS             18308..19126
                     /gene="UL11"
                     /note="type 1 membrane protein; disrupts T cell function
                     via inhibition of CD45; involved in immune regulation;
                     RL11 family"
                     /codon_start=1
                     /product="membrane glycoprotein UL11"
                     /protein_id="AAR31247.1"
                     /translation="MLLRYITFHREKVLYLTAACIFGVYISLHDACIPVVGKIGTNVT
                     LNAVDVIPPRDQVRWSYGPGGQGYMLCIFTGTSTTTFNNTRFNFSCLSNYSLLLINVT
                     AQYSTTYRTMTSLDDWRHQQHSHGFRWTLDTCYNLTVNENGTFPTTTTKKPTTTTRTT
                     TTTTQRTTTTRTTTAAKKTTISTTHHKHSSPKKSSTPNSHVEHHVGFEATAAETPLQP
                     SPQHQHVATHALWVLAAVIVIIIIIIFYFRIPQKLWLLWQHDKHGIVLIPQTDL"
     gene            19324..20745
                     /gene="UL13"
     CDS             19324..20745
                     /gene="UL13"
                     /note="contains signal peptide"
                     /codon_start=1
                     /product="protein UL13"
                     /protein_id="AAR31248.2"
                     /translation="MLWAHCGRFLRYHLLPLLLCRLPFLLLFQRPQWAHGLDIVEEDE
                     WLREIQGATYQLSIVRQAMQHAGFQVRAASVMTRRNAVDLDRPPLWSGSLPHLPVYDV
                     RSPRPLRPPSSQHHAVSPELPSRDGIRWQYQELQYLVEEQRRRNQSRNAIPRPSFPPP
                     DPPSQPAEDARDADAERAESPHSAESTVRHDASENVMRRRHERRRYNALTVRSRDSLL
                     LTRIRFSNQRCFGRGRLRHPAGSGPNTGGPRPGGAGLRQLRQQLTVRWQLFRLRCHGW
                     TQQVSSQIRTRWEESNVVSQTATRIRTWFVERTTLWRRTWVPGQNPAAEAQELAVIPP
                     APTVLRQNEEPRQQLTEEKTRNSTHTQREEVEDVSREGAREGNDGSRASGNDERRNNA
                     GRYDDDHEVQEPQVTYPAGQGELNRRSQEENEEGGPCESPPMTTNTLTVACPPREPPH
                     RALFRLCLGLWVSSYLVRRPMTI"
     gene            20895..21878
                     /gene="UL14"
     CDS             20895..21878
                     /gene="UL14"
                     /note="type 1 membrane protein; possibly involved in
                     immune regulation; UL14 family"
                     /codon_start=1
                     /product="membrane protein UL14"
                     /protein_id="ADD39076.1"
                     /translation="MGGGRLPPLWLPLLIAWSEWGNCCLDAPPVVRSPCLQPVRDRNR
                     ERNPGSPQLLPYGDRLEVACIFPAHDWPEVSIRVHLCYWPEIVRSLVVDARSGQVLHN
                     DASCYIAGGRWRFEDGGAAQRLSLSFRLITETAGTYTCVLGNETHSLATETTALVADV
                     HDLRHSDRSCDLAFGSRSQTRYLWTPDPSRLRSINCGWEGERHRVVHYIPGTSGLLPS
                     CEEDERELCVPFISQSIADNNCSRRHRVDGARRRYHLRRDYWLTDPKIGLLAAGSVAL
                     TSLCHLLCYWCSESYRRLNTEEENEAAEETAAGEASAVAAAAVSEEEQQRE"
     gene            21891..22199
                     /gene="UL15A"
     CDS             21891..22199
                     /gene="UL15A"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein UL15A"
                     /protein_id="ADD39077.1"
                     /translation="MKRMIRSHGRKTECQMTGAGERRGSAVGALICGSGTRRGSGANE
                     RRDSDVGPIAHSSGTRRGSANETSACTRTDHQKADIGLWFMFLVFGLCSWLAMRYRAQ
                     "
     gene            22423..23115
                     /gene="UL16"
     CDS             22423..23115
                     /gene="UL16"
                     /note="type 1 membrane protein; inhibits NK cell
                     cytotoxicity; sequesters MICB, ULBP1 and ULBP2; acts on
                     activating receptor NKG2D; involved in immune regulation"
                     /codon_start=1
                     /product="membrane glycoprotein UL16"
                     /protein_id="ADD39078.1"
                     /translation="MERRRGTVPLGWGFFVLCLSASSPCAVDLGSKSSNSTCRLNVTE
                     LASIRPGETWTLHGMCISICYYENVTEDEIIGVAFTWQHNESVVDLWLYQNDTVIRNF
                     SDITTNILQDGLKMRTVPVTKLYTSRIVTNLTVGRYDCLRCENGTTKIIERLYVRLGS
                     LYPRPPGSGLAKHPSVSADEELSATLARDIVLVSAITLFFFLLALRIPQRLCQRLRIR
                     LPHRYQRLRTED"
     gene            23223..23537
                     /gene="UL17"
     CDS             23223..23537
                     /gene="UL17"
                     /note="possibly related to UL19"
                     /codon_start=1
                     /product="protein UL17"
                     /protein_id="ADD39079.1"
                     /translation="MDHALLTHFVGRPRHCRLEMLILDEQVSKRSWDTTVYHRRRKHL
                     PRRRAPCGPQRPAEIPKRRTKAAVLLFWHDLCWLFRRLFFPREDSEPLMSDPARSPEE
                     EE"
     gene            23646..24752
                     /gene="UL18"
     CDS             23646..24752
                     /gene="UL18"
                     /note="type 1 membrane protein; inhibits NK cell
                     cytotoxicity; acts on inhibitory receptor LIR-1 (ILT2);
                     involved in immune regulation; MHC family"
                     /codon_start=1
                     /product="membrane glycoprotein UL18"
                     /protein_id="ADD39080.1"
                     /translation="MMTTWCLTLFVLWMLRVVGMHVLRYGYTGIFDDTSHMTLTVVGI
                     FDGQHFFTYHVNSSDKASSRANGTISWMANVSAAYPTYLDGERAKGDLIFNQTEQNLL
                     ELEIALGYQSQSVLTWTHECNTTENGSFVAGYEGFGWDGETLMELKDNLTLWTGPNYE
                     ISWLKQNKTYIDGKIKNISEGDTTIQRNYLMGNCTEWSVIYSGFQTPVTHPVVKGGVR
                     NHNDNRAEAFCTSYGFFPGEINITFIHYGDKVPEDSEPQCNPLLPTFDGTFHQGCYVA
                     IFCNQNYTCRVTHGNWTVEIPISITSPDDSSSGEVPDHPTASKRYNTMTISSVLLALL
                     LCALLFAFLHYFTTLKQYLRNLAFAWRYRKVRSS"
     gene            24749..25045
                     /gene="UL19"
     CDS             24749..25045
                     /gene="UL19"
                     /note="possibly related to UL17"
                     /codon_start=1
                     /product="protein UL19"
                     /protein_id="ADD39081.1"
                     /translation="MTSNALYELFRRRLPRAPVNTVMFLTRRTRDGFCGRLTSIATNS
                     HYTMFVLDHGSVRIERPSQSEVDCASLMETLKRIRLRNSWVASEDELDVSRRDA"
     gene            25307..26329
                     /gene="UL20"
     CDS             25307..26329
                     /gene="UL20"
                     /note="type 1 membrane protein"
                     /codon_start=1
                     /product="membrane protein UL20"
                     /protein_id="ADD39082.1"
                     /translation="MLGIHAMLVMLNYHWMQVTTNNDARNNNTNTIFVSLLTGPNGVT
                     RTAVGGLYSNYTDLTGTFNFIQGNISANASSGDNWSVANLTKNCINRGESYLITLWLL
                     NCTQNDTYWYSGNAYNYTNNTCGSTVSGYLLGMCELWKKWVDNDTSHNTTRIELLKNE
                     TRCTLPAKQYTLNTTVEWYNKSEGDVPKEFMSYAILNSVAVLTCGLHEAYIFDMTRRT
                     TYLFSMSCIGITSIISIILASLSLLILICYYRCDRLLICPRGFERLPEFTEEEEEKEN
                     LLTHKDIEVQVPIRTRRLLVPWIRESKMWTLPPPLPPRPPHLIEFPPSPPSSPEPTHM
                     VICIPS"
     gene            complement(26474..26845)
                     /gene="UL21A"
     CDS             complement(26474..26845)
                     /gene="UL21A"
                     /codon_start=1
                     /product="protein UL21A"
                     /protein_id="ADD39083.1"
                     /translation="MGGSPVPQLTTVTQGLMPSVRMDFRARRPLRRLAFYAPRARRRL
                     FQNHIHPEQRRVLVHEGDEEMLPDLPMEIDIVIDRPPQQPLPNPLVLLLDDVPPHVPG
                     FAPYRVPRPHPMIPEEHWDQF"
     gene            27114..27514
                     /gene="UL22A"
     CDS             join(27114..27199,27283..27514)
                     /gene="UL22A"
                     /note="contains signal peptide; secreted protein; binds CC
                     chemokine RANTES; involved in immune regulation"
                     /codon_start=1
                     /product="glycoprotein UL22A"
                     /protein_id="ADD39084.1"
                     /translation="MARRLWILSVLAVTLTVALAAPSQKSKRSVTVEQPSTSTNSDGN
                     TTRNKDVTLSQGGSTTDGDEDYSGGDYDVLITDTDGGNHQQPQEKTDEHKEEHTKENE
                     KTQ"
     gene            complement(27881..28735)
                     /gene="UL23"
                     /note="beta gene"
     CDS             complement(27881..28735)
                     /gene="UL23"
                     /note="US22 family"
                     /codon_start=1
                     /product="tegument protein UL23"
                     /protein_id="ADD39085.1"
                     /translation="MSVIKDCFLNLLDRWRPPKTSRPWKPGQRVALVWPKDRCLVIRR
                     RWRLVRDEGRDAQRLASYLCCPEPLRFVGSICTYNFLKHKGDHNVPSELYLGASGAMY
                     LWTDHIYSDSLTFVAESITEFLNIGLRRCNFITVPEELPHTASLRALAGCMHIHAFAQ
                     WRAMYRGRIMVVGDYSVIRVSTIRLYDWSEINDWRVMVGSNHVEPLGWLVSPYDVINL
                     FVDDCMRVFAANNQHVCIVADSLMEFVTRGMTRCHENGIYYGTRSMRKLNQPTCPYGV
                     DHQLFDNA"
     gene            complement(28951..30027)
                     /gene="UL24"
                     /note="beta gene"
     CDS             complement(28951..30027)
                     /gene="UL24"
                     /note="US22 family"
                     /codon_start=1
                     /product="tegument protein UL24"
                     /protein_id="ADD39086.2"
                     /translation="MEETRAGRYIVRAGSGGQTEDTASGAESVLATLAAVRTRRRSVV
                     CDGPPGSPTDSARHMSDLASLALTAEFGLGCLEAYVRINAGQVLPVVWPPGWNLVLQE
                     IETDEDFKPEDVKAWSHYLCCQTRLAFVGRFVNEGVLSPDQQKKTAVCLISDEGYVFC
                     YVREDTAVYYLARNLMEFARVGLRAVETLHCMRYLTSSLVKRYFRPLLRAWSLGLDTM
                     ARFIIRHHGQFMPLTYPPGTELRLCNLRCFENSVEGGHLLRNIKTAFGMRVLGLGTVS
                     LKGENAPFPHLRWPVDLIPIVVAYTGAVYACDVRDDRYIRLGDNLNTFMCLGLNLLFE
                     NRRFSGHNGIYDRVPDCPKGRQHR"
     gene            30075..32045
                     /gene="UL25"
     CDS             30075..32045
                     /gene="UL25"
                     /note="UL25 family"
                     /codon_start=1
                     /product="tegument protein UL25"
                     /protein_id="ADD39087.1"
                     /translation="MSSRRRSSSRRSGEPSTVIYIPSSNEDTPADEEAEDSVFTNTRA
                     RSATEDLDRMEAGLSPYSVSSDAPSSFELVRETGAAGAAKKPSDKKRSSSRRQPQIAA
                     GAPRGSPATPKAGKSPKVSRPPSVPSLPENGAGDGGDDNSSSGGSSSRTTSNSSRSTS
                     PVAPGEPSAVEGDEFSFCDSDIEDFERECYRVSVADNLGFEPSVVAPQHVEYLKFVLQ
                     DFDVQHLRRLNDCIPMPAFALTSLVDPVLNNVAPGERDLTRRIITHAVIINYYYVAQK
                     KARHMMEAIRTTVRSDTVRRVATQVNNQSRSGRAAALALHFLTSRKGVTDGQYATSLR
                     RLDEELRHRGTPESPRLTEVYQTLRDYNVLFYTAHYTSRGALYLYRQNLQRLNENHRG
                     MLRLLSVEEICEEHTLNDLAFLVGVELMITHFQRTIRVLRCYLQHQLQSISELCYLIY
                     VQLPSLREDYAQLSDVLYWAVSQNYDYALYASTPALFDFLRVVRQQDAFICTDYVYCA
                     LRLLACPDRPIIGDTGGSSSSQRLVGEFMVRDPLLRDPRATHLRQKLITRDICVARLQ
                     AQPSSRHIPVEHTGVSSVTLLKIFSQVPPDEREEDTLREMALKAFMEANGNHPEQICR
                     SPPPPLPPRDYPQRDERDRHRRDRRDSGEYCC"
     gene            complement(32234..32800)
                     /gene="UL26"
     CDS             complement(32234..32800)
                     /gene="UL26"
                     /note="transcriptional activator of major immediate early
                     promoter; involved in gene regulation; US22 family"
                     /codon_start=1
                     /product="tegument protein UL26"
                     /protein_id="ADD39088.1"
                     /translation="MTSRRAPDGGLNLDDFMRRQRGRHLDLPYPRGYTLFVCDVEETI
                     LTPRDVEYWKLLVVTQGQLRVIGTIGLANLFSWDRSVAGVAADGSVLCYEISRENFVV
                     RAADSLPQLLERGLLHSYFEDVERAAQGRLRHGNRSGLRRDADGQVIRESACYVSRAL
                     LRHRVTPGKQEITDAMFEAGNVPSALLP"
     gene            complement(32856..34682)
                     /gene="UL27"
                     /note="beta gene"
     CDS             complement(32856..34682)
                     /gene="UL27"
                     /note="low-level resistance to maribavir"
                     /codon_start=1
                     /product="protein UL27"
                     /protein_id="ADD39089.1"
                     /translation="MNPVDQPPPPLPTQQPEEQAKEDHDDGDERLFRDPLTTYEYLDD
                     CRDDEEFCHQFLRAYLTPIRNRQEAVRAGLLCRTPEDLVAAGGQKKKTPAPKHPKHAM
                     VYIRRSCLVHSACATAHGKYDIRGLTLESDLAVWAALRGVPLPPDPQHFRWLNAGAFR
                     RLVHEAQYLPEISRAAKRIALAVATGQYVVCTLLDYKTFGTRTHYLRQLCSMTEELYL
                     RLDGTLCLFLDPEERELIGRCLPAALCRGLPVKYRTHRAAVFFHATFMARAEAALKDL
                     YAAFCECGDGRDDGGNHNGNHGGGDHSSLSLSAAASHHSRLEHAELRLERNRHLGAFH
                     LPAIRHLTAGDVARVQNSVSRDLGFADWSQTLVDDYFLLPAGWACANPRRGYAMYLAS
                     NAVLALRIIRLLRASIRHEYTACIRMLSGDVQRLIRLFKGEAALLRKGLAQNPVQRRE
                     LSRFRKHVHDLKRIRFTEDTFVETFCDFLELVQRIPDYRSVSLRIKRELLCLHVFKLR
                     RGCRAPPTPETARVQRLLWHSLRHGDAPQDRTRLPQFSSALSDAELSNHANRCRRKAP
                     LELGPAVVAAPGPSVRYRAHIQKFERLHVRRFRPHEVGGHAT"
     gene            complement(34779..37030)
                     /gene="UL29"
                     /note="beta gene"
     CDS             complement(join(34779..35805,35952..37030))
                     /gene="UL29"
                     /note="US22 family"
                     /codon_start=1
                     /product="protein UL29"
                     /protein_id="ADD39090.1"
                     /translation="MSGRRKGCSAATASSSSSSPPSRLPPLPGHARRPRRKRCLVPEV
                     FCTRDLADLCVRRDYEGLRRYLRRFEGSCVSLGWPSQCIYVVGGEHSPHSLTEIDLEH
                     CQNDFFGEFRALHLIGTVSHATCRYQVFVDAYGAVFAYDAQEDCLYELASDLAGFFAK
                     GMIRCDPVHESICARLQPNVPLVHPDHRAELCRRSRASARGRYLRSLLAFRELLACED
                     TAARCAYVEAHREAQLTLIWPEKHSLVLRTARDLGLSASMLRRFQRSLYTREPVMPLG
                     EIEGAEDKTFFHRVRILCGDTGTVYAALVGQDKLVRLARDLRGFVRVGLALLIDDFRY
                     ESIGPVDRSSLYEANPELRLPFKKRRLVVGYFDSLSSLYLRGQPKFSSIWRGLRDAWT
                     HKRPKPRERASGVHLQRYVRATAGRWLPLCWPPLHGIMLGDTQYFGVVRDHKTYRRFS
                     CLRQAGRLYFIGLVSVYECVPDANTAPEIWVSGHGHAFAYLPGEDKVYVLGLSFGEFF
                     ENGLFAVYSFFERDYVDEIVEGAWFKHTFAGMYELSQILHDRTNLLRVCQLHAGSKIR
                     LGGSPACTFTFGSWNVAEADEANNFVIGVLEQAHFVVIGWMEPVNKAVFMDAHGGIHV
                     LLYGTMLVKLAETLRGFIRQGSFWFRCPRRFCFSPLDSSATVAAKPVSSHTSPAYDVS
                     EYVFSGRSVLDSVSGTGAS"
     gene            complement(37160..37525)
                     /gene="UL30"
     CDS             complement(37160..37525)
                     /gene="UL30"
                     /note="UL30 family"
                     /codon_start=1
                     /product="protein UL30"
                     /protein_id="ADD39091.1"
                     /translation="MTTSAMTAPDTRRQLQHVETLRRFLRGDSCFVHDLRGMMDYHDG
                     LSRRQQRAFCRAGRVLTDPEPIQSEAEGENKQFTEHTHKVVSFFIKSVFVFPYLVLPN
                     CCQVSVDRSRVPETGGRWL"
     gene            complement(37571..37810)
                     /gene="UL30A"
     CDS             complement(37571..37810)
                     /gene="UL30A"
                     /note="UL30 family;
                     alternative start codon"
                     /codon_start=1
                     /transl_except=(pos:complement(37808..37810),aa:Met)
                     /product="protein UL30A"
                     /protein_id="AGL39530.1"
                     /translation="MACRDARWVRFIRLRTLWSVRPRAHVADLEDFAAFYRTLSDSEQ
                     QEFEQEAELASRSQRVRHLREARRQLKMDLMCHGG"
     gene            38004..39791
                     /gene="UL31"
                     /note="beta gene"
     CDS             38004..39791
                     /gene="UL31"
                     /note="DURP family"
                     /codon_start=1
                     /product="protein UL31"
                     /protein_id="ADD39092.1"
                     /translation="MGDKPALVTLLTVAVSSPPPSSPLPLVSFTELLLPPPSVAAAAV
                     AATATSEVGEKTAEQEVAAAGPETGNERRENRENEGGETRTTGTTAVKRSHDGIPRQL
                     AERLRLCRHMDPEQDYRLPAQDVVTSWIEALRDADRDNYGRCVRHAKIHRSASHLTAY
                     ESYLVSITEQYNTASNVTEKASYVQGCIFLSFPVIYNNTQGCGYKYDWSNVVTPKAAY
                     AELFFLLCSTSESSVVLQPLITKGGLCSSMAVYDEETMRQSQAVQIGFLHTQLVMVPF
                     VPHACPHYAVPFTTPGKPGCGGAPSGVAGLEEAAPFGRVSVTRHGATLLCRVDHLTWI
                     SKRVTTYGHKKITRYLAQFRGTMDDDEAALPGEDEAWIASKNVQYEFMGLIFTVNVDS
                     LCVDAEQRQLLGTVATSFCHRVSDKITARNMPRAFSFYLLTSAQRGYDLRFSRNPSLF
                     FSGDALNCPLLNEPNVFSLTVHAPYDIHFGVQPRQTVELDLRYVQITDRCFLVANLPH
                     EDAFYTGLSVWRGGEPLKVTLWTRTRSIVIPQGTPIATLYQITEGDGNVYSYNHHTVF
                     RQMHAAGATTFFLGDMQLPADNFLTSPHP"
     gene            complement(39872..43021)
                     /gene="UL32"
                     /note="beta gene"
     CDS             complement(39872..43021)
                     /gene="UL32"
                     /note="major tegument protein; binds to capsids"
                     /codon_start=1
                     /product="tegument protein pp150"
                     /protein_id="ADD39093.1"
                     /translation="MSLQFIGLQRRDVVSLVNFLRHLTQKPDVDLEAHPKILKKCGEK
                     RLHRRTVLFNELMLWLGYYRELRFHNPDLSSVLEEFEVRCAAVARRGYTYPFGDRGKA
                     RDHLAVLDRTEFDTDVRHDAEIVERALVSAVILAKMSVRETLVTAIGQTEPIAFVHLK
                     DTEVQRIEENLEGVRRNMFCVKPLDLNLDRHANTALVNAVNKLVYTGRLIMNVRRSWE
                     ELERKCLARIQERCKLLVKELRMCLSFDSNYCRNILKHAVENGDSADTLLELLIEDFD
                     IYVDSFPQSAHTFLGARSPSLEFDDDANLLSLGGGSAFSSVPKKHVPTQPLDGWSWIA
                     SPWKGHKPFRFEAHGSLAPAAEAHAARSAAVGYYDEEEKRRERQKRVDDEVVQREKQQ
                     LKAWEERQQNLQQRQQQPPPPARKPSASRRLFGSSADEDDDDDDDDDEKNIFTPIKKP
                     GTSGKGAASGGGVSSIFSGLLSSGSQKPTSGPLNIPQQQQRHAAFSLVSPQVTKASPG
                     RVRRDSAWDVRPLTETRGDLFSGDEDSDSSDGYPPNRQDPRFTDTLVDITDTETNVKP
                     PVTTAYKFEQPTLTFGAGVNVPAGAGAAILTPTPVNPSTAPAPAPTPTFAGTQTPVNG
                     NSPWAPTAPLPGDMNPANWPRERAWALRNPHLAHNPFRMPTTSTASQNTVSTTPRRPS
                     TPRAAVTQTASQNTADEVWALRDQTAESPVEDSEEEDDDSSDTGSVVSLGHTTPSSDY
                     NDVISPPSQTPEQSTPSRIRKAKLSSPMTTTSTNQKPVLGKRVATPHASARAQTVTST
                     PVQGKVEKQVSGTPSTVPATLLQPQPASSKTTSSRNVASGAGTSSASARQPSASASVL
                     SPTEDDIVSPATSPLPMLSSASPSPAKSAPPSPVKGRGSRVGVVPSLKPTLGGKAVVG
                     RPPSVPVSGSAPGRLSGTSRAASTTPTYPAVTTVYPPSSTAKSSVSNAPPVASPSILK
                     PGASAALQSRRSTGTAAVGSPVKSTTGMKTVAFDLSSPQKSGTGPQPGSAGMGGAKTP
                     SDAVQNILQKIEKIKNTEE"
     gene            43092..44450
                     /gene="UL33"
                     /note="beta gene"
     CDS             join(43092..43115,43236..44450)
                     /gene="UL33"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     putative chemokine receptor; involved in intracellular
                     signalling; GPCR family"
                     /codon_start=1
                     /product="envelope glycoprotein UL33"
                     /protein_id="ADD39094.1"
                     /translation="MDTIIHNSTRNTTTPHINDTCNMTGPLFAIRTTEAVLNTLIIFV
                     GGPLNAIVLVTQLLTNRVLGYSTPTIYMTNLYSTNFLTLTVLPFIVLSNQWLLPAGVA
                     SCKFLSVIYYSSCTVGFATVALIAADRYRVLHKRIYARQSYRSTYTILILTWLAGLIF
                     SMPAAVYTTVVMHHEANDTTNATGHATCVLYFVADEVHTVLLSWKVLLTLVWGAAPVI
                     MMTWFYAFFYSTVQRTSQKQRSRTLTFVSVLLISFVALQTPYISLMIFNSYATTAWST
                     KCEHLTLRRTIGTLARLVPHLHCLINPILYALLGHDFLQRMRQCFRGQLLDRRAFLRS
                     QQNQRATAETNLAAGNNSQSVATSLDPNSKNCNQHAKRSVSFNFPSGTWKGGQKTASN
                     DTSTKIPHRLSQSHHNLSGV"
     gene            44818..46041
                     /gene="UL34"
     CDS             44818..46041
                     /gene="UL34"
                     /note="represses US3 transcription; involved in gene
                     regulation"
                     /codon_start=1
                     /product="protein UL34"
                     /protein_id="ADD39095.1"
                     /translation="MNFIITTRDFSNDDSVLRAAEMRDNVAGSISKAYKGTVRAEGKK
                     KLLLKHLPVPPGGCSRRNSNLFVFCTERDYRKFHQGIAQLKRAPAELDPHEIQQVTAS
                     IRCRLQPSLREPPTPADELQTAVSRVCALFNQLVFTAQLRHYCEHQDKVVSYARDELT
                     KRCGEKSALGVEVHQLVALLPHERHRELCHVLIGLLHQTPHMWARSIRLIGHLRHYLQ
                     NSFLHLLMNSGLDIAQVFDGCYHSEAYRMLFQIGHTDSVSAALEFSHSAAAGPPEADE
                     NNDEGEEDDDELRHSDPAPLHESKKPRNARRPRTRMPPHEQKPEENEEEEEELFPSCK
                     ATAAFLRAEPSVSNDDGNGGERCDTLATALRHCADEEDGPLASQTAVRVAATPSPSVT
                     PALTPVTSPITPLCI"
     gene            46120..48045
                     /gene="UL35"
                     /note="beta gene"
     CDS             46120..48045
                     /gene="UL35"
                     /note="UL25 family"
                     /codon_start=1
                     /product="tegument protein UL35"
                     /protein_id="ADD39096.1"
                     /translation="MAQGSRAPSGPPLPVLPVDDWLNFRVDLFGDEHRRLLLEMLTQG
                     CSNFVGLLNFGVPSPVYALEALVDFQVRNAFMKVKPVAQEIIRICILANHYRNSRDVL
                     RDLRTQLDVLYSEPLKTRLLRGLIRLCRAAQTGVKPEDISVHLGADDVTFGVLKRALV
                     RLHRVRDALGLRASPEAEARYPRLTTYNLLFHPPPFTTVEAVDLCAENLSDVTQRRNR
                     PLRCLTSIKRPGSRTLEDALNDMYLLLTLRHLQLRHALELQMMQDWVVERCNRLCDAL
                     YFCYTQAPETRQTFVTLVRGLELARQHSSPAFQPMLYNLLQLLTQLHEANVYLCPGYL
                     HFSAYKLLKKIQSVSDARERGEFGDEDEEQENDGEPREAQLDLEADPTAREGELFFFS
                     KNLYGNGEVFRVPEQPSRYLRRRMFVERPETLQIFYNFHEGKITTETYHLQRIYSMMI
                     EGASRQTGLTPKRFMELLDRAPLGQESEPEITEHRDLFADVFRRPVTDAASSSSASSS
                     SSSASPNSVSLPSARSSSTRTTTPASTYTSAGTSSTTGLLLSSSSLSGSHGISSADLE
                     QPPRQRRRMVSVTLFSPYSVAYSHHRRHRRRRSPPPAPRGPAHTRFQGPDSMPSTSYG
                     SDVEDPRDDLAENLRHL"
     gene            complement(48271..49809)
                     /gene="UL36"
                     /note="beta gene; immediate early gene"
     CDS             complement(join(48271..49499,49608..49809))
                     /gene="UL36"
                     /note="inhibitor of caspase-8-induced apoptosis; involved
                     in apoptosis; US22 family"
                     /codon_start=1
                     /product="tegument protein vICA"
                     /protein_id="ADD39097.1"
                     /translation="MDDLRDTLMAYGCIAIRAGDFNGLNDFLEQECGTRLHVAWPERC
                     FIQLRSRSALGPFVGKMGTVCSQGAYVCCQEYLHPFGFVEGPGFMRYQLIVLIGQRGG
                     VYCYDDLRDCVYELAPTMKDFLRHGFRHCDHFHTMRDYQRPMVQYDDYWNAVMLYRGD
                     VESLSAEVTKRGYASYTIDDPFDECPDTHFAFWTHNTEVMKFKETSFSVIRAGGSIQT
                     MELMIRTVPRITCYHQLLGALGHEVPERKEFLVRQYVLVDTFGVVYGYDPAMDAVYRL
                     AEDVVMFTCVMGKKGHRNHRFSGRREAIVRLEKTPTCQHPKKTPDPMIMFDEDDDDEL
                     SLPRNVMTHEEAESRLYDAITENLMHCVKLVTTDSPLATHLWPQELQALCDSPALSLC
                     TDDVEGVRQKLRARTGSLHHFELSYRFHDEDPETYMGFLWDIPSCDRCVRRRRFKVCD
                     VGRRHIIPGAANGMPPLTPPHAYMNN"
     gene            complement(49943..52741)
                     /gene="UL37"
                     /note="beta gene; immediate early gene"
     CDS             complement(join(49943..50875,50980..51022,52254..52741))
                     /gene="UL37"
                     /note="type 1 membrane protein; involved in apoptosis;
                     involved in gene regulation; major isoform (mitochondrial
                     inhibitor of apoptosis, vMIA) encoded by unspliced mRNA"
                     /codon_start=1
                     /product="envelope glycoprotein UL37"
                     /protein_id="ADD39098.1"
                     /translation="MSPVYVNLLGSVGLLAFWYFSYRWIQRKRLEDPLPPWLRRKKAC
                     ALTRRSRHRLRRQHGVIDGENSETERSVDLVAALLAEAGEESVTEDTEREDTEEERED
                     EEEENEARTPEVNPIDAEGLSGLAREACEALKKALRRHRFLWQRRRRAQLLQHNGPQQ
                     SHHAAVFCRVHGLRGFQVSVWLLLTLFWSTGYGVSVRCTYHGTDINVTSNATSMNCLL
                     NCTCNHTQIYNGPCAGAESKLPLNVTFRQSRRQWHSVMLTFGFQYHLEGWFPLRILNE
                     SRDINVTEVYGEVACFTNDTNITMGQLTLNLTGRSYVLRALARTSPFESSVNWEETNV
                     TDNVTSSENNTVTVMSILTVYAESDYIFLQDMCPRFLKRSVKLTKNNKKNTTFTGTNM
                     TSLPMWTSECEGWRYWTTLSIMWKNRRSALLRAKSRALGHWALLSICTVAAGSIALLS
                     LFCILLIGLRRDLLEDFRYICRDEGSSSTKNDVHRIV"
     gene            complement(51162..52157)
                     /gene="UL38"
                     /note="beta gene"
     CDS             complement(51162..52157)
                     /gene="UL38"
                     /note="involved in apoptosis"
                     /codon_start=1
                     /product="protein UL38"
                     /protein_id="ADD39099.1"
                     /translation="MTTATHSTAAIMSLLDEAEWRQTQMDVGGLIQASALGKVALRYA
                     VRKLMKRGARLRHDSGLYVCICDPSYEFLQMNLSKISWLERHCPPLDQELIMFGVIEA
                     WEEASMRPTRQLVLFMTPKWDVFGYDSGILFFLAPSMAQFWHGAIVLEYWNALFPVEV
                     RSHVRQHAHTMDDLVMVFHQLDYEKQVLEARRDKNTEGPRTFAKSVNSYVRAILESER
                     RIREGKIPMTFVDRDSLRANSLAHIQATGAQPSHAPAQRVLSAPPSLPSPVSEEDPAA
                     AATPPSSAATTPPSSVVPASVESELSSSPPLPPVVVKDVMYTAGEGDVVQMVVVV"
     gene            complement(53253..53918)
                     /gene="UL40"
     CDS             complement(53253..53918)
                     /gene="UL40"
                     /note="type 1 membrane protein; sequence in signal peptide
                     inhibits NK cell cytotoxicity; upregulates cell surface
                     expression of HLA-E; acts on inhibitory receptor
                     CD94/NKG2A; involved in immune regulation"
                     /codon_start=1
                     /product="membrane glycoprotein UL40"
                     /protein_id="ADD39100.1"
                     /translation="MNKFSNTRIGFTCAVMAPRTLVLTLGLLCMRIRSLLSSPAETTV
                     TTAGAMSAHGPQCPLVFQGWAYAVYHQGDMALMTLDVYCCRQTSSNTVVAFSHHPADN
                     TLLIEVGNNTRRHVDGISCQDHFRAQHQECPAQTVHVRGVNESAFGLTHLQSCCLNEH
                     SQLSERVAYHLKLRPATFGLETWAMYTVGILALGSFSSFYSQIARSLGVLPNDHHYAL
                     KKA"
     gene            complement(54080..54316)
                     /gene="UL41A"
     CDS             complement(54080..54316)
                     /gene="UL41A"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein UL41A"
                     /protein_id="ADD39101.1"
                     /translation="MTLFCRTANSTAGYVDMNVCIGMIGVVCFVFGVFILIFCSTLKA
                     FYVRQKTYHLLGTESDDEETTVWEKRRMESDTDF"
     gene            complement(54422..54790)
                     /gene="UL42"
     CDS             complement(54422..54790)
                     /gene="UL42"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein UL42"
                     /protein_id="ADD39102.1"
                     /translation="MEPTPMLRDRDHDDAPPTYEQAMGLCPTTVSTPPPPPPDCSPPP
                     YRPPYCLVSSPSPRHTFDMDMMEMPATMHPTTGAYFDNGWKWTFALLVVAILGIIFLA
                     VVFTVVINRDNSTTTGTSSG"
     gene            complement(54854..56125)
                     /gene="UL43"
                     /note="beta gene"
     CDS             complement(54854..56125)
                     /gene="UL43"
                     /note="US22 family"
                     /codon_start=1
                     /product="tegument protein UL43"
                     /protein_id="ADD39103.1"
                     /translation="MEKTPAETTAVSAGNVPRDSIPCITNVSADTRGRTRPSRPATVP
                     QRRPARIGHFRRRSASLSFLDWPDDSVTEGVRTTSASVAASAARFDEIRRRRQSINDE
                     MKERTLEDALAVELVNETFRCSVTADARKDLQKLVRRVSGTVLRLSWPNGWFFTYCDL
                     LRVGYFGHLNIKGLEKTFLCCDKFLLPVGTVSRCEAIGRPPLPVLIGEGGRVYVYSPV
                     VESLYLVSRSGFRGFVQEGLRNYAPLREELGYVRFETGGDVGREFMLARDLLALWRLC
                     MKREGSIFSWRDGNEALTTVVLNGSQTYEDPAHGNWLKETCSLNVLQVFVVRAVPVES
                     QQRLDISILVNESGAVFGVHPETRQAHFLARGLLGFFRVGFLRFCNNYCFARDCFTHP
                     ESVAPAYRATGCPRELFCRRLRKKKGLFARR"
     gene            complement(56172..57473)
                     /gene="UL44"
                     /note="core gene"
     CDS             complement(56172..57473)
                     /gene="UL44"
                     /note="dsDNA-binding protein; involved in DNA replication"
                     /codon_start=1
                     /product="DNA polymerase processivity subunit"
                     /protein_id="ADD39104.1"
                     /translation="MDRKTRLSEPPTLALRLKPYKTAIQQLRSVIRALKENTTVTFLP
                     TPSLILQTVRSHCVSKITFNSSCLYITDKSFQPKTINNSTPLLGNFMYLTSSKDLTKF
                     YVQDISDLSAKISMCAPDFNMEFSSACVHGQDIVRESENSAVHVDLDFGVVADLLKWI
                     GPHTRVKRNVKKAPCPTGTVQILVHAGPPAIKFILTNGSELEFTANNRVSFHGVKNMR
                     INVQLKNFYQTLLNCAVTKLPCTLRIVTEHDTLLYVASRNGLFAVENFLTEEPFQRGD
                     PFDKNYVGNSGKSRGGGGGGGSLSSLANAGGLHDDGPGLDNDLMNEPMGLGGLGGGGG
                     GGGKKHDRGGGGGSGTRKMSSGGGGGDHDHGLSSKEKYEQHKITSYLTSKGGSGGGGG
                     GGGGGLDRNSGNYFNDAKEESDSEDSVTFEFVPNTKKQKCG"
     gene            complement(57614..60334)
                     /gene="UL45"
                     /note="core gene"
     CDS             complement(57614..60334)
                     /gene="UL45"
                     /note="enzymatically inactive; tegument protein"
                     /codon_start=1
                     /product="ribonucleotide reductase subunit 1"
                     /protein_id="ADD39105.1"
                     /translation="MNPADADEEQRVSSVPAHRCRPGRIPSRGSETETEESSAEAAAD
                     TTGGDDSELEEGPLPGGDKEASAGNTNVSSGVACVAGFTSGGGVVSWRPESPSPDGTP
                     SVLSLTRDSGPAVPSRGGRVSSGLSTFNPAGATRMELDSVEEEDDFGASLCKVSPPIQ
                     ATRMLMGKKCHCHGYWGKFRFCGVQEPARELPSDRNALWREMDTVSRHSAGLGSFRLF
                     QLIMRHGPCLIRHSPRCDLLLGRFYFKANLARESRTPLCYASELCDESVRRFVLRHME
                     DLPKLAEETARFVELAGCWGLYAAILCLDKVCRQLHGQDESPGGVFLRIAVALTAAIE
                     NSRHSRIYRFHLDARFEGEVLESVLKRCRDGQLSLSTFTMSTVGFDRVPQYDFLISAD
                     PFSRDASWAAMCKWMSTLSCGVSVSVNVTRLNADVNSVIRCLGGYCDLIREKEVHRPV
                     VRVFVDMWDVAAIRVINFILKESTSELTGVCYAFNVPSVLMKRYRAREQRYSLFGRPV
                     SRRLSDLGQESAFEKEYSRCEQSCPKVVVNTDDFLKKMLLCALKGRASVVFVHHVVKY
                     SIMADSVCLPPCLSPDMASCHFGECDMPVQRLTVNVARCVFARSDEQKLHLPDVVLGN
                     TRRYFDLSVLRELVTEAVVWGNARLDALMSASEWWVESALEKLRPLHIGVAGLHTALM
                     RLGFTYFASWDLIERIFEHMYFAAVRASVDLCKSGLPRCEWFERTIYQEGKFIFELYR
                     LPRLSIASARWEALRADMLEFGLRNCQFLAVGPDDEVAHLWGVTPSVWASRGTVFEEE
                     TVWSLCPPNRECYFPTVVRRPLRVPVVNYAWLEQHQEEGKATQCLFQAAPAIQNDVEM
                     AAVNLSVFVDQCVALVFYYDSGMTPDVLLARMLKWYHWRFKVGVYKYCAS"
     gene            complement(60481..61353)
                     /gene="UL46"
                     /note="core gene"
     CDS             complement(60481..61353)
                     /gene="UL46"
                     /note="complexed 1:2 with capsid triplex subunit 2 to
                     connect capsid hexons and pentons; involved in capsid
                     morphogenesis"
                     /codon_start=1
                     /product="capsid triplex subunit 1"
                     /protein_id="ADD39106.1"
                     /translation="MDARAVAKRPRDPADEDNELVTALKAKREVNTISVRYLYHADHQ
                     ALTARFFVPEGLVEFEAQPGALLIRMETGCDSPRHLYISLYLLGIRASNVSASTRCLL
                     ESVYTASAARAALQWLDLGPHLLHRRLETLGCVKTVSLGITSLLTCVMRGYLYNTLKT
                     EVFALMIPKDMYLTWEETRGRLQYVYLIIVYDYDGPETRPGIYVLTSSIAHWQTLVDV
                     ARGKFARERCSFVNRRITRPRQIPLCTGVIQKLGWCLADDIHTSFLVHKELKLSVVRL
                     DNFSVELGDFREFV"
     gene            61352..64303
                     /gene="UL47"
                     /note="core gene"
     CDS             61352..64303
                     /gene="UL47"
                     /note="complexed with large tegument protein; involved in
                     virion morphogenesis"
                     /codon_start=1
                     /product="tegument protein UL37"
                     /protein_id="ADD39107.1"
                     /translation="MMARRTVDFKKLIEQLRARATDKAEALNTVSQLEIGAVDAQDVT
                     ASAVRAFVGALPSSGYHFGFVRQNVVFYLLSHATVQTARDPLYAAEQLHEQLDRFLRH
                     QHDGGGDEDRLPFYHNGATLTAFQKLLQTLREIQTVIAEQSGGAAAAADLIASNNASA
                     ERRGKKGGSSSGGQQPLVRRVITQLETAVTEARPYVNCRAVAELLDLTYQRLIYWACT
                     LMPYVLFRRDTDTELDTVLLMHFFYTHYRSVNGDLAVEFQNYVKNSVRHMSSFVSSDI
                     DGDQKPGAEHMRDVSYKLFVGNLQARDASGLMFPIISTRISTVNLYLSPERMFFHPGL
                     ISRLLSEEVSPRANLDAYARVCDRVLEDHLHTPRRVQRLLDLTQMVTRLVELGFNHDT
                     CAAYAQMALIQPASQKSSLFVSEIREKLIQIIYNFYTFFMCLYVYSPTFLFDHRRRLI
                     LEQHRSTLIGSKEELQHVWSNVTLNVNTHFAVQYTEEDFEAHTKGATEAEREYLYRDL
                     HSKWGVHLFTLRPSRGAAGAASPLPPLDGVTRSDILRECALVNLNEGRVNYASLLAFS
                     HHPEFPSIFAQLVVVTEFSEIFGIPQGLFQAVGSPRLFALIQLCRVLLPEQVTLYQNL
                     VSIYNLTTFVKHIDAAVFKTVRDCVFDIATTLEHLSGVPVTPNVDLLAELMARSVAHN
                     LYTTVNPLIEDVMRSSAGSLRNYLRHTRLCFGLARGRARLSEDGVTVYVEVQGQYGLR
                     VPTTRFVEQLRELVRRDRLLAENLRGLNERLLSVRVRVRQISSDTEEVSRHAKGHRTV
                     AQMSKALKKTASKIKVLETRVTLALEQAQRSNGAVVTAVQRALAVFDVLSRENLERRG
                     AQLCLTEATSLLHRHRALAPMTWPAGTGVAAAAEADRALREFLEAPWESAPQPPRLRM
                     TPDTDHEESTAGATSVPEVLGARYEPTHLAASDLLNWYIVPVSQAQQDILSSIDPPAG
                     STSVSLPPASP"
     gene            64300..71028
                     /gene="UL48"
                     /note="core gene"
     CDS             64300..71028
                     /gene="UL48"
                     /note="complexed with tegument protein UL37;
                     ubiquitin-specific protease (N-terminal region); involved
                     in capsid transport"
                     /codon_start=1
                     /product="large tegument protein"
                     /protein_id="ADD39108.1"
                     /translation="MKVTQASCHQGDIARFGARAGNQCVCNGIMFLHALHLGGTSAVL
                     QTEALDAIMEEGARLDARLERELQKKLPAGGRLPVYRLGDEVPRRLESRFGRTVHALS
                     RPFNGTTETCDLDGYMCPGIFDFLRYAHAKPRPTYVLVTVNSSARAVVFTEDHMLVFD
                     PHSSAECHNAAVYHCEGLHQVLMVLTGFGVQLSPAFYYEALFLYMLDVATVPEAEIAA
                     RLVSTYRDRDIDLTGVVRESVDTAATTTTAAPSLPPLPDPIVDPGCPPGVAPSIPVYD
                     PSSSPKKTPEKRRKDLSGSKHGGKKKPPSTTSKTLATASSSSPSAIAAASSSSTVPPS
                     YSCGEGALPALGRYQQLVDEVEQELKALTLPPLPANTSAWTLHAAGTENGANAATATA
                     PSFDEAFLTDRLQQLIIHAVNQRSCLRRPCGPQSAAQQAVRAYLGLSKKLDAFLLNWL
                     HHGLDLRRMHDYLSHKTTKDTYSMLDRALLEKMQVVFDPYGRQHGPALIAWVEEMLRY
                     VESKPTNELSQRLQRFVTKRPMPVSDSFICLRPVDFQRLTQVIEQRRRVLQRQREEYH
                     GVYEHLAGLITSIDIHDLDASDLNRREILKALQPLDDNAKQELFRLGNAKMLELQMDL
                     DRLSTQLLTRVHNHILNGFLPVEDLKQMERVVEQVLRLFYDLRDLKLCDGSYEEGFVV
                     IREQLSYLMTGTVRDNVPLLQEILQLRHAYQQATQQNEGRLTQIHDLLHVIETLVRDP
                     GSRGSALTLALVQEQLAQLEALGGLQLPEVQQRLQNAQLALSRLYEEEEETQRFLDGL
                     SYDDPPTEQTIKRHPQLREMLRRDEQTRLRLINAVLSMFHTLVMRLARDESPRPTFFD
                     AVSLLLQQLPPDSHEREDLRAANATYAQMVKKLEQIEKAGTGASEKRFQALRELVYFF
                     RNHEYFFQHMVGRLGVGPQVTELYERYQHEMEEQHLERLEREWQEEAGKLTVTSVEDV
                     QRVLARAPSHRVMHQMQQTLTTKMQDFLDKEKRKQEEQQRQLLDGYQKKVQQDLQRVV
                     DAVKGEMLSTIPHQPLEATLELLLGLDQRAQPLLDKFNQDLLSALQQLSKKLDGRINE
                     CLHGVLTGDVERRCHPHREAAMQTQASLNHLDQILGPQLLIHETQQALQHAVHQAQFI
                     EKCQQGDPTTAITGSEFEGDFVRYRSSQQKMEGQLQETRQQMTETSERLDRSLRQDPG
                     SSSVTRVPEKPFKGQELAGRITPPPADFQRPVFKTLLDQQADAARKALSDEADLLNQK
                     VQTQLRQRDEQLSTAQNLWTDLVTRHKMSGGLDVTTPDAKALMEKPLETLRELLGKAT
                     QQLPYLSAERTVRWMLAFLEEALAQITTDPTHPHHGSRTHYRNLQQQAVESAVTLAHQ
                     IEQNAACENFIAQHQEATANGASTPRVDMVQAVEAVWQRLEPGRVAGGAARHQKVQEL
                     LQRLGQTLGDLELQETLATEYFALLHGIQTFSYGLDFRSQLEKIRDLRTRFAELAKQR
                     GTRLSNEGALPNPRKPQATTSLGAFTRGLNALERHVQLGHQYLLNKLNGSSLVYRLED
                     IPSVLPPTHETDPALIMRDRLRRLCFARHHDTFLEVVDVFGMRQIVTQAGEPIHLVTD
                     YGNVAFKYLALRDDGRPLAWRRRCSGGGLKNVVTTRYKAITVAVAVCQTLRTFWPQIS
                     QYDLRPYLTQHQSHTHPAETHTLHNLKLFCYLVSTAWHQRIDTQQELTAADRVGSGEG
                     GDVGEQRPGRGTVLRLSLQEFCVLIAALYPEYIYTVLKYPVQMSLPSLTAHLHQDVIH
                     AVVNNTHKMPPDHLPEQVKAFCITPTQWPAMQLNKLFWENKLVQQLCQVGPQKSTPPL
                     GKLWLYAMATLVFPQDMLQCLWLELKPQYAETYASVSELVQTLFQIFTQQCEMVTEGY
                     TQPQLPTGEPVLQMIRVRRQDTTTTDTNTTTEPGLLDVFIQTETALDYALGSWLFGIP
                     VCLGVHVADLLKGQRILVARHLEYTSRDRDFLRIQRSRDLNLSQLLQDTWTETPLEHC
                     WLQAQIRRLRDYLRFPTRLEFIPLVIYNAQDHTVVRVLRPPSTFEQDHSRLVLDEAFP
                     TFPLYDQDDNSSADNVAASGAAPTPPVPFNRVPVNIQFLRENPPPIARVQQPPRRHRH
                     RAAAAADDDGQIDHVQDDTSRTADSALVSTAFGGSVFQENRLGETPLCRDELVAVAPG
                     AASTSFASPPITVLTQNVLSALEILRLVRLDLRQLAQSVQDTIQHMRFLYLL"
     gene            complement(71147..71374)
                     /gene="UL48A"
                     /note="core gene"
     CDS             complement(71147..71374)
                     /gene="UL48A"
                     /note="located externally on capsid hexons; involved in
                     capsid morphogenesis; possibly involved in capsid
                     transport"
                     /codon_start=1
                     /product="small capsid protein"
                     /protein_id="ADD39109.1"
                     /translation="MSNTAPGPTVANKRDEKHRHVVNVVLELPTEISEATHPVLATML
                     SKYTRMSSLFNDKCAFKLDLLRMVAVSRTRR"
     gene            complement(71367..73079)
                     /gene="UL49"
                     /note="betagamma gene"
     CDS             complement(71367..73079)
                     /gene="UL49"
                     /codon_start=1
                     /product="protein UL49"
                     /protein_id="ADD39110.1"
                     /translation="MANRRLRHAPHTATEEFHQALRRLFAPLCVHEDHFHVQLVIGRG
                     ALQPEEAAVETSQPPAQFAAQTSAVLQQQLVHHVPRSCVLHLFVTDKRFLNRELGDRL
                     YQRFLREWLVCRQAEREAVTALFQRMVMTKPYFVFLAYVYSMDCLHTVAVRTMAFLRF
                     ERYDTDYLLRRLRLYPPERLHALLDGVTSSLLGDLHRFLFGVDLRLPVLHPTSSPCLA
                     LLRAKRFDARADLAVYHRNQWCHQRQPRSPQLRGLIAALRRHAGKVPCGNPLYVLARQ
                     AVQTFCDTCPRYLVPLRALGLHDETRGGGSTAAAAAVGHAGAGQQARHVEPTKIVLFA
                     LSAALRGGLIGSVIDLPLWCLCRLKCERHLDARSLVAVVCRQCGHCLNLGKEKLHCQQ
                     NFPLNSMFYYRDRQEKSVIFNTHAELVHCSLCGSQRVVRQRVYELVSETLFGQRCVRV
                     GWKAVLGLNAACAVYDHRLAFDVILPCAARTCDSTVVVRGVTVPRLLRLTSHGHGLLC
                     ARCQTGEYRDSCLESEDGAPLCRGCALVKQTACHVGGHIVQQARGGLAATSSSSSPHG
                     LPHV"
     gene            complement(73036..74232)
                     /gene="UL50"
                     /note="core gene"
     CDS             complement(73036..74232)
                     /gene="UL50"
                     /note="type 2 membrane protein; interacts with nuclear
                     egress lamina protein; involved in nuclear egress"
                     /codon_start=1
                     /product="nuclear egress membrane protein"
                     /protein_id="ADD39111.1"
                     /translation="MEMNKVLHQDLVQATRRILKLGPSELRVTDAGLICKNPNYSVCD
                     AMLKTDTVYCVEYLLSYWESRTDHVPCFIFKNTGCAVSLCCFVRAPVKLVSPARHVGE
                     FNVLKVNESLIVTLKDIEEIKPSAYGVLTKCVVRKSNSASVFNIELIAFGPENEGEYE
                     NLLRELYAKKAASTSLAVRNHVTVSSHSGSGPSLWRARMSAALTRTAGKRSSRTASPP
                     PPPPRHPSCSPTMVAAGGAAAGPRPPPPPMAAGSWRLCRCEACMGRCGCASEGDADEE
                     EEELLALAGEGKAAAAAAGQDVGGSARRPLEEHVSRRRGVSTHHRHPPSPPCAPSLER
                     TGYRWAPSSWWRARSGPSRPQSGPWLPARFATLGPLVLALLLVLALLWRGHGQSPSPT
                     RSAHRD"
     gene            complement(74254..74727)
                     /gene="UL51"
                     /note="core gene"
     CDS             complement(74254..74727)
                     /gene="UL51"
                     /note="interacts with DNA packaging terminase subunit 2;
                     involved in DNA encapsidation"
                     /codon_start=1
                     /product="DNA packaging protein UL33"
                     /protein_id="ADD39112.1"
                     /translation="MSWAKQRVPFLDDDDGEEENDVQDDVDSPVPTRPLVIDEDAEPA
                     AGTSGGLEGGGGDDEDGEDGHALPDLDDDLLLQFEPMLPRVYDLLLPSLDARLNFVNA
                     GQKYAAFLKYVHGDCATCSHGEILREKTQLLTAIVSKLMDINGILEGKDEPAPGK"
     gene            74765..76768
                     /gene="UL52"
                     /note="core gene"
     CDS             74765..76768
                     /gene="UL52"
                     /note="involved in DNA encapsidation; possibly involved in
                     capsid transport"
                     /codon_start=1
                     /product="DNA packaging protein UL32"
                     /protein_id="ADD39113.1"
                     /translation="MNPSTHVSSNGPTTPPHGPHTTFLPPTSPAPSTSSVAAATLCSP
                     QRQAVSRYSGWSTEYTQWHSDLTTELLWHAHPRQVPMDEALAAAAAASYQVNPQHPAN
                     RYRHYEFQTLSLGTSEVDELLNCCAEETTCGGTQSTVLTNATNTTNCGGAVAGSSNAG
                     PAGASAACDLDAELAGLETSAADFEQLRRLCAPLAIDTRCNLCAIISICLKQDCDQSW
                     LLEYSLLCFKCSYAPRAALSTLIIMSEFTHLLQQHFSDLRIDDLFRHHVLTVFDFHLH
                     FFINRCFEKQVGDAVDNENVTLNHLAVVRAMVMGEDTVPYNKPRRHPQQKQKTNPYHV
                     EVPQELIDNFLEHSSPSRDRFVQLLFYMWAGTGVMSTTPLTELTHTKFARLDALSTAS
                     EREDARMMIEEEEDEEGEKGGDDPGRHNGGGTSGGFSESTLKKNVGPIYLCPVPAFFT
                     KNQTSTVCLLCELMACSYYDNVVLRELYRRVVSYCQNNVKMVDRIQLVLADLLRECTS
                     PLGAAHEDVARCGLEAPTSPGGDSDYHGLSGVDGALARPDPVFCHVLRQAGVTGIYKH
                     FFCDPQCAGNIRVTNEAVLFGRLHPHHVQEVKLAICHDNYYISRLPRRVWLCITLFKA
                     FQITKRTYKGKVHLADFMRDFTQLLESCDIKLVDPTYVIDKYV"
     gene            76761..77891
                     /gene="UL53"
                     /note="core gene"
     CDS             76761..77891
                     /gene="UL53"
                     /note="interacts with nuclear egress membrane protein;
                     involved in nuclear egress"
                     /codon_start=1
                     /product="nuclear egress lamina protein"
                     /protein_id="ADD39114.1"
                     /translation="MSSVSGVRTPRERRSALRSLLRKRRQRELASKVASTVNGATSAN
                     NHGEPPSPADARPRLTLHDLHDIFREHPELELKYLNMMKMAITGKESICLPFNFHSHR
                     QHTCLDISPYGNEQVSRIACTSCEDNRILPTASDAMVAFINQTSNIMKNRNFYYGFCK
                     SSELLKLSTNQPPIFQIYYLLHAANHDIVPFMHAEDGRLHMHVIFENPDVHIPCDCIT
                     QMLTAAREDYSVTLNIVRDHVVISVLCHAVSASSVKIDVTILQRKIDEMDIPNDVSES
                     FERYKELIQELCQSSGSNLYEEATSSYAIRSPLTASPLHVVSTNGCGPSSSSQSTPPH
                     LHPPSQATQPHHYSHHQSQSQQHHHRPQSPPPPLFLNSIRAP"
     gene            complement(77869..81597)
                     /gene="UL54"
                     /note="core gene"
     CDS             complement(77869..81597)
                     /gene="UL54"
                     /EC_number="2.7.7.7"
                     /note="involved in DNA replication"
                     /codon_start=1
                     /product="DNA polymerase catalytic subunit"
                     /protein_id="ADD39115.1"
                     /translation="MFFNPYLSGGVTGGAVAGGRRQRSQPGSAQGSGKRPPQKQFLQI
                     VPRGVMFDGQTGLIKHKTGRLPLMFYREIKHLLSHDMVWPCPWRETLVGRVVGPIRFH
                     TYDQTDAVLFFDSPENVSPRYRQHLVPSGNVLRFFGATEHGYSICVNVFGQRSYFYCE
                     YSDTDRLREVIASVGELVPEPRTPYAVSVTPATKTSIYGYGTRPVPDLQCVSISNWTM
                     ARKIGEYLLEQGFPVYEVRVDPLTRLVIDRRITTFGWCSVNRYDWRQQGRASTCDIEV
                     DCDVSDLVAVPDDSSWPRYRCLSFDIECMSGEGGFPCAEKSDDIVIQISCVCYETGGN
                     TAVDQGIPNGNDGRGCTSEGVIFGHSGLHLFTIGTCGQVGPDVDVYEFPSEYELLLGF
                     MLFFQRYAPAFVTGYNINSFDLKYILTRLEYLYKVDSQRFCKLPTAQGGRFFLHSPAV
                     GFKRQYAAAFPSASHNNPASTAATKVYIAGSVVIDMYPVCMAKTNSPNYKLNTMAELY
                     LRQRKDDLSYKDIPRCFVANAEGRAQVGRYCLQDAVLVRDLFNTINFHYEAGAIARLA
                     KIPLRRVIFDGQQIRIYTSLLDECACRDFILPNHYSKGTTVPETNSVAVSPNAAIIST
                     AAVPGDAGSVAAMFQMSPPLQSAPSSQDGVSPGSGSNSSSSVGVFSVGSGSSGGVGVS
                     NDNHGAGGTAAVSYQGATVFEPEVGYYNDPVAVFDFASLYPSIIMAHNLCYSTLLVPG
                     GEYPVDPADVYSVTLENGVTHRFVRASVRVSVLSELLNKWVSQRRAVRECMRECQDPV
                     RRMLLDKEQMALKVTCNAFYGFTGVVNGMMPCLPIAASITRIGRDMLERTARFIKDNF
                     SEPCFLHNFFNQEDYVVGTREGDSEESSTLPEGLETSSGGLDERRVEARVIYGDTDSV
                     FVRFRGLTPQALVARGPSLAHYVTACLFVEPVKLEFEKVFVSLMMICKKRYIGKVEGA
                     SGLSMKGVDLVRKTACEFVKGVTRDVLSLLFEDREVSEAAVRLSRLSLDEVKKYGVPR
                     GFWRILRRLVQARDDLYLHRVRVEDLVLSSVLSKDISLYRQSNLPHIAVIKRLAARSE
                     ELPSVGDRVFYVLTAPGVRTAPQGSSDNGDSVTAGVVSRSDAIDGTDDDADGGGVEES
                     NRRGGEPAKKRARKPPSAVCNYEVAEDPSYVREHGVPIHADKYFEQVLKAVTNVLSPV
                     FPGGETARKDKFLHMVLPRRLHLEPAFLPYSVKAHECC"
     gene            complement(81738..84455)
                     /gene="UL55"
                     /note="core gene"
     CDS             complement(81738..84455)
                     /gene="UL55"
                     /note="type 1 membrane protein; putative membrane fusogen;
                     binds cell surface heparan sulphate; involved in cell
                     entry; involved in cell-to-cell spread"
                     /codon_start=1
                     /product="envelope glycoprotein B"
                     /protein_id="ADD39116.1"
                     /translation="MESRIWCLVVCVNLCIVCLGAAVSSSSTSHATSSTHNGSHASRT
                     TSAQTRSVSSQHVTSSKAVSHRANETIYNTTLKYGDVVGVNTTKYPYRVCSMAQGTDL
                     IRFERNIVCTPMKPINEDLDEGIMVVYKRNIVAHTFKVRVYQKVLTFRRSYAYIHTTY
                     LLGSNTEYVAPPMWEIHHINSHSQCYSSYSRVIAGTVFVAYHRDSYENKTMQLMLDDY
                     SNTHSIRYVTVKDQWHSRGSTWLYRETCNLNCMVTITTARSKYPYHFFATSTGDVVDI
                     SPFYNGTNRNTSYFGENADKFFIFPNYTIVSDFGRANSAPETHRLVAFLERADSVISW
                     DIQDEKNVTCQLTFWEASERTIRSEAEDSYHFSSAKMTATFLSKKQEVNMSDPVLDCV
                     RNQALDKLQQIFNASYNQTYEKYGNVSVFETTGGLVVFWQGIKQKSLLELERLANSSG
                     VNSTRRTKRSTGNTTTLSPESESVRNVLYAQLQFTYDTLRSYINRALAQIAEAWCVDQ
                     RRTLEVFKELSKINPSAILSAIYNKPIAARFMGDVLGLASCVTINQTSVKVLRDMNVK
                     ESPGRCYSRPVVIFNFVNSSYVQYGQLGEDNEILLGNHRTEECQFPSLKIFIAGNSAY
                     EYVDYLFKRMIDLSSISTVDSMIALDIDPLENTDFRVLELYSQKELRSSNVFDLEEIM
                     REFNSYKQRVKYVEDKVVDPLPPYLKGLDDLMSGLGAAGKAVGVAIGAVGGAVASVVE
                     GVATFLKNPFGAFTIILVAIAVVIIIYLIYTRQRRLCMQPLQNLFPYLVSADGTTVTS
                     GNTKDTSLQAPPSYEESVYNSGRKGPGPPSSDASTAAPPYTNEQAYQMLLALARLDAE
                     QRAQQNGTDSLDGQTGTQDKGQKPNLLDRLRHRKNGYRHLKDSDEEENV"
     gene            complement(84418..86970)
                     /gene="UL56"
                     /note="core gene"
     CDS             complement(84418..86970)
                     /gene="UL56"
                     /note="involved in DNA encapsidation"
                     /codon_start=1
                     /product="DNA packaging terminase subunit 2"
                     /protein_id="ADD39117.1"
                     /translation="MEMNLLQKLCVVCSKCNEYAMELECLKYCDPNVLLAESTPFKRN
                     AAAIVYLYRKIYPEVVAQNRTQSSLLTLYLEMLLKALHEDTALLDRALMAYSRQPDRA
                     AFYRTVLRLDRCDRHHTVELQFTDNVRFSVSLATLNDIERFLCKMNYVYGILAPEAGL
                     EVCAQLLELLRRLCGISPVARQEVYVEGTTCAQCYEELTIIPNQGRSLNKRLQGLLCN
                     HIAVHRPSSQSDVNIQTVEQDLLDLTTRIPHLAGVLSALKSLFSSSSAYHSYIQEAEE
                     ALREYNLFTDIPERIYSLSDFTYWSRTSEVIVKRVGITIQQLNVYHQLCRALMNGISR
                     HLYGEDVEDIFVLGEKALDGEERMFVGSVFAAPNRIIDLITSLSIQAFEDNPVFNKLH
                     ESNEMYTKIKHILEEIRRPLPDGTGGDGPEGEAIHLRGREAMSGTGTTLMTASNSSNS
                     STHSQRNNGGGGRARGGGKKVVGGGVNGQDGDGSENGLRVRNCDEHEALDLVDARSRI
                     HNVTREVNVRKRAYLQKVSEVGYGKVIRCIKTQERLTSKLIDVNLVGPLCLDFISKLM
                     NGFLYRSQYHQDQDVVDVGDQFTYDEHLYVVNNLIHKSLPVESLPLLGQQIYELCNGP
                     LFTHCTDRYPLSHNVDMAYACDNAGVLPHVKDDLVKCAEGTVYPSEWMVVKYMGFFNF
                     SDCQDLNVLQKEMWMHVRELVLSVALYNETFGKQLSIACLRDELHPDRDVILTYNKEW
                     PLLLRHEGSLYKSKDLYLLLYRHLSRPDESGDVPTAPVAKPSTLTAAAAVSGVFREPD
                     RPWLPSPYPSSSTAGVSRRVRATRKRPRRASSLLDLARDEHGIQDLVPGSLR"
     gene            complement(87537..91244)
                     /gene="UL57"
                     /note="core gene"
     CDS             complement(87537..91244)
                     /gene="UL57"
                     /note="contains zinc-finger; involved in DNA replication;
                     possibly involved in gene regulation"
                     /codon_start=1
                     /product="single-stranded DNA-binding protein"
                     /protein_id="ADD39118.1"
                     /translation="MSHEELTALAPVGPAAFLYFSRLNAETQEILATLSLCDRSSSVV
                     IAPLLAGLTVEADFGVSVRTPVLCYDGGVLTKVTSFCPFALYFHHTQGIVAFTEDHGD
                     VHRLCEDARQKYALEAYTPEADRVPTDLAALCAAVGCQASETTVHVVVGNGLKEFLFA
                     GQLIPCVEEATTVRLHGGEAVRVPLYPPTLFNSLQLDAEADEVSLDARSAFVETRGLY
                     VPAVSETLFYYVYTSWCQSLRFSEPRVLIEAALRQFVHDSQQSVKLAPHKRYLGYMSQ
                     RLSSLEKDHLMLSDAVVCELAFSFASVFFDSAYQPAESMLFSEWPLVTNATDHRDLIR
                     ALTELKLHLSTHVAALVFSANSVLYQHRLVYLQSSARHPSAGGTASQETLLKAIQFTN
                     GLSAACEDVYNDARKVLKFQGAPLKDERYGPQHLALVCGTCPQLVSGFVWYLNRVSVY
                     NTGLSGSSTLTNHLVGCAAGLCEACGGTCCHTCYQTAFVRVRTRLPVVPKQPKKEPCV
                     ITVQSRFLNDVDILGSFGRRYNVDAKDGGLDGKGDDGVPGGGAGGGGGRDVSGGPSDG
                     LGGGRGGGGGGDSGGMMGRGGRMLGASVDRTYRLNRILDYCRKMRLIDPVTGEDTFSA
                     HGKSDFVAVFSALNKFVDDEALGFVSEVRLKSSRDEVAGATQAFNLDLNPYAVAFQPL
                     LAYAYFRSVFYVIQNVALITATSYIVDNPLTTNLVSKWMTQHFQSIHGAFSTTSSRKG
                     FLFTKQIKSSKNSDHDRLLDFRLYAQGTYAVVPMEIKLSRLSVPTLIMVRVKNRPIYR
                     AGKGNAGSVFFRRDHVPRRNPAKGCLGFLLYRHHERLFPECGLPCLQFWQKVCSNALP
                     KNVPIGDMGEFNAFVKFLVAVTADYQEHDLLDVAPDCVLSYVESRFHNKFLCYYGFKD
                     YIGSLHGLTTRLTTQNHAQFPHVLGASPRFSSPAEFALHVKGLKTAGVPAPMAATVAR
                     ESLVRSVFEHRSLVTVPVSVEKYAGINNSKEIYQFGQIGYFSGNGVERSLNVSSMSGQ
                     DYRFMRQRYLLATRLADVLIKRSRRENVLFDADLIKNRVMLALDAENLDCDPEVMAVY
                     EILSVREEIPASDDVLFFVDGCEALAASLMDKFAALQEQGVEDFSLENLRRVLDADAQ
                     RLTDAAGGEVHDLSALFAPSGVGAASGVGGGGLLLGESVAGNSICFGVPGETGGGCFL
                     VNAGEDEAGGVGGSSGGGGGSGLLPAKRSRL"
     repeat_region   93711..93850
                     /note="OriLyt-associated repeat"
                     /rpt_unit_range=93711..93774
     gene            93949..98873
                     /gene="RNA4.9"
     regulatory      93949..93954
                     /regulatory_class="TATA_box"
                     /gene="RNA4.9"
     ncRNA           93978..98873
                     /ncRNA_class="other"
                     /gene="RNA4.9"
                     /product="RNA4.9"
     regulatory      98848..98853
                     /regulatory_class="polyA_signal_sequence"
                     /gene="RNA4.9"
     gene            complement(99159..101378)
                     /gene="UL69"
                     /note="core gene"
     CDS             complement(99159..101378)
                     /gene="UL69"
                     /note="RNA-binding protein; shuttles between nucleus and
                     cytoplasm; inhibits pre-mRNA splicing; exports virus mRNA
                     from nucleus; exerts most effects post-transcriptionally;
                     involved in gene regulation; involved in RNA metabolism
                     and transport"
                     /codon_start=1
                     /product="multifunctional expression regulator"
                     /protein_id="ADD39119.1"
                     /translation="MELHSRGRHDAPSLSSLSERERRARRARRFCLDYEPVPRKFRRE
                     RSPTSPSTRNGAAASEYHLAEDTVGAASHHHRPCVPARRPRYSKDDDTEGDPDHYPPP
                     LPPSSRHALGGTGGHIIMGTAGFRGGHRASSSFKRRVAASASVPLNPHYGKSYDNDDG
                     EPHHHGGDSTHLRRRVPSCPTTFGSSHPSSANNHHGSSAGPQQQQMLALIDDELDAMD
                     EDELQQLSRLIEKKKRARLQRGAASSGTSPSSTSPVYDLQRYTAESLRLAPYPADLKV
                     PTAFPQDHQPRGRILLSHDELMHTDYLLHIRQQFDWLEEPLLRKLVVEKIFAVYNAPN
                     LHTLLAIIDETLSYMKYHHLHGLPVNPHDPYLETVGGMRQLLFNKLNNLDLGCILDHQ
                     DGWGDHCSTLKRLVKKPGQMSAWLRDDVCDLQKRPPETFSQPMHRAMAYVCSFSRVAV
                     SLRRRALQVTGTPQFFDQFDTNNAMGTYRCGAVSDLILGALQCHECQNEMCELRIQRA
                     LAPYRFMIAYCPFDEQSLLDLTVFAGTTTTTASNHATAGGQQRGGDQIHPTDEQCANM
                     ESRTDPATLTAYDKKDREGSHRHPSPMIAAAPPAQPPSQPQQHYSEGELEEDEDSDDA
                     SSQDLVRATDRHGDTVVYKTTAVPPSPPAPLAGVRSHRGELNLMTPSPSHGGSPPQVP
                     HKQPIIPVQSANGNHSTTATQQQPPPPPVPQEDDSVVMRCQTPDYEDMLCYSDDMDD"
     gene            complement(101478..104318)
                     /gene="UL70"
                     /note="core gene"
     CDS             complement(101478..104318)
                     /gene="UL70"
                     /note="involved in DNA replication"
                     /codon_start=1
                     /product="helicase-primase primase subunit"
                     /protein_id="ADD39120.1"
                     /translation="MTLVLFATEYDSAHIVANVLSQTPTDHCVFPLLVKHQVSRRVYF
                     CLQTQKCSDSRRVAPVFAVNNETLQLSRYLAARQPIPLSALIASLDEAETQPLYRHLF
                     RTPVLSPEHGGEVREFKHLVYFHHAAVLRHLNQVFLCPTSPSWFISVFGHTEGQVLLT
                     MAYYLFEGQYSTISTVEEYVRSFCTRDLGTIIPTHASMGEFARLLLGSPFRQRVSAFV
                     AYAVARNRRDYTELEQVDTQINAFRERARLPDTVCVHYVYLAYRTALARARLLEYRRV
                     VAYDADAAPEAQCTREPGFLGRRLSTELLDVMQKYFSLDNFLHDYVETHLLRLDESPH
                     SATSPHGLGLAGYGGRIDGTHLAGFFGTSTQLARQLERINTLSESVFSPLERSLSGLL
                     RLCASLRTAQTYTTGTLTRYSQRRYLLPEPALAPLLERPLPVYRVHLPNDQHVFCAVA
                     SETWHRSLFPRDLLRHVPDSRFSDEALTETVWLHDDDVASTSPETQFYYTRHEVFNER
                     LPVFNFVADFDLRLRDGVSGLARHTVFELCRGLRRVWMTVWASLFGYTHPDRHPVYFF
                     KSACPPNSVPVDAAGAPFDDDDYLDYRDERDTEEDEDGKENKNNVPDNGVFQKTTSSV
                     DTSPPYCRCKGKLGLRIITPFPACTVAVHPSVLRAVAQVLNHAVCLDAELHTLLDPIS
                     HPESSLDTGIYHHGRSVRLPYMYKMDQDDGYFMHRRLLPLFIVPDAYREHPLGFVRAQ
                     LDLRNLLHHHPPHDLPALPLSPPPRVILSVRDKICPSTEANFIETRSLNVTRYRRRGL
                     TEVLAYHLYGGDGATAAAISDTDLQRLVVTRVWPPLLEHLTQHYEPHVSEQFTAPHVL
                     LFQPHGACCVAVKRRDGARTRDFRCLNYTHRNPQETVQVFIDLRTEHSYALWASLWSR
                     CFTKKCHSNAKNVHISIKIRPPDAPMPPATAV"
     gene            104334..105419
                     /gene="UL71"
                     /note="core gene"
     CDS             104334..105419
                     /gene="UL71"
                     /note="involved in virion morphogenesis"
                     /codon_start=1
                     /product="tegument protein UL51"
                     /protein_id="ADD39121.1"
                     /translation="MQLAQRLCELLMCRRKAAPVADYVLLQPSEDVELRELQAFLDEN
                     FKQLEITPADLRTFSRDTDVVNHLLKLLPLYRQCQSKCAFLKGYLSEGCLPHTRPAAE
                     VECKKSQRILEALDILILKLVVGEFAMSEADSLEMLLDKFSTDQASLVEVQRVMGLVD
                     MDCEKSAYMLEAGAAATVAPPTPPAVVQGESGVREDGETVAAVSAFACPSVSDSLIPE
                     ETGVTRPMMSLAHINTVSCPTVMRFDQRLLEEGDEEDEVTVMSPSPEPVQQQPPVEPV
                     QQQPQGRGSHRRRYKESAPQETLPTNHEREILDLMRHSPDVPREAVMSPTMVTIPPPQ
                     IPFVGSARELRGVKKKKPTAAALLSSA"
     gene            complement(105500..106666)
                     /gene="UL72"
                     /note="core gene"
     CDS             complement(105500..106666)
                     /gene="UL72"
                     /note="enzymatically inactive; DURP family"
                     /codon_start=1
                     /product="deoxyuridine triphosphatase"
                     /protein_id="ACS93332.2"
                     /translation="MLTMLTDRIDSQLVLSRLPRSRFQRFWETPTLIMKEESAPSSGS
                     IILAEKSVNMRYCVRFASDSDFQTTFTLPQSVEEKYDKEQHPGEDEASSPLPSPLKVP
                     YKWMPSSFIVKQCHTQLAFYNKHIIWLSRERKVPTSLGVSLYIPEGFFGITFYKCLDA
                     QFVCMPELLESGLQVPQLDVVNLNDTFQSIFPGTIEGDIGVFPCFVPEPWQLMNLPPP
                     NEHRFFSLRTRQTLVIGPGHTQTVYFDAAYVHAPGICALIVGVRQFSQSDLIIRPTIW
                     LPGTAAGVTVVNTSHTTVCISPHTTVAKAVFTTHRFTYLPVGSHPLGQMIVPPTPDIG
                     FTHTPEHALLQRTPSPVDDDVDETEEDEKSSDAESPVNTNDVIFDVGPKPPRHP"
     gene            106682..107089
                     /gene="UL73"
                     /note="core gene"
     CDS             106682..107089
                     /gene="UL73"
                     /note="type 1 membrane protein; complexed with envelope
                     glycoprotein M; involved in virion morphogenesis; involved
                     in membrane fusion"
                     /codon_start=1
                     /product="envelope glycoprotein N"
                     /protein_id="ACS93333.1"
                     /translation="MEWNTLVLGLLVLSVAASSNNTSTASTPSPSSSTRTSTTVKSTA
                     VATTSTTTATSTSSTTSAKPGSTTHDPNVMRPHAHNDFYNAHCTSHMYELSLSSFAAW
                     WTMLNALILMGAFCIVLRHCCFQNFTATTTKGY"
     gene            complement(107061..108455)
                     /gene="UL74"
                     /note="beta gene"
     CDS             complement(107061..108455)
                     /gene="UL74"
                     /note="contains signal peptide; associated with envelope
                     glycoprotein H and envelope glycoprotein L; involved in
                     virion morphogenesis"
                     /codon_start=1
                     /product="envelope glycoprotein O"
                     /protein_id="ACS93334.1"
                     /translation="MGRKGDMRSISKLFFIISLTVLLFSIINCKVVRPPGRYWLGTVL
                     STIGKQKLDKFKLEILKQLEREPYTKYFNMTRQHVKNLTMNMTQFPQYYILAGPIRND
                     SITYLWFDFYSTQLRKPAKYVYSQYNHTAKTITFRPPSCGTVPSMTCLSEMLNVSKRN
                     DTGEQGCGNFTTFNPMFFNVPRWNTKLYVGPTKVNVDSQTIYFLGLTALLLRYAQRNC
                     THSFYLVNAMSRNLFRVPKYINGTKLKNTMRKLKRKQAPVKEQLEKKTKKSQSTTTPY
                     FSYTTSTALNVTTNATYKVTTSAKRIPTSTIAYRPDSSFMKSIMATQLRDLATWVYTT
                     LRYRNEPFCKPDRNRTAVSEFMKNTHVLIRNETPYTIYGTLDMSSLYYNETMSVENET
                     ASDNNETTPTSPSTRFQKTFIDPLWDYLDSLLFLDKIRNFSLQLPAYGNLTPPEHRRA
                     VNLSTLNSLWWWSQ"
     gene            107773..108659
                     /gene="UL74A"
                     /note="beta gene"
     CDS             join(107773..107786,108461..108659)
                     /gene="UL74A"
                     /note="type 2 membrane protein"
                     /codon_start=1
                     /product="envelope glycoprotein 24"
                     /protein_id="ACS93336.2"
                     /translation="MALTRGGDSAPSVCLVVWLACVYSLLILVVLLLIYRCCIGFQDD
                     LVSRTLAVYRACIQGPICNQTHNSTS"
     gene            complement(108831..111062)
                     /gene="UL75"
                     /note="core gene"
     CDS             complement(108831..111062)
                     /gene="UL75"
                     /note="type 1 membrane protein; putative membrane fusogen;
                     complexed with envelope glycoprotein L; involved in cell
                     entry; involved in cell-to-cell spread"
                     /codon_start=1
                     /product="envelope glycoprotein H"
                     /protein_id="ACS93335.2"
                     /translation="MRPGLPPYLTVFAVYLLSHLPSQRYGADAASEALDPHAFHLLLN
                     TYGRPIRFLRENTTQCTYNSSLRNSTVVRENAISFNFFQSYNQYYVFHMPRCLFAGPL
                     AEQFLNQVDLTETLERYQQRLNTYALVSKDLASYRSFSQQLKAQDSLGQQPTTVPPPI
                     DLSIPHVWMPPQTTPHDWKGSHTTSGLHRPHFNQTCILFDGHDLLFSTVTPCLHQGFY
                     LMDELRYVKITLTEDFFVVTVSIDDDTPMLLIFGHLPRVLFKAPYQRDNFILRQTEKH
                     ELLVLVKKAQLNRHSYLKDSDFLDAALDFNYLDLSALLRNSFHRYAVDVLKSGRCQML
                     DRRTVEMAFAYALALFAAARQEETGTEISIPRALDRQAALLQIQEFMITCLSQTPPRT
                     TLLLYPTAVDLAKRALWTPDQITDITSLVRLVYILSKQNQQHLIPQWALRQIADFALQ
                     LHKTHLASFLSAFARQELYLMGSLVHSMLVHTTERREIFIVETGLCSLAELSHFTQLL
                     AHPHHEYLSDLYTPCSSSGRRDHSLERLTRLFPDATVPATVPAALSILSTMQPSTLET
                     FPDLFCLPLGESFSALTVSEHVSYVVTNQYLIKGISYPVSTTVVGQSLIITQTDSQTK
                     CELTRNMHTTHSITAALNISLENCAFCQSALLEYDDTQGVINIMYMHDSDDVLFALDP
                     YNEVVVSSPRTHYLMLLKNGTVLEVTDVVVDATDSRLLMMSVYALSAIIGIYLLYRML
                     KTC"
     gene            111257..112234
                     /gene="UL76"
                     /note="core gene"
     CDS             111257..112234
                     /gene="UL76"
                     /codon_start=1
                     /product="nuclear protein UL24"
                     /protein_id="ADD39122.1"
                     /translation="MPSGRGDDADSTGNALRRLPHVRKRIGKRKHLDIYRRLLRVFPS
                     FVALNRLLGGLFPPELQKYRRRLFIEVRLSRRIPDCVLVFLPPDSGSRGIVYCYVIEF
                     KTTYSDADDQSVRWHATHSLQYAEGLRQLKGALVDFDFLRLPRGGGQVWSVVPSLVFF
                     QQKADRPSFYRAFRSGRFDLCTDSVLDYLGRRQDESVAHLLAATRRRLLRAARGKRAA
                     LPRARASAVAGGRGGGNARRGLARGCAHGPGAQTVSASGAQGSGSQGADLLRGSRRAR
                     VRGGGAVEPAVRARRRTVAADAATTTVSSAFVVPRDRRGRSFRRPTRSL"
     gene            111837..113783
                     /gene="UL77"
                     /note="core gene"
     CDS             111837..113783
                     /gene="UL77"
                     /note="located on capsid near vertices; possibly
                     stabilizes the capsid and retains the genome; involved in
                     DNA encapsidation"
                     /codon_start=1
                     /product="DNA packaging tegument protein UL25"
                     /protein_id="ADD39123.1"
                     /translation="MSLLHTFWRLPVAVFFEPHEENVLRCPERVLRRLLEDAAVATRG
                     GGWREDVLMDRVRKRYLRQELRDLGHRVQTYCEDLEGRVSEAEALLNQQCELDEGPSP
                     RTLLQPPCRPRSSSPGTGVAGASAVPHGLYSRHDAITGPAAAPSDAVAPSDAVAPSDA
                     VAASAAAGASSTWLAQCAERPLPGNVPSYFGITQNDPFIRFHTDFRGEVVNTMFENAS
                     TWTFSFGIWYYRLKRGLYTQPRWKRVYHLAQMDNFSISQELLLGVVNALENVTVYPTY
                     DCVLSDLEAAACLLAAYGHALWEGRDPPDSVATVLGELPQLLPRLADDVSREIAAWEG
                     PVAAGNNYYAYRDSPDLRYYMPLSGGRHYHPGTFDRHVLVRLFHKRGVLQHLPGYGTI
                     TEELVQERLSGQVRDDVLSLWSRRLLVGKLGRDVPVFVHEQQYLRSGLTCLASLLLLW
                     KVTNADSVFAPRTGKFTLADLLGSDAVAGGGLPGGRAGGEEEGYGGRHGRVRNFEFLV
                     QYYIGPWYARDPAVTLSQLFPGLALLAVTESVRSGWDPSRREDSAGGGDGGGAVLMQL
                     SKSNPVADYMFAQSSKQYGDLRRLEVHDALLFHYEHGLGRLLSVTLPRHRVSTLGSSL
                     FNVNDIYELLYFLVLGFLPSVAVL"
     gene            113872..115167
                     /gene="UL78"
                     /note="beta gene"
     CDS             113872..115167
                     /gene="UL78"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     putative chemokine receptor; possibly involved in
                     intracellular signalling; GPCR family"
                     /codon_start=1
                     /product="envelope protein UL78"
                     /protein_id="ADD39124.1"
                     /translation="MSPSAEKTTSVTDSIMLAIVNFKYMGPFEGYSMSADRAASDLLI
                     GMFGSVSLVNLLTIIGCLWVLRVTRPPVSVMIFTWNLVLSQFFSIVATMLSKGIMLRG
                     ALNLSLCRLVLFVDDVGLYSTALFFLFLILDRLSAISYGRDLWHHETRENAGVALYAV
                     AFAWVLSIVAAVPTAATGSLDYRWLGCQIPIQYAAVDLTIKMWFLLGAPMIAVLANVV
                     ELAYSDRRDHVWSYVGRVCTFYVTCLMLFVPYYCFRVLRGVLQPASAAGTGFGIMDYV
                     ELATRTLLTMRLGILPLFIIAFFSREPTKDLDDSFDYLVEKCHQSCHGHFVRRLVQAL
                     KRAMYSVELAVCYFSTSVRDVAEAVKKSSSRCYADATSAAVVVTTTTSEKATLVEHAE
                     GMASEMCPGTTIDVSAESSSVLCTDGENTVASDATVTAL"
     gene            complement(115222..116109)
                     /gene="UL79"
                     /note="betagamma gene"
     CDS             complement(115222..116109)
                     /gene="UL79"
                     /note="promotes accumulation of late transcripts"
                     /codon_start=1
                     /product="protein UL79"
                     /protein_id="ADD39125.1"
                     /translation="MMARDEENPAVPRVRTGKFSFTCANHLILQISEKMSRGQPLSSL
                     RLEELKIVRLICVLLFHRGLETLLLRETMNNLGVSDHAVLSRKTPQPYWPHLYRELRQ
                     AFPGLDFEAAVFDETRAARLSQRLCHPRLSGGLLTRFVQRHTGLPVVFPEDLARNGNI
                     LFSLGTLYGHRLFRLAAFFTRHWGAEAYEPLIRIICQKMWYFYLVGTGKMRITPDAFE
                     IQRSRHETGIFTFIMEDYRTFAGTLSRHPHRPHPQQQQHHHPGPPHPPLSHPASSCLS
                     PEAVLAARALHMPTLANDV"
     gene            116146..118275
                     /gene="UL80"
                     /note="core gene"
     CDS             116146..118275
                     /gene="UL80"
                     /EC_number="3.4.21.97"
                     /note="serine protease (N-terminal region); minor scaffold
                     protein (remainder of protein, clipped near C terminus);
                     involved in capsid morphogenesis"
                     /codon_start=1
                     /product="capsid maturation protease"
                     /protein_id="ADD39126.1"
                     /translation="MTMDEQQPQAVAPVYVGGFLARYDQSPDEAELLLPRDVVEHWLY
                     AQSQGQPSLSVALPLNINHDDTAVVGHVAAMQSVRDGLFCLGCVTSPRFLEIVRRASE
                     KSELVSRGPVSPLQPDKVVEFLSGSYAGLSLSSRRCDDVEAATSLSGSETTPFKHVAL
                     CSVGRRRGTLAVYGRDPEWVTQRFPDLTAADRDGLRAQWQRCGSTAVDASGDPFRSDS
                     YGLLGNSVDALYIRERLPKLRYDKQLVGVTERESYVKASVSPEAACDIKAASAERSGD
                     SRSQAATPATGARVPSSSPSPPVEPPSPVQPPALPASPSVLPAESPPSLSPSEPAEAA
                     SMSHPLSAAVTAATAPPGATVAGASPAVPSLAWPHDGVYLPKDAFFSLLGASRSAAPV
                     MYPGAVAAPPSASPAPLPLPSYPASYGAPVVGYDQLAVRHFADYVDPHYPGWGRRYEP
                     APSLHPSYPVPPPPSPAYYRRRDSPGGMDEPPSGWERYDGGHRGQSQKQHRHGGSGGH
                     NKRRKEAAAASSSSSSDEDLSFPGEAEHGRARKRLKSHVNSDGGSGGHAGSNQQQQQR
                     YDELRDAIHELKRDLFAARQSSTLLSAALPAAASSSPTTTTVCTPTGELTSGGGETPT
                     ALLSGGAKVAERAQAGVVNASCRLATASGSEAATAGPSTAGSSSCPASVVLAAAAAQA
                     AAASQSPPKDMVDLNRRIFVAALNKLE"
     gene            117151..118275
                     /gene="UL80.5"
                     /note="core gene"
     CDS             117151..118275
                     /gene="UL80.5"
                     /note="clipped near C terminus; involved in capsid
                     morphogenesis"
                     /codon_start=1
                     /product="capsid scaffold protein"
                     /protein_id="ADD39127.1"
                     /translation="MSHPLSAAVTAATAPPGATVAGASPAVPSLAWPHDGVYLPKDAF
                     FSLLGASRSAAPVMYPGAVAAPPSASPAPLPLPSYPASYGAPVVGYDQLAVRHFADYV
                     DPHYPGWGRRYEPAPSLHPSYPVPPPPSPAYYRRRDSPGGMDEPPSGWERYDGGHRGQ
                     SQKQHRHGGSGGHNKRRKEAAAASSSSSSDEDLSFPGEAEHGRARKRLKSHVNSDGGS
                     GGHAGSNQQQQQRYDELRDAIHELKRDLFAARQSSTLLSAALPAAASSSPTTTTVCTP
                     TGELTSGGGETPTALLSGGAKVAERAQAGVVNASCRLATASGSEAATAGPSTAGSSSC
                     PASVVLAAAAAQAAAASQSPPKDMVDLNRRIFVAALNKLE"
     gene            complement(118437..120119)
                     /gene="UL82"
     CDS             complement(118437..120119)
                     /gene="UL82"
                     /note="upper matrix protein; involved in gene regulation;
                     transcriptional activator; targeted to ND10; targets Rb
                     proteins for ubiquitin-independent proteosomal
                     degradation; DURP family"
                     /codon_start=1
                     /product="tegument protein pp71"
                     /protein_id="ADD39128.1"
                     /translation="MSQASSSPGEGPSSEAAAISEAEAASGSFGRLHCQVLRLITNVE
                     GGSLEAGRLRLLDLRTNIEVSRPSVLCCFQENKSPHDTVDLTDLNIKGRCVVGEQDRL
                     LVDLNNFGPRRLTPGSENNTVSVLAFALPLDRVPVSGLHLFQSQRRGGEENRPRVEAR
                     AIIRRTAHYWAVRLTVTPNWRRRTDSSLEAGQIFVSQFAFRAGAIPLTLVDALEQLAC
                     SDPNTYIHKTETDERGQWIMLFLHHDSPHPPTSVFLHFSVYTHRAEVVARHNPYPHLR
                     RLPDNGFQLLIPKSFTLTRIHPEYIVQIQNAFETNQTHDTIFFPENIPGVSIEAGPLP
                     DRVRITLRVTLTGDQAVHLEHRQPLGRIHFFRRGFWTLTPGKPDKIKRPQVQLRAGLF
                     PRSNVMRGAVSEFLPQSPGLPPTEEEEEEEEEEDDDDDLSSTPTPTPLSEAMFAGFEE
                     ASGDEDSDTQAGLSRALILTGQRRRSGNNGALTLVIPSWHVFASLDDLVPLTVSVQHG
                     ALRPTSYLRSDMDGDVRTAADISSTLRSVPAPRPSPISTASTSSTPRSRPRI"
     gene            complement(120309..121994)
                     /gene="UL83"
                     /note="beta gene"
     CDS             complement(120309..121994)
                     /gene="UL83"
                     /note="lower matrix protein; involved in immune
                     regulation; suppresses interferon response; inhibits NK
                     cell cytotoxicity; binds NKp30; DURP family"
                     /codon_start=1
                     /product="tegument protein pp65"
                     /protein_id="ADD39129.1"
                     /translation="MESRGRRCPEMISVLGPISGHVLKAVFSRGDTPVLPHETRLLQT
                     GIHVRVSQPSLILVSQYTPDSTPCHRGDNQLQVQHTYFTGSEVENVSVNVHNPTGRSI
                     CPSQEPMSIYVYALPLKMLNIPSINVHHYPSAAERKHRHLPVADAVIHASGKQMWQAR
                     LTVSGLAWTRQQNQWKEPDVYYTSAFVFPTKDVALRHVVCAHELVCSMENTRATKMQV
                     IGDQYVKVYLESFCEDVPSGKLFMHVTLGSDVEEDLTMTRNPQPFMRPHERNGFTVLC
                     PKNMIIKPGKISHIMLDVAFTSHEHFGLLCPKSIPGLSISGNLLMNGQQIFLEVQAIR
                     ETVELRQYDPVAALFFFDIDLLLQRGPQYSEHPTFTNQYRIQGKLEYRHTWDRHDEGA
                     AQGDDDVWTSGSDSDEELVTTERKTPRVTGGGAMAGASTSAGRKRKSASSATACTAGV
                     MTRGRLKAESTVAPEEDTDEDSDNEIHNPAVFTWPPWQAGILARNLVPMVATVQGQNL
                     KYQEFFWDANDIYRIFAELEGVWQPAAQPKRRRHRQEALPGPCIASTPKKHRG"
     gene            complement(122261..124021)
                     /gene="UL84"
                     /note="beta gene"
     CDS             complement(122261..124021)
                     /gene="UL84"
                     /note="involved in gene regulation; involved in DNA
                     replication; DURP family"
                     /codon_start=1
                     /product="protein UL84"
                     /protein_id="ADD39130.1"
                     /translation="MPRVDPNLRNRARRPRARRGGGGGVGSNSSRHSGKCRRQRRALS
                     APPLTFLATTTTTTMMGVASTDDDSLLLKTPDELDKHSGSPQTILTLTDKHDIRQPRV
                     HRGTYHLIQLHLDLRPEELRDPFQILLSTPLQLGEANGESQTAPATSQEEETAASHEP
                     EKKKEKEEKKEEDEDDRNDDRERGILCVVSNEDSDVRPAFSLFPARPGCHILRSVIDQ
                     QLTRMAIVRLSLNLFALRIITPLLKRLPLRRKAAHHTALHDCLALHLPELTFEPTLDI
                     NNVTENAASAADAAESTDADLTPTLTVRVRHALCWHRVEGGISGPRGLTSRISARLSE
                     TTAKTLGPSVFGRLELDPNESPPDLTLSSLTLYQDGMLRFNVTCDRTEAPADPVAFRL
                     RLRRETVRRPFFSDAPLPYFVPPRSGAADEGLEVRVPYELTLKNSHTLRIYRRFYGPY
                     LGVFVPHNRQGLKMPVTVWLPRSWLELTVLVSDENGATFPRDALLGRLYFISSKHTLN
                     RGCLSAMTHQVKSTLHSRSTSHSPSQQQLSVLGASIALEDLLPMRLASPETEPQNCKL
                     TENTTDKTSPVTLAMVCGDL"
     gene            complement(124053..124973)
                     /gene="UL85"
                     /note="core gene"
     CDS             complement(124053..124973)
                     /gene="UL85"
                     /note="complexed 2:1 with capsid triplex subunit 1 to
                     connect capsid hexons and pentons; involved in capsid
                     morphogenesis"
                     /codon_start=1
                     /product="capsid triplex subunit 2"
                     /protein_id="ADD39131.1"
                     /translation="MAAMEANIFCTFDHKLSIADVGKLTKLVAAVVPIPQRLHLIKHY
                     QLGLHQFVDHTRGYVRLRGLLRNMTLTLMRRVEGNQILLHVPTHGLLYTVLNTGPVTW
                     EKGDALCVLPPLFHGPLARENLLTLGQWELVLPWIVPMPLALEINQRLLIMGLFSLDR
                     SYEEVKAAVQQLQTITFRDATFTIPDPVIDQHLLIDMKTACLSMSMVANLASELTMTY
                     VRKLALEDSSMLLVKCQELLMRLDRERSVGEPRTPARPQHVSPDDEIARLSALFVMLR
                     QLDDLIREQVVFTVCDVSPDNKSATCIFKG"
     gene            complement(125135..129247)
                     /gene="UL86"
                     /note="core gene"
     CDS             complement(125135..129247)
                     /gene="UL86"
                     /note="6 copies form hexons, 5 copies form pentons;
                     involved in capsid morphogenesis"
                     /codon_start=1
                     /product="major capsid protein"
                     /protein_id="ADD39132.1"
                     /translation="MENWSALELLPKVGIPTDFLTHVKTSAGEEMFEALRIYYGDDPE
                     RYNIHFEAIFGTFCNRLEWVYFLTSGLAAAAHAIKFHDLNKLTTGKMLFHVQVPRVAS
                     GAGLPTSRQTTIMVTKYSEKSPITIPFELSAACLTYLRETFEGTILDKILNVEAMHTV
                     LRALKNTADAMERGLIHSFLQTLLRKAPPYFVVQTLVENATLARQALNRIQRSNILQS
                     FKAKMLATLFLLNRTRDRDYVLKFLTRLAEAATDSILDNPTTYTTSSGAKVSGVMVST
                     ANVMQIIMSLLSSHITKETVSAPATYGNFVLSPENAVTAISYHSILADFNSYKAHLTS
                     GQPHLPNDSLSQAGAHSLTPLSMDVIRLGEKTVIMENLRRVYKNTDTKDPLERNVDLT
                     FFFPVGLYLPEDRGYTTVESKVKLNDTVRNALPTTAYLLNRDRAVQKIDFVDALKTLC
                     HPVLHEPAPCLQAFTERGPPSEPAMQRLLECRFQQEPMGGAARRIPHFYRVRREVPRT
                     VNEIKQDFVVTDFYKVGNITLYTELHPFFDFTHCQENSETVALCTPRIVIGNLPDGLA
                     PGPFHELRTWEIMEHMRLRPPPDYEETLRLFKTTVTSPNYPELCYLVDVLVHGNADAF
                     LLIRAFIARCIVNMFHTRQLLVFAHSYALVTLIAEHLADGALPPQLLFHYRNLVAVLR
                     LVTRISALPGLNNGQLAEEPLSAYVNALHDHRLWPPFVTHLPRNMEGVQVVADRQPLN
                     PANIEARHHGVSDVPRLGAMDADEPLFVDDYRATDDEWTLQKVFYLCLIPAMTNNRAC
                     GLGLNLKTLLVDLFYRPAFLLMPAATAVSTSGTTSKESTSGVTPEDSVAAQRQAVGEM
                     LTELVEDVATDAHTPLLQACRELFLAVQFVGEHVKVLEVRAPLDHAQRQGLPDFISRQ
                     HVLYNGCCVVTAPKTLIEYSLPVPFHRFYSNPTICAALSDDIKRYVTEFPHYHRHDGG
                     FPLPTAFAHEYHNWLRSPFSRYSATCPNVLHSVMTLAAMLYKISPVSLVLQTKAHIHP
                     GFALTAVRTDTFEVDMLLYSGKSCTSVIINNPIVTKEERDISTTYHVTQNINTVDMGL
                     GYTSNTCVAYVNRVRTDMGVRVQDLFRVFPMNVYRHDEVDRWIRHAAGVERPQLLDTE
                     TISMLTFGSMSERNAAATVHGQKAVCELILTPVTMDVNYFKITNNPRGRASCMLGVDP
                     YDTEAATKAIYDHREADAQTFAATHNPWASQAGCLSDVLYNTRHRERLGYNSKFYSPC
                     AQYFNTEEIIAANKTLFKTIDEYLLRAKDCIRGDTDTQYVCVEGTEQLIENPCRLTQE
                     ALPILSTTTLALMETKLKGGAGAFATSETHFGNYVVGEIIPLQQSMLFNS"
     gene            129307..132129
                     /gene="UL87"
                     /note="betagamma gene"
     CDS             129307..132129
                     /gene="UL87"
                     /note="promotes accumulation of late transcripts"
                     /codon_start=1
                     /product="protein UL87"
                     /protein_id="ADD39133.1"
                     /translation="MAGAAPRRLGCDALIVVGGSATPRRVLHVPVHVRACNLTQELST
                     GEDARFCRPRPVNVERVRAVFAALYRACPVHARTESERVKLVLGRLLLGPVAVPCFCD
                     GEVEGHGEHLVPTTQFCRGPLLYVHRRCCCGSVTAGRALSCHVLENHVATHVLRGLLS
                     LTEWNRELPGLFCDCPGGGGALGTDERYAMACLPRDLSLHLDDYPYLMVEIGRVLSVS
                     EVDDYVTAVSGYLGEAAAPRIQVHYKLLFGLNVRPQAPCALDATRDFFLLELQKLWLG
                     VEYHHEVTSEFFGRVLAQLHRDRARVMMALRLPEQTVCHLSTFVLSRFKRQVLYFKLQ
                     VSYGKCRTGHADRSGGGGNGGSQGHHNLLCYRRLSVTFADTDTVWRNLFYVYYELARD
                     LGSHGTEDRSVSRGYGVSCAPRTSRLPPSEPTVVSANGHALSSTALPTTSAGHKLSLP
                     RDPAADRVRRYVCIISRLMFARYGERWRKHRRRRSETGEEEEETVESGETDATPPFDF
                     TGQQLRRAYQEHRRRKHLAVQRYAPCRRKLIGGMEFAEVTGVSLDRIAVNAFNTNRVI
                     NMKAALSSIAASGLGVRAPRLPKNMTHSFVMYKHTFKEPACTVSTFVSNDAVYINSLN
                     VNIRGSYPEFLYSLGVYRLHVNIDHFFLPAVVCNSNSSLDVHGLEDQAVIRSERSKVY
                     WTTNFPCMISHTNNVNVGWFKAATAIVPRVSGADLEAILLKELSCIKNMRDVCIDYGL
                     HRVFTQLELRNSYQIPFLAKQLVLFLRACLLKLHGREKRLQLDRLVFEAAQRGLFDYS
                     KNLTAHTKIKHTCALIGSRLANNVPKILARNKKVKLDHLGRNANVLTVCRHVEAHKIP
                     RTRLKVLVEALGALQSISGTPHTREVIHQTLFRLCSTAAATSGLCSSPPPLCVSSSSS
                     VTSVPTSVSVDGSSEPTSPRARFASR"
     gene            132126..133415
                     /gene="UL88"
                     /note="betagamma gene"
     CDS             132126..133415
                     /gene="UL88"
                     /codon_start=1
                     /product="tegument protein UL88"
                     /protein_id="ADD39134.1"
                     /translation="MMEAAAAAAAAFRPEERPTPGWHDAALLMDDGTVREHAFRNGPL
                     SQLIRRVLPPPPDAEDDVVFASELCFYCSGRFNRRSSVFSIYWQKHSDLVYALTGITH
                     CAKLVVECGQLGSSRLRWRDGDASGEERRGDDDSRDELYDVPGIYMIRVNDGGSTGPR
                     HVIWPGTSVLWAPDVVITTVQRRISAARALVNTFRQYFFLLERRSHEELVLCPPEMEE
                     RLAPLLQSATRGDSDMFDGVVASAYHRLRMSNIPRSSARLLEHCVGLAGAKKLLLLDV
                     PRLENYFLCQVCLYELDEDEMGEEMLGMLAGKPEDAAVSGASGGFLLHRKTMKLAACL
                     CLLLNSLHLHQEALEALDPPPPRVEENDLVNVVLRRYYRSHGGVQARTLAAARALLAD
                     YAETFSPLGSFTRLGYDRLVSADAGVSRRHLVALLRA"
     gene            complement(133412..139337)
                     /gene="UL89"
                     /note="core gene"
     CDS             complement(join(133412..134548,138450..139337))
                     /gene="UL89"
                     /note="contains ATPase domain; involved in DNA
                     encapsidation"
                     /codon_start=1
                     /product="DNA packaging terminase subunit 1"
                     /protein_id="ADD39135.1"
                     /translation="MLRGDSAAKIQERYAELQKRKSHPTSCISTAFTNVAALCRKRYQ
                     MMHPELGLAHSCNEAFLPLMAFCGRHRDYNSPEESQRELLFHERLKSALDELTFRPCS
                     EEQRASYQKLDALTELYRDPQFQQINNFMTDFKKWLDGGFSTAVEGDAKAIRLEPFQK
                     NLLIHVIFFIAVTKIPVLANRVLQYLIHAFQIDFLSQTSIDIFKQKATVFLVPRRHGK
                     TWFIIPIISFLLKHMIGISIGYVAHQKHVSQFVLKEVEFRCRHTFARDYVVENKDNVI
                     SIDHRGAKSTALFASCYNTNSIRGQNFHLLLVDEAHFIKKEAFNTILGFLAQNTTKII
                     FISSTNTTSDATCFLTRLNNAPFDMLNVVSYVCEEHLHSFTEKGDATACPCYRLHKPT
                     FISLNSQVRKTANMFMPGAFMDEIIGGTNKISQNTVLITDQSREEFDILRYSTLNTNA
                     YDYFGKTLYVYLDPAFTTNRKASGTGVAAVGAYRHQFLIYGLEHFFLRDLSESSEVAI
                     AECAAHMIISVLSLHPYLDELRIAVEGNTNQAAAVRIACLIRQSVQSSTLIRVLFYHT
                     PDQNHIEQPFYLMGRDKALAVEQFISRFNSGYIKASQELVSYTIKLSHDPIEYLLEQI
                     QNLHRVTLAEGTTARYSAKRQNRISDDLIIAVIMATYLCDDIHAIRFRVS"
     gene            134784..135119
                     /gene="UL91"
                     /note="betagamma gene"
     CDS             134784..135119
                     /gene="UL91"
                     /codon_start=1
                     /product="protein UL91"
                     /protein_id="ADD39136.1"
                     /translation="MNSLLAELNRLGVAHATTEDVFIFVDRLFQHFSFLFQAEESGPR
                     RLELVASVFEHLTVECVNDILDACSHPDVNVAETSNTCRPCPSPIPSAPKTVSGAQTS
                     CATPRAPVT"
     gene            135089..135694
                     /gene="UL92"
                     /note="betagamma gene"
     CDS             135089..135694
                     /gene="UL92"
                     /codon_start=1
                     /product="protein UL92"
                     /protein_id="ADD39137.1"
                     /translation="MCDASGACDMRHVQNAFTEEIQLHSLYACTRCFRTHLCDLGSGC
                     ALVSTLEGSVCVKTGLVYEALYPVARSHLLEPIEEAALDDVNIISAVLSGVYSYLMTH
                     AGRYADVIQEVVERDRLKKQVEDSIYFTFNKVFRSMHNVNRISVPVISQLFIQLIIGI
                     YSKQTKYDACVIKVSRKKREDALLKQMRSEYGNAPVFGSGV"
     gene            135660..137444
                     /gene="UL93"
                     /note="core gene"
     CDS             135660..137444
                     /gene="UL93"
                     /note="capsid-associated; involved in DNA encapsidation;
                     involved in capsid transport"
                     /codon_start=1
                     /product="DNA packaging tegument protein UL17"
                     /protein_id="ADD39138.1"
                     /translation="METHLYSDLAFEARFADDEQLPLHLVLDQEVLSNEEAETLRYVY
                     YRNVDSAGRSAGRAPGGDEDDAPASDDAEDAVGGDRAFDRERRTWQRACFRVLPRPLE
                     LLDYLRQSGLTVTLEKEQRVRMFYAVFTTLGLRCPDNRLSGAQTLHLRLVWPDGSYRD
                     WEFLARDLLREEMEANKRDRQHQLATATNHRRRGGLRNNLDNGSDRRLPETAMASLET
                     AVSTPFFEIPNGAGTSSANGGGRFSNLEQRVARLLRGDEEFIYHAGPLEPPSKIRGHE
                     LVQLRLDVNPDLMYATDPHDRDEVARTDEWKGAGVSRLREVWDVQHRVRLRVLWYVNS
                     FWRNRELSYDDHEVELYRALDAYRARIAVEYVLIRAVRDEIYAVLRRDGGALPQRFAC
                     HVPRNMSWRVVWELCRHALVLWMDRADVRSCIIKALTPRLSRGAAAAAQRARRQRERP
                     APKPQELLFGPRNESGPPAERTWYADVVRCVRAQVDLGVEVRAARCPRTGLWIVRDRR
                     GRLRRWLSQPEVCVLYVTPDLDFYWVLPGGFAVFSRVTLHGLAQRALRDRFQNFEAVL
                     ARGMHVEAGRQEPETPRVSGRRLPFDDL"
     gene            137302..138339
                     /gene="UL94"
                     /note="core gene"
     CDS             137302..138339
                     /gene="UL94"
                     /note="possibly involved in virion morphogenesis"
                     /codon_start=1
                     /product="tegument protein UL16"
                     /protein_id="ADD39139.1"
                     /translation="MAWRSGLCETDSRTLKQFLQEECMWKLVGKSRKHREYRAVACRS
                     TIFSPEDDSSCILCQLLLLYRDGEWIICFCCNGRYQGHYGVNHVHRRRRRICHLPTLY
                     QLSFGGPLGPASIDFLPSFSQVTSSMTCDGITPDVIYEVCMLVPQDEAKRILVKGHGA
                     MDLTCQKAVTLGGAGAWLLPRPEGYTLFFYILCYDLFTSCGNRCDIPSMTRLMAAATA
                     CGQAGCSFCTDHEGHVDPTGNYVGCTPDMGRCLCYVPCGPMTQSLIHNEEPATFFCES
                     DDAKYLCAVGSKTAAQVTLGDGLDYHIGVKDSEGRWLPVKTDVWDLVKVEEPVSRMIV
                     CSCPVLKNLVH"
     gene            139336..140931
                     /gene="UL95"
                     /note="betagamma gene"
     CDS             139336..140931
                     /gene="UL95"
                     /note="promotes accumulation of late transcripts"
                     /codon_start=1
                     /product="protein UL95"
                     /protein_id="ADD39140.1"
                     /translation="MMAAAVVRAEVRRQRREERKKMAAARTTEDLPENHVVADVACGT
                     GAVTRSSSSSLVVSSSSASGSDESSSASPLSFPVSSPSTAVRSPGSAGVSTSLCSVER
                     MVELSAQSPAADFSVSEAWRFEEAVNMALVACEAVSPYDRFRLIETPDENFLLVTNVI
                     PRESAEVPVLDSSSGGGDSGPEDKKKNVGNKTAGEKNDGGSRAKRRRRRRAPKNDAAT
                     PSFLRRHDVLERFAAAAEPLPSLCVRDYALRNADRVTYDGELIYGSYMLYRKAHVELS
                     LSSNKVQHVEAVLRQVYTPGLLDHHNVCDVEALLWLLYCGPRSFCARDTCFGREKNGC
                     PFPALLPKLFYEPVRDYMTYMNLAELYVFVWYRGYEFPAPTPQATTAGGGGGSGGGGG
                     AGACAVETSASAGRVDDAGDEVHLPLKPVSLDRLREVLQAVRGRFSGREVPAWPASSR
                     TCLLCALYSQNRLCLDLARDEARTVSYSPIVIQDCAAAVTDVTLSHILPGQSTVSLFP
                     VYHVGKLLDALSLNDAGLITLNL"
     gene            140928..141311
                     /gene="UL96"
                     /note="core gene"
     CDS             140928..141311
                     /gene="UL96"
                     /note="involved in virion morphogenesis"
                     /codon_start=1
                     /product="tegument protein UL14"
                     /protein_id="ADD39141.1"
                     /translation="MTSVNKQLLKDVMRVDLERQQHQFLRRTYGPQHRLTTQQALTVM
                     RVAAREQTRYSQRTTQCVAAHLLEQRAAVQQELQRARQLQSGNVDDALDSLTELKDTV
                     DDVRATLVDSVSGTCDLDLEVDDAV"
     gene            141432..143555
                     /gene="UL97"
                     /note="core gene"
     CDS             141432..143555
                     /gene="UL97"
                     /EC_number="2.7.11.1"
                     /note="involved in protein phosphorylation; resistance to
                     ganciclovir; high-level resistance to maribavir"
                     /codon_start=1
                     /product="tegument serine/threonine protein kinase"
                     /protein_id="ADD39142.1"
                     /translation="MSSALRSRARSASLGTTTQGWDPPPLRRPSRARRRQWMREAAQA
                     AAQAAVQAAQAAAAQVAQAHVDEDEVVDLMADEAGGGVTTLTTLSSVSTTTVLGHATF
                     SACVRSDVMRDGEKEDAASDKENLRRPVVPSTSSRGSAASGDGYHGLRCRETSAMWSF
                     EYDRDGDVTSVRRALFTGGSDPSDSVSGVRGGRKRPLRPPLVSLARTPLCRRRVGGVD
                     AVLEENDVELRAESQDSAVASGPGRVPQSLSGSSGEESATAVEADSTSHDDVHCTCSN
                     DQIITTSIRGLTCDPRMFLRLTHPELCELSISYLLVYVPKEDDFCHKICYAVDMSDES
                     YRLGQGSFGEVWPLDRYRVVKVARKHSETVLTVWMSGLIRTRAAGEQQQPPSLVGTGV
                     HRGLLTATGCCLLHNVTVHRRFHTDMFHHDQWKLACIDSYRRAFCTLADAIKFLNHQC
                     RVCHFDITPMNVLIDVNPHNPSEIVRAALCDYSLSEPYPDYNERCVAVFQETGTARRI
                     PNCSHRLRECYHPAFRPMPLQKLLICDPHARFPVAGLRRYCMSELSALGNVLGFCLMR
                     LLDRRGLDEVRMGTEALLFKHAGAACRALENGKLTHCSDACLLILAAQMSYGACLLGE
                     HGAALVSHTLRFVEAKMSSCRVRAFRRFYHECSQTMLHEYVRKNVERLLATSDGLYLY
                     NAFRRTTSIICEEDLDGDCRQLFPE"
     gene            143649..145403
                     /gene="UL98"
                     /note="core gene"
     CDS             143649..145403
                     /gene="UL98"
                     /note="involved in DNA processing"
                     /codon_start=1
                     /product="deoxyribonuclease"
                     /protein_id="ADD39143.2"
                     /translation="MWGVSSLDYDDDEELTRLLAVWDDEPLSLFLMNTFLLHQEGFRN
                     LPFTVLRLSYAYRIFAKMLRAHGTPVAEDFMTRVAALARDEGLRDILGQRHAAEASRA
                     EIAEALERVAERCDDRHGGSDDYVWLSRLLDLAPNYRQVELFQLLEKESRGQSRNSVW
                     HLLRMDTVSATKFYEAFVSGCLPGAAAADGSGGGGSHYTGSRAGVSPGIQFGIKHEGL
                     VKTLVECYVMHGREPVRDGLGLLIDPTSGLLGASMDLCFGVLKQGSGRTLLVEPCARV
                     YEIKCRYKYLRKKEDPFVQNVLRRHDAAAVASLLQSHPVPGVEFRGERETPSAREFLL
                     SHDAALFRATLKRARPLKPPEPLREYLADLLYLNKAECSEVIVFDAKHLNDDNSDGDA
                     TTTINASLGLAAGDAAGGGADHHLRGSPGDSPPPIPFEDENTPELLGRLNVYEVARFS
                     LPAFVNPRHQYYFQMLIQQYVLSQYYIKKHPDPERIDFRDLPTVYLVSAIFREREESE
                     LGCELLAGGRVFHCDHIPLLLIVTPVVFDPQFTRHAVSTVLDRWSRDLSRKTNLPIWV
                     PNSANEYVVSSVPRPVSP"
     gene            145340..145912
                     /gene="UL99"
                     /note="core gene"
     CDS             145340..145912
                     /gene="UL99"
                     /note="envelope-associated; involved in virion
                     morphogenesis"
                     /codon_start=1
                     /product="myristylated tegument protein"
                     /protein_id="ADD39144.1"
                     /translation="MGAELCKRICCEFGTTPGEPLKDALGRQVSLRSYDNIPPTSSSD
                     EGEDDDDGEDDDNEERQQKLRLCGSSCGGNDSSSGSHREAAHDGSKKNAVRSTFREDK
                     APKPSKQSKKKKKPSKRHHHQQSSIMQETDDLDEEDTSIYLSPPPVPPVQVVAKRLPR
                     PDTPRTPRQKKISQRPPTPGTKKPAASLPF"
     gene            complement(146172..147293)
                     /gene="UL100"
                     /note="core gene"
     CDS             complement(146172..147293)
                     /gene="UL100"
                     /note="type 3 membrane protein; 8 transmembrane domains;
                     complexed with envelope glycoprotein N; involved in virion
                     morphogenesis; involved in membrane fusion"
                     /codon_start=1
                     /product="envelope glycoprotein M"
                     /protein_id="ADD39145.1"
                     /translation="MAPSHVDKVNTRTWSASIVFMVLTFVNVSVHLVLSNFPHLGYPC
                     VYYHVVDFERLNMSAYNVMHLHTPMLFLDSVQLVCYAVFMQLVFLAVTIYYLVCWIKI
                     SMRKDKGMSLNQSTRDISYMGDSLTAFLFILSMDTFQLFTLTMSFRLPSMIAFMAAVH
                     FFCLTIFNVSMVTQYRSYKRSLFFFSRLHPKLKGTVQFRTLIVNLVEVALGFNTTVVA
                     MALCYGFGNNFFVRTGHMVLAVFVVYAIISIIYFLLIEAVFFQYVKVQFGYHLGAFFG
                     LCGLIYPIVQYDTFLSNEYRTGISWSFGMLFFIWAMFTTCRAVRYFRGRGSGSVKYQA
                     LATASGEEVAALSHHDSLESRRLREQEDDDDDDEDFEDA"
     gene            147471..150092
                     /gene="UL102"
                     /note="core gene"
     CDS             147471..150092
                     /gene="UL102"
                     /note="involved in DNA replication"
                     /codon_start=1
                     /product="helicase-primase subunit"
                     /protein_id="ADD39146.1"
                     /translation="MTAQPPLHHRHHPYTLFGTSCHLSWYGLLEASVPIVQCLFLDLG
                     GGRAEPRLHTFVVRGDRLPPAEVRAVHRASYAALASAVTTDADERRRGLEQRSAVLAR
                     VLLEGSALIRVLARTFTPVQIQTDASGVEILEAAPALGVETAALSNALSLFHVAKLVV
                     IGSYPEVHEPRVVTHAAERVSEEYGTHAHKKLRRGYYAYDLAMSFRVGTHKYVLERDD
                     EAVLARLFEVREVCFLRTCLRLVTPVGFVAVAVTDEQCCLLLQSAWTHLYDVLFRGFA
                     GQPPLRDYLGPDLFETGAARSFFFPGFPPVPVYAVHGLHTLMRETALDAAAEVLSWCG
                     LPDIVGSAGKLEVEPCALSLGVPEDEWQVFGTEAGGGAVRLNATAFRERPAGGDRRWL
                     LPPLPRDDGDGENNVVEVSSSTGGAHPPSDDATFTVHVRDATLHRVLIVDLVERVLAK
                     CVRARDFNPYVRYSHRLHTYAVCEKFIENLRFRSRRAFWQIQSLLGYISEHVTSACAS
                     AGLLWVLSRGHREFYVYDGYSGHGPVSAEVCVRTVVDCYWRKLFGGDDPGPTCRVQES
                     APGVLLVWGDERLVGPFNFFYGNGGAGGSPLHGVVGGFAAGHCGGACCAGCVVTHRHS
                     SGGGGSGVGDADHASGGGLDAAAGSGHNGGSDRVSPSTPPAALGGCCCAAGGDWLSAV
                     GHVLGRLPALLRERVSVSELEAVYREILFRFVARRNDVDFWLLRFQPGENEVRPHAGV
                     IDCAPFHGVWAEQGQIIVQSRDTALAADIGYGVYVDKAFAMLTACVEVWARELLSSST
                     ASTTACSSSSVLSSALPSVTSSSSGTATVSPPSCSSSSATWLEERDEWVRSLAVDAQH
                     AAKRVASEGLRFFRLNA"
     gene            complement(150257..151006)
                     /gene="UL103"
                     /note="core gene"
     CDS             complement(150257..151006)
                     /gene="UL103"
                     /note="involved in virion morphogenesis"
                     /codon_start=1
                     /product="tegument protein UL7"
                     /protein_id="ADD39147.1"
                     /translation="MEALMIRGVLEVHTDFTRQNVMIMEPQVLDFTVRGDKLWLHTEH
                     GLLVSMAEYRSELLCTSAFLGYSAVFLLETEDAVTQVRLSDLRLKHRCGIVKADNLLH
                     FALCTVISCVENCNLTRKCLHDLLQYLDAVNVRESFGRLLHHSARRLICSALYLLFEE
                     KEPHIVQYVPATFVLFQQTRHTCLQLVARFFFRLTGQDEAHSFSLKLTERKTVDGWPV
                     GLGLLDVLNANYPNLPSPPKLPPRWERGEEE"
     gene            complement(150954..153047)
                     /gene="UL104"
                     /note="core gene"
     CDS             complement(150954..153047)
                     /gene="UL104"
                     /note="dodecamer located at one capsid vertex in place of
                     penton; involved in DNA encapsidation"
                     /codon_start=1
                     /product="capsid portal protein"
                     /protein_id="ADD39148.1"
                     /translation="MERNHWNEKSSGAKRSRERDLTLSTIRSILAADERLRIKASSYL
                     GVGRGVDDEAVIDIFPTGQTMSFLRLLHGFLGTCRGQSMHQVLRDPCVLRKQLLYGVC
                     KTLFDTITVRRVAEEWKLHAALFPYRALDEEDLEQYLLVWSASLRQSVQTGVLGALRD
                     ILYQYADNDDYGLYVDWCVTVGLVPLLDVKTKPSEAAERAQFVRAAVQRATETHPLAQ
                     DLLQANLALLLQVAERLGAVRVANAPEVRVFKKVRSERLEAQLRGKHIRLYVAAEPLA
                     YERDKLLFTTPVAHLHEEILRYDGLCRHQKICQLLNTFPVKVVTASRHELNCKKLVEM
                     MEQHDRGSDAKKSIMKFLLNVSDSKSRIGIEDSVESFLQDLTPSLVDQNRLLPARGPG
                     GPGVVGPGGAVVGGPAGHVGLLPPPPGPAAPERDIRDLFKKQVIKCLEEQIQSQVDEI
                     QDLRTLNQTWENRVRELRDLLTRYASRREDSMSLGARDAELYHLPVLEAVRKARDAAP
                     FRPLAVEDNRLVANSFFSQFVPGTESLERFLTQLWENEYFRTFRLRRLVTHQGAEEAI
                     VYSNYTVERVTLPYLCHILALGTLDPVPEAYLQLSFGEIVAAAYDDSKFCRYVELICS
                     REKARRRQMSREAAGGVPERGTASSGGPGTLERSAPRRLITADEERRGPERVGRFRNG
                     GPDDPRRAGGPYGFH"
     gene            152875..155745
                     /gene="UL105"
                     /note="core gene"
     CDS             152875..155745
                     /gene="UL105"
                     /note="involved in DNA replication"
                     /codon_start=1
                     /product="helicase-primase helicase subunit"
                     /protein_id="AAR31532.2"
                     /translation="MSMTASSSTPRPTPKYDDALILNLSSAAKIERIVDKVKSLSRER
                     FAPEDFSFQWFRSISRVERTTDNNPSAATTAAATTTVHSSASSSAAAAASSEAGGTRV
                     PCVDRWPFFPFRALLVTGTAGAGKTSSIQVLAANLDCVITGTTVIAAQNLSAILNRTR
                     SAQVKTIYRVFGFVSKHVPLADSAVSHETLERYRVCEPHEETTIQRLQINDLLAYWPV
                     IADIVDKCLNMWERKAASASAAAAAAACEDLSELCESNIIVIDECGLMLRYMLQVVVF
                     FYYFYNALGDTRLYRERRVPCIICVGSPTQTEALESRYDHYTQNKSVRKGVDVLSALI
                     QNEVLINYCDIADNWVMFIHNKRCTDLDFGDLLKYMEFGIPLKEEHVAYVDRFVRPPS
                     SIRNPSYAAEMTRLFLSHVEVQAYFKRLHEQIRLSERHRLFDLPVYCVVNNRAYQELC
                     ELADPLGDSPQPVELWFRQNLARIINYSQFVDHNLSSEITKEALRPAADVVATNNSSV
                     QAHGGGGSVIGSTGGNDETAFFQDDDTTTAPDSRETLLTLRITYIKGSSVGVNSKVRA
                     CVIGYQGTVERFVDILQKDTFIERTPCEQAAYAYSLVSGLLFSAMYYFYVSPYTTEEM
                     LRELARVELPDVSSLCAAAAATAAAPAWSGGENPINNHVDADSSQGGQSVPVSQRMEH
                     GQEETHDIPCLSNHHDDSDAVTDAELMDHTSLYADPFFLKYVKPPSLALLSFEETVHM
                     YTTFRDIFLKRYQLMQRLTGGRFATLPLVTYNRRNVVFKANCQISSQTGSFVGMLSHV
                     SPAQTYTLEGYTSDNVLSLPSDRHRIHPEVVQRGLSRLVLRDALGFLFVLDVNVSRFV
                     ESAQGKSLHVCTTVDYGLTSRTAMTIAKSQGLSLEKVAVDFGDHPKNLKMSHIYVAMS
                     RVTDPEHLMMNVNPLRLPYEKNTAITPYICRALKDKRTTLIF"
     gene            complement(155744..161454)
                     /gene="RNA5.0"
     ncRNA           complement(join(155744..156056,160593..161422))
                     /ncRNA_class="other"
                     /gene="RNA5.0"
                     /product="RNA5.0"
     regulatory      complement(155773..155778)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="RNA5.0"
     gene            160639..161325
                     /gene="UL111A"
     CDS             join(160639..160818,160895..161095,161179..161325)
                     /gene="UL111A"
                     /note="contains signal peptide; involved in immune
                     regulation"
                     /codon_start=1
                     /product="interleukin-10"
                     /protein_id="AAR31534.1"
                     /translation="MLSVMVSSSLVLIVFFLGASEEAKPATTTIKNTKPQCRPEDYAT
                     RLQDLRVTFHRVKPTLQREDDYSVWLDGTVVKGCWGCSVMDWLLRRYLEIVFPAGDHV
                     YPGLKTELHSMRSTLESIYKDMRQCPLLGCGDKSVISRLSQEAERKSDNGTRKGLSEL
                     DTLFSRLEEYLHSRK"
     regulatory      complement(161449..161454)
                     /regulatory_class="TATA_box"
                     /gene="RNA5.0"
     gene            161550..163761
                     /gene="UL112"
                     /note="beta gene"
     CDS             join(161550..162306,162464..163761)
                     /gene="UL112"
                     /note="involved in gene regulation; involved in DNA
                     replication"
                     /codon_start=1
                     /product="protein UL112"
                     /protein_id="AAR31533.2"
                     /translation="MDLPTTVVRKYWTFANPNRILHQSVNQTFDVRQFVFDTARLVNC
                     VDGDGKVLHLNKGWLCATIMQHGEASAGAKTQQGFMSIDITGDGELQEHLFVRGGIVF
                     NKSVSSVVGSSGPNESALLTMISENGNLQVTYVRHYLKNHGESSSGGGGCGAASTASA
                     VCVSSLGGSGGTRDGPSAEEQQRRRQEQRHEERRKKSSSSAGGGGGGGAGGGGGGGGS
                     GGQHSSDSANGLLRDPRLMNRQKERRPPPSSENDGSPPLREAKRQKTTAQHEGHGGGG
                     KNETEQQSGGAGGGGGGGSGRMSLPLDTSEAVAFLNYSSSSSAVSSSSNNHHHHHHHH
                     NAVTDVAAGTDGALLLPIERGAVVSSPSSTSPSSLLSLPRPGSAHSAGETVQESEAAA
                     TAAAAGLMMMRRMRRAPAEAAEAPPQSEEENDSTTPVSNCRVPPNSQESAAPQPPRSP
                     RFDDIIQSLTKMLNDCKEKRLCDLPLVSSRLLPETSGGTVVVNHSSVARTAAAVSTAG
                     VGPPAAACPPLVTTGVVPSGSVAGVAPVAAAVETPAAPPRPVCEIKPYVVNPVVATAA
                     AASNSSSSSSAPLPPPPPPPGGRRGRARNNTRGGGGGGGGRNSRRQAASSSSSSSRRS
                     RRRNNRHEDEEDNDPLLRLSQVAGSGRRRGPSFLEDGLEIIDPSEEAAIAAASIAAFF
                     DD"
     gene            complement(163934..164686)
                     /gene="UL114"
                     /note="core gene"
     CDS             complement(163934..164686)
                     /gene="UL114"
                     /EC_number="3.2.2.3"
                     /note="involved in DNA repair"
                     /codon_start=1
                     /product="uracil-DNA glycosylase"
                     /protein_id="ADD39149.1"
                     /translation="MALKQWMLANIADNKGSLLTPDEQARVFCLSADWIRFLSLPDHD
                     TVLLRDTVAAVEGARQLEMVYPAPEHVHRWSYLCPPEQVRVVIVGQDPYCDGSASGLA
                     FGTLAGRLPPPSLNNVFRELARTVDGFQRPASGCLDAWARRGVLLLNTVFTVVHGQPG
                     SHRHLGWQTLSNHVIRRLSERREHLVFMLWGADAHTCEYLIDRRRHLVLKSCHPSPRN
                     TTRAFVGNDHFILANAYLDTHYRETMDWRLCG"
     gene            complement(164658..165494)
                     /gene="UL115"
                     /note="core gene"
     CDS             complement(164658..165494)
                     /gene="UL115"
                     /note="contains signal peptide; complexed with envelope
                     glycoprotein H; involved in cell entry; involved in
                     cell-to-cell spread"
                     /codon_start=1
                     /product="envelope glycoprotein L"
                     /protein_id="ADD39150.1"
                     /translation="MCRRPDCGFSFSPGPVVLLWCCLLLPIVSSVAVSVAPTAAKKVP
                     AECPELTRRCLLGEVFQGDKYESWLRPLVNVTGRDGPLSQLIRYRPVTPEAANSVLLD
                     DAFLDTLALLYNNPDQLRALLTLLSSDTAPRWMTVMRGYSECGDGSPAVYTCVDDLCR
                     GYDLTRLSYGRSIFTEHVLGFELVPPSLFNVVVAIRNEATRTNRAVRLPVSTAAAPEG
                     ITLFYGLYNAVKEFCLRHQLDPPLLRHLDKYYAGLPPELKQTRVNLPAHSRYGPQAVD
                     AR"
     gene            complement(165494..166396)
                     /gene="UL116"
     CDS             complement(165494..166396)
                     /gene="UL116"
                     /note="contains signal peptide"
                     /codon_start=1
                     /product="protein UL116"
                     /protein_id="ADD39151.1"
                     /translation="MKRRRRWRGWLLFLALCFCLLCEAVETNTTTVTSTTAAAATTNT
                     TVATTGTTTTSPNVTSTTSSATSNSISTAPATSTVSEAKNTRNNTTTVGTNATSPSPS
                     VSILTTVTPAATSTTSNGDVTSDYTPTFDLENITTTRAPTRPPAQDLCSHNLSIILYE
                     EESQSSVDIAVGEEESELEEDDDEEYDELWFPLYFEAECNLNYTLQYVNHSCDYSVRQ
                     SSVSFPPWRDIDSVTFVPRNLSNCSAHGLAVIVVGNQTWYVNPFSLAHLLDAIYNVLG
                     IEDLSANFRRQLAPYRHTLIVPQT"
     gene            complement(166393..167670)
                     /gene="UL117"
                     /note="beta gene"
     CDS             complement(166393..167670)
                     /gene="UL117"
                     /codon_start=1
                     /product="protein UL117"
                     /protein_id="ADD39152.1"
                     /translation="MVMFSQDHVQIVYGSTRICKSLAPANKRKTHRTIVVAPRRGFLR
                     IPPDGQDVNHVKIVPTTTSSSLAPPRDDERRPTPPLRPPLTIYPYGTSLIRRSARDAK
                     LRSKLIVFHITRPALGQHPQNPGISGPAAMDHSEFLTSFRREVDRQTVLTAESAPATV
                     EVCLGDALPGGVTGGGGLPAGVGSASAAVAAAAAAVAGVPVAANPVMPATATVTTPPM
                     IDLTSHHRPLTLFTPASAAAAPAVATNGGNATYILPADCRYAPLFANKYKYVFEEVSR
                     LMRLHDSTAVQLQISASCGNAFQALKSALLKLHNVTVLAGQQLITQTMPHTPQAVATF
                     KFFHQDPNRVLDCIRPVVPRSTSYHETGVYQMWVSGATKKDLFDAVTLCASIVEKQPD
                     VFNINVSLLTYPSIAAPHLPLYNEFTSFRLPTS"
     gene            complement(167783..168925)
                     /gene="UL119"
                     /note="beta gene"
     CDS             complement(join(167783..168399,168487..168925))
                     /gene="UL119"
                     /note="type 1 membrane protein; IgG Fc-binding; similar to
                     OX-2; involved in immune regulation; possibly related to
                     UL120 family"
                     /codon_start=1
                     /product="membrane glycoprotein UL119"
                     /protein_id="AAR31501.2"
                     /translation="MCPALAIALAAALLSNTHPGMGSSTTSAVTSPNITVTFTTSINT
                     PNNVTSTVTTTVQTSTFTSGSTSTSASTSVATTTQKEGHLYNVNCEASYSYDQVSLNA
                     TCKVNLLNNTKNPDILSVTCYARTNCKGPFTQVGYLSAFPSDDKGKLHLSYNATAQEL
                     LISGLRPQETTEYTCSFFSWGRHHNATWDLFTYPIYAVYGTRLNATTMRVRVLLQEHE
                     HCLLNGSSLYHPNSTVHLHQGNQLIPPWNISNVTYNGQRLREFVFYLNGTYTVVRLHV
                     QIAGRSFTTTYVFIKSDPLFEDRLLAYGVLAFLVFMVIILLYVTYMLARRRDWSYKRL
                     EEPVEEKKHPVPYFKQW"
     gene            complement(168980..169573)
                     /gene="UL120"
     CDS             complement(168980..169573)
                     /gene="UL120"
                     /note="type 1 membrane protein; UL120 family"
                     /codon_start=1
                     /product="membrane protein UL120"
                     /protein_id="AAR31502.1"
                     /translation="MYRAGVTLLVVAVISVGRWDVVAVAIGWYEPQVSVAYMYEHNDT
                     NLTIFCNTTACDSPFLASGMMISIPQNTQFLTSKVNYSDDMYNDRKNYTHELKRMLTG
                     APGTYVNGSVTCWGSNGTFGAKTFLVKSMINTTAGNTSTSIIHFVQQDELVENPAYFR
                     RSNHRAFMIVILTQVVFVVFIINASFIWSWTFKRHKR"
     gene            complement(169624..170166)
                     /gene="UL121"
     CDS             complement(169624..170166)
                     /gene="UL121"
                     /note="type 1 membrane protein; UL120 family"
                     /codon_start=1
                     /product="membrane protein UL121"
                     /protein_id="AAR31503.1"
                     /translation="MWGCGWSRILVLLPLMCIALMARGTHGAYICSPNPGRLRISCAL
                     SVLDQRLWWEIQYSSGRLTRVLVFHDEGDEGDDLHLTDTRHCTSCTHPYVISLVTPLT
                     INATLRLLIRDGMYGRGEKELCIAHLPTLRDIRTCRVDADLGLLYAVCLILSFSIVAA
                     ALWKVDYDRSVAVVSKIYKS"
     gene            complement(170294..173699)
                     /gene="UL122"
                     /note="beta gene; immediate early gene"
     CDS             complement(join(170294..171780,173324..173508,
                     173629..173699))
                     /gene="UL122"
                     /note="interacts with basal transcriptional machinery and
                     cellular transcription factors; specific DNA-binding
                     protein; involved in gene regulation"
                     /codon_start=1
                     /product="regulatory protein IE2"
                     /protein_id="AAR31505.1"
                     /translation="MESSAKRKMDPDNPDEGPSSKVPRPETPVTKATTFLQTMLRKEV
                     NSQLSLGDPLFPELAEESLKTFEQVTEDCNENPEKDVLAELGDILAQAVNHAGIDSSS
                     TGPTLTTHSCSVSSAPLNKPTPTSVAVTNTPLPGASATPELSPRKKPRKTTRPFKVII
                     KPPVPPAPIMLPLIKQEDIKPEPDFTIQYRNKIIDTAGCIVISDSEEEQGEEVETRGA
                     TASSPSTGSGTPRVTSPTHPLSQMNHPPLPDPLARPDEDSSSSSSSSCSSASDSESES
                     EEMKCSSGGGASVTSSHHGRGGFGGAASSSLLSCGHQSSGGASTGPRKKKSKRISELD
                     NEKVRNIMKDKNTPFCTPNVQTRRGRVKIDEVSRMFRNTNRSLEYKNLPFTIPSMHQV
                     LDEAIKACKTMQVNNKGIQIIYTRNHEVKSEVDAVRCRLGTMCNLALSTPFLMEHTMP
                     VTHPPEVAQRTADACNEGVKAAWSLKELHTHQLCPRSSDYRNMIIHAATPVDLLGALN
                     LCLPLMQKFPKQVMVRIFSTNQGGFMLPIYETAAKAYAVGQFEQPTETPPEDLDTLSL
                     AIEAAIQDLRNKSQ"
     gene            complement(171934..173699)
                     /gene="UL123"
                     /note="beta gene; immediate early gene"
     CDS             complement(join(171934..173153,173324..173508,
                     173629..173699))
                     /gene="UL123"
                     /note="enhances activation by IE2; interacts with basal
                     transcriptional machinery and cellular transcription
                     factor; disrupts ND10; involved in gene regulation"
                     /codon_start=1
                     /product="regulatory protein IE1"
                     /protein_id="AAR31504.1"
                     /translation="MESSAKRKMDPDNPDEGPSSKVPRPETPVTKATTFLQTMLRKEV
                     NSQLSLGDPLFPELAEESLKTFEQVTEDCNENPEKDVLAELVKQIKVRVDMVRHRIKE
                     HMLKKYTQTEEKFTGAFNMMGGCLQNALDILDKVHEPFEEMKCIGLTMQNMYENYIVP
                     EDKREMWMACIKELYNVTKGAANKLGGALQAKARAKKDELKRKMMYMCYRNVEFFTKN
                     SAFPKTTNGCSQAMAALQNLPQCSPNEIMTYSQKIFKILDEERDKVLTHIDHIFMDIL
                     TTCVETMCSEYKVTSDACMMGMYGAISLLTEFCRVLCCYILEETSVLLAKRPLITKPE
                     VINIMKRRIEEICMKVFAQYILGADPLRVCSPSVDDLRAIAEESDEENAIAAYTLATA
                     GASSSDSLVSPPESPVPATIPLSSVIVAENSDQEESEQSDEEREEGAQEEREDTVSVK
                     SEPVSEIEQVASEEEEDGAEEPTTSGGKSTHPMVTRSKADH"
     gene            173732..174190
                     /gene="UL124"
                     /note="beta gene"
     CDS             173732..174190
                     /gene="UL124"
                     /note="type 1 membrane protein"
                     /codon_start=1
                     /product="membrane protein UL124"
                     /protein_id="AAR31506.1"
                     /translation="MERNSLLVCQLLCLVARAAATSTAQTTLPSTVNSTATGVTSDSY
                     QNTTTQLPASSSAAALSLPNASAVQARSPSSFSDTYPTATALCGTLVVVGIVLCLSLA
                     STVRSKELPSDHEPLEAWEQGSDVEAPPLPEKSPCPEHVPEIRVEIPRYV"
     variation       176003..190338
                     /note="inverted compared with other strains"
     gene            176053..176826
                     /gene="UL133"
     CDS             176053..176826
                     /gene="UL133"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein UL133"
                     /protein_id="AAR31523.1"
                     /translation="MGCDVHDPSWQCQWGVPTIIVAWITCAALGIWCLAGSSADVSSG
                     PGIAAVVGCSVFMIFLCAYLIRYREFFKDSVIDLLTCRWVRYCSCSCKCSCKCISGPC
                     SRCCSACYKETMIYDMVQYGHRRRPGHGDDPDRVICEIVESPPVSAPTVSVPPPSEES
                     HQPVIPPQPPAPTSEPKPKKGRAKDKPKGRPKDKPPCEPTVSSQPPSQPTAMPGGPPD
                     APPPAMPQMPPGVAEAVQAAVQAAVAAALQQQQQHQTGT"
     gene            177003..177929
                     /gene="UL135"
     CDS             177003..177929
                     /gene="UL135"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein UL135"
                     /protein_id="AAR31522.1"
                     /translation="MVWIWLGIGLLGGTGLASLVLAISLFTQRRGRKRSDETSSRGRL
                     PGAASDKRGACACCYRNPKEDVVEPLDLELGLMRVATHPPTPQVPRCTSLYIGEDGLP
                     IDKPEFPPARFEIPDVSTPGTPTSIGRSPSHCSSSSSLSSSTSVDTVLHQPPPSWKPP
                     PPPGRKKRPPTPPVRAPTTRLSSHRPPTPIPAPRKNLSTPPTKKTPPPTKPKPVGWTP
                     PVTPRPFPKTPTPQKPPRNPRLPRTVGLENLSKVGLSCPCPRPRTPTEPTTLPIVSVS
                     ELAPPPRWSDIEELLEQAVQSVMKDAESMQMT"
     gene            178020..178742
                     /gene="UL136"
     CDS             178020..178742
                     /gene="UL136"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein UL136"
                     /protein_id="AAR31521.1"
                     /translation="MSVKGVEMPEMTWDLDVRNKWRRRKALSRIHRFWECRLRVWWLS
                     DAGVRETDPPRPRRRPTWMTAVFHVICAVLLTLMIMAIGALIAYLRYYHQDSWRDMLH
                     DLFCGCHYPEKCRRHHERQRRRRQAMDVPDPELGDPARRPLNGAMYYGSGCRFDTVEM
                     VDETRPAPPALSSPETGDDSNDDAVAGGGAGGVTSPATRTTSPNALLPEWMDAVHVAV
                     QAAVQATVQVSGPRENAVSPAT"
     gene            178825..179334
                     /gene="UL138"
     CDS             178825..179334
                     /gene="UL138"
                     /note="contains potential transmembrane domain; possibly
                     involved in latency"
                     /codon_start=1
                     /product="protein UL138"
                     /protein_id="AAR31520.1"
                     /translation="MDDLPLNVGLPIIGVMLVLIVAILCYLAYHWHDTFKLVRMFLSY
                     RWLIRCCELYGEYERRFADLSSLGLGAVRRESDRRYRFSERPDEILVRWEEVSSQCSY
                     ASSRITDRRVGSSSSSSVHVASQRNSVPPPDMAVTAPLTDVDLLKPVTGSATQFTTVA
                     MVHYHQEYT"
     gene            179897..180304
                     /gene="UL139"
     CDS             179897..180304
                     /gene="UL139"
                     /note="type 1 membrane protein"
                     /codon_start=1
                     /product="membrane glycoprotein UL139"
                     /protein_id="AAR31519.1"
                     /translation="MLWILVLFALAASASETTTGTSSNSSQSTSATANTTVSTCINAS
                     NGSSWTVPQLALLAASGWTLSGLLLLFTCCFCCFWLVRKICSCCGNSSESESKTTHAY
                     TNAAFTSSDATLPMGTTGSYTPPQDGSFPPPPR"
     gene            180486..181061
                     /gene="UL140"
     CDS             180486..181061
                     /gene="UL140"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein UL140"
                     /protein_id="AAR31518.1"
                     /translation="MTPAQTNATTTVHPHDAKNGSGGSALPTLVVFGFIVTLLFFLFM
                     LYFWNNDVFRKLLRCAWIQRCCDRFDAWQDEVIYRRPSRRSQSDDESRTNSVSSYVLL
                     SPASDGGFDNPALTEAVDSVDDWATTSVFYATSDETADAERRDSQQLLIELPPEPLPP
                     DVVAAMQKAVKRAVQNALRHSHDSWQLHQTL"
     gene            181360..182376
                     /gene="UL141"
     CDS             181360..182376
                     /gene="UL141"
                     /note="type 1 membrane protein; inhibits NK cell
                     cytotoxicity; sequesters CD155; acts on activating
                     receptor DNAM-1, CD96; involved in immune regulation; UL14
                     family"
                     /codon_start=1
                     /product="membrane glycoprotein UL141"
                     /protein_id="AAR31517.1"
                     /translation="MCRRESLRTLPWLFWVLLSCPRLLEYSSSSFPFATADIAEKMWA
                     ENYETTSPAPVLVAEGEQVTIPCTVMTHSWPMVSIRARFCRSHDGSDELILDAVKGHR
                     LMNGLQYRLPYATWNFSQLHLGQIFSLTFNVSMDTAGMYECVLRNYSHGLIMQRFVIL
                     TQLETLSRPDEPCCTPALGRYSLGDQIWSPTPWRLRNHDCGTYRGFQRNYFYIGRADA
                     EDCWKPACPDEEPDRCWTVIQRYRLPGDCYRSQPHPPKFLPVTPAPPADIDTGMSPWA
                     TRGIAAFLGFWSIFTVCFLCYLCYLQCCGRWCPTPGRGRRGGEGYRRLPTYDSYPGVR
                     KMKR"
     gene            182449..183369
                     /gene="UL142"
     CDS             182449..183369
                     /gene="UL142"
                     /note="type 1 membrane protein; inhibits NK cell
                     cytotoxicity; downregulates MICA; acts on activating
                     receptor NKG2D; involved in immune regulation; MHC family"
                     /codon_start=1
                     /product="membrane glycoprotein UL142"
                     /protein_id="AAR31516.1"
                     /translation="MRIEWVWWLFGYFVSSVGSERSLSYRYHLESNSSTNVVCNGNIS
                     VFVNGTLGVRYNITVGISSSLLIGHLTIQVLESWFTPWVQNKSYNKQPLGDTETLYNI
                     DSENIHRVSQYFHTRWIKSLQENHTCDLTNSTPTYTYQVNVNNTNYLTLTSSGWQDRL
                     NYTVINSTHFNLTESNITSIQKYLNTTCIERLRNYTLESVYTTTVPQNITTSQHATTT
                     MHTIPPNTITIQNTTQSHTVQTPSFNDTHNVTKHTLNISYVLSQKTNNTTSPWIYAIP
                     MGATATIGAGLYIGKHFTPVKFVYEVWRGQ"
     gene            184009..184539
                     /gene="UL144"
     CDS             184009..184539
                     /gene="UL144"
                     /note="type 1 membrane protein; similar to TNFR; interacts
                     with BTLA and inhibits T cell proliferation; does not bind
                     TNF superfamily ligands; activates NFkappaB via
                     TRAF6-dependent mechanism to upregulate CCL22; involved in
                     immune regulation"
                     /codon_start=1
                     /product="membrane glycoprotein UL144"
                     /protein_id="AAR31515.1"
                     /translation="MKPLIMLICFAVILLQLGVTKVCQHNEVQLGNECCPPCGSGQRV
                     TKVCTDYTSVTCTPCPNGTYVSGLYNCTDCTQCNVTQVMIRNCTSTNNTVCAPKNHTY
                     FSTPGVQHHKQRQQNHTAHITVKQGKSGRHTLAWLSLFIFLVGIILLILYLIAAYRSE
                     RCQQCCSIGKIFYRTL"
     gene            184780..185172
                     /gene="UL145"
     CDS             184780..185172
                     /gene="UL145"
                     /note="RL1 family"
                     /codon_start=1
                     /product="protein UL145"
                     /protein_id="AAR31514.1"
                     /translation="MYGVLAHYYSFISSPSVMVNFKHHNAVQLLCARTRDGTAGWERL
                     THHASYHANYGAYAVLMATSQRKSLVLHRYSAVTAVALQLMPVEMLRKLDQSDWVRGA
                     WIVSETFPTSDPKGVWSDDDSSMGGSDD"
     gene            185453..185806
                     /gene="UL146"
     CDS             185453..185806
                     /gene="UL146"
                     /note="contains signal peptide; putative secreted
                     glycoprotein; involved in immune regulation; CXCL family"
                     /codon_start=1
                     /product="chemokine vCXCL1"
                     /protein_id="AAR31513.1"
                     /translation="MRLIFGALIIFLAYVYHYEVNGTELRCRCLHRKWPPNKIILGNY
                     WLHRDPRGPGCDKNEHLLYPDGRKPPGPGVCLSPDHLFSKWLDKHNDNRWYNVNITKS
                     PGPRRINITLIGVRG"
     gene            185871..186350
                     /gene="UL147"
     CDS             185871..186350
                     /gene="UL147"
                     /note="contains signal peptide; putative secreted
                     glycoprotein; possibly involved in immune regulation; CXCL
                     family"
                     /codon_start=1
                     /product="chemokine vCXCL2"
                     /protein_id="AAR31512.1"
                     /translation="MVLTWLHHPVSNSHINLLSVRHLSLIAYMLLTICPLAVHVLELE
                     DYDRRCRCNNQILLNTLPVGTELLKPIAASESCNRQEVLAILKDKGTKCLNPNAQAVR
                     RHINRLFFRLILDEEQRIYDVVSTNIEFGAWPVPTAYKAFLWKYAKRLNYHHFRLRW"
     gene            186353..186580
                     /gene="UL147A"
     CDS             186353..186580
                     /gene="UL147A"
                     /note="type 1 membrane protein"
                     /codon_start=1
                     /product="membrane protein UL147A"
                     /protein_id="AAR31511.1"
                     /translation="MSLFYRAVALGTLSALVWYSTSILAEINENSCSSSSADHEDCEE
                     PDEIVREEQDYRALLAFSLVICGTLLVTCVI"
     gene            186649..187599
                     /gene="UL148"
     CDS             186649..187599
                     /gene="UL148"
                     /note="type 1 membrane protein"
                     /codon_start=1
                     /product="membrane protein UL148"
                     /protein_id="AAR31510.1"
                     /translation="MLRLLFTLVLLALHGQSVGASRDYVHVRLLSYRGDPLVFKHTFS
                     GVRRPFTELGWAACRDWDSMHCTPFWSTDLEQMTDSVRRYSTVSPGKEVTLQLHGNQT
                     VQPSFLSFTCRLQLEPVVENVGLYVAYVVNDGERPQQFFTPQVDVVRFALYLETLSRI
                     VEPLESGRLAVEFDTPDLALAPDLVSSLFVAGHGETDFYMNWTLRRSQTHYLEEMALQ
                     VEILKPRGVRHRAIIHHPKLQPGVGLWIDFCVYRYNARLTRGYVRYTLSPKARLPAKA
                     EGWLVSLDRFIVQYLNTLLITMMAAIWARVLITYLVSRRR"
     gene            187676..188488
                     /gene="UL132"
     CDS             187676..188488
                     /gene="UL132"
                     /note="type 1 membrane protein"
                     /codon_start=1
                     /product="envelope glycoprotein UL132"
                     /protein_id="AAO11765.2"
                     /translation="MPALRGPLRATFLALVAFGLLLQIDLSDATNVTSSTKVPTSTSN
                     RNNVDNATSSGPTTGINMTTTHESSVHNVRNNEIMKVLAILFYIVTGTSIFSFIAVLI
                     AVVYSSCCKHPGRFRFADEEAVNLLDDTDDSGGSSPFGSGSRRGSQIPAGFCSSSPYQ
                     RLETRDWDEEEEASAARERMKHDPENVIYFRKDGNLDTSFVNPNYGRGSPLTIESHLS
                     DNEEDPIRYYVSVYDELTASEMEEPSNSTSWQIPKLMKVAMQPVSLRDPEYD"
     gene            188594..189091
                     /gene="UL131A"
     CDS             join(188594..188829,188938..189091)
                     /gene="UL131A"
                     /note="contains signal peptide; complexed with envelope
                     glycoproteins H and L; essential in non-fibroblast cells;
                     involved in cell entry"
                     /codon_start=1
                     /product="envelope protein UL131A"
                     /protein_id="AAO11766.1"
                     /translation="MQLCRVWLSVCLCAVVLGQCQRETAEKNDYYRVPHYWDACSRAL
                     PDQTRYKYVEQLVDLTLNYHYDASHGLDNFDVLKRINVTEVSLLISDFRRQNRRGGTN
                     KRTTFNAAGSLAPHARSLEFSVRLFAN"
     gene            189112..189756
                     /gene="UL130"
     CDS             189112..189756
                     /gene="UL130"
                     /note="contains signal peptide; complexed with envelope
                     glycoproteins H and L; essential in non-fibroblast cells;
                     involved in cell entry"
                     /codon_start=1
                     /product="envelope glycoprotein UL130"
                     /protein_id="AAR31507.1"
                     /translation="MLRLLLRHHFHCLLLCAVWATPCLASPWSTLTANQNPSPPWSKL
                     TYSKPHDAATFYCPFLYPSPPRSPLQFSGFQQVSTGPECRNETLYLLYNREGQTLVER
                     SSTWVKKVIWYLSGRNQTILQRMPQTASKPSDGNVQISVEDAKIFGAHMVPKQTKLLR
                     FVVNDGTRYQMCVMKLESWAHVFRDYSVSFQVRLTFTEANNQTYTFCTHPNLII"
     misc_feature    189796..190338
                     /note="UL128; disrupted by inversion of genome region"
     gene            complement(190360..190602)
                     /gene="UL148A"
     CDS             complement(190360..190602)
                     /gene="UL148A"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein UL148A"
                     /protein_id="AAO11769.1"
                     /translation="MSSSNNLDPWIPVCVVVVMTSVVLFAGLHVYLWYVRRQLVAFCL
                     EKVCVRCCGKDETTPLVEDAEPPAELEMVEVSDECY"
     gene            complement(190732..190974)
                     /gene="UL148B"
     CDS             complement(190732..190974)
                     /gene="UL148B"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein UL148B"
                     /protein_id="AAR31525.1"
                     /translation="MALDTLAGLAICVGLIMGVTVIASCALLVFYYCDERGDGRPSKL
                     LQRSIRRWRHGLSTESLTAILPDGSSTEQEIYHTRL"
     gene            191058..191291
                     /gene="UL148C"
     CDS             191058..191291
                     /gene="UL148C"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein UL148C"
                     /protein_id="AAR31526.1"
                     /translation="MLTPAVFPAVLYLLALVVWVEMFCLVAVAVVEREIAWALLLRML
                     VVGLMVEVGAAAAWTFVRCLAYQRSFPVLTAFP"
     gene            191673..191861
                     /gene="UL148D"
     CDS             191673..191861
                     /gene="UL148D"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein UL148D"
                     /protein_id="AAR31527.1"
                     /translation="MTAPKCVTTSTYLVKTKEQPWWPDNAIRRWWISVAIVIFIGVCL
                     VALMYFTQQQARSGSSSG"
     gene            complement(191877..193796)
                     /gene="UL150"
     CDS             complement(191877..193796)
                     /gene="UL150"
                     /note="contains signal peptide"
                     /codon_start=1
                     /product="protein UL150"
                     /protein_id="AAR31528.1"
                     /translation="MLTLYLFTATCCFVYALPQQTPADTAICHHTWPMCSDVPHPTSS
                     AHNTALSSPHAISIEHRLLHSPSPPRENIRHSMRCRRRDMASSASTPVSHTQPLAANH
                     RRSRITYATTDPTNSPTASPAKSDKLEADADPALHRRPASLLRHLFQPCHAQRGTSNR
                     ATSQRASLNAVHHKLCGAMISSSCSTTCTPLIMDLPSLSVELSAGHKKKETPTEGGWG
                     GEEGEDDVLATIRNTLSAPTSPAAATTHRLSFPGESTFCLTAVSECSQRRTSTAALTP
                     PPPAVAAAFSFSSTVSETGTFPQSTTGRTRVDDTAVVTAGDPRSPVTHVTLLQIFRLR
                     SSLLTSRSGGALRGGEHEAIPKVASLFWTLLKATQIVEMTHKTPSADSHRNPQKYTDR
                     PQRLLLTALAIWQRTYNDTRAAHAPQVRLLGDILTYRRPQTATASTKAHTQQQPEEPK
                     GQQIWTQTAGQAAPHGDEPHSDGELRRESHSAPPTSRTLPDTILAVKRRSVAQRSHVR
                     LDAKPGLNERDGFRQRLLLPLSGYFRANELRNQQFMGYGTKNGLKNTWLTRPLGVAGG
                     VRETIGERQDRNVADSATQRVFHTLYAALQTVRVWYTALGTAWRTSGSRTRESLFDGP
                     RRRDRQAARLRRLEL"
     gene            192736..193662
                     /gene="UL150A"
     CDS             join(192736..193078,193190..193662)
                     /gene="UL150A"
                     /codon_start=1
                     /product="protein UL150A"
                     /protein_id="AFP95540.1"
                     /translation="MASCSPPRRAPPDLLVSSELRRRNIWRRVTCVTGERGSPAVTTA
                     VSSTRVRPVVLCGKVPVSETVDEKENAAATAGGGGVNAAVDVRRCEHSETAVRQKVDS
                     PGNDSRCVVAAADSSTDSDGKSIISGVQVVEHDEDIIAPQSLWCTAFKEALWDVALLE
                     VPRWAWQGWKRWRNSEAGRRWSAGSASASSLSDLAGEAVGELVGSVVAYVILERLWLA
                     ARGWVCETGVEAEEAMSRRRQRMLWRMFSRGGDGECSRRCSMEMACGEESAVL"
     repeat_region   194038..195228
                     /note="IRL"
                     /rpt_type=inverted
     repeat_region   194480..197217
                     /note="IRS"
                     /rpt_type=inverted
     repeat_region   194480..195228
                     /note="'a' sequence"
                     /rpt_type=inverted
     gene            195534..198110
                     /gene="IRS1"
                     /note="immediate early gene"
     CDS             195534..198110
                     /gene="IRS1"
                     /note="transcriptional activator; blocks phosphorylation
                     of eIF2alpha and host shutoff of protein synthesis; binds
                     dsRNA; involved in gene regulation; involved in
                     translational regulation; US22 family"
                     /codon_start=1
                     /product="tegument protein IRS1"
                     /protein_id="ADD39153.1"
                     /translation="MAQRNGMSPRPPPLGRGRGAGGPSGVGSSPSSSCVPMAATSTAG
                     TGASTAGSATPAHGVHRVEPRGPPGAPPGSGNNSNFWHGPERLLLSQIPVERQALTEL
                     EYQAMGAVWRAAFLANSTGRAMRKWSQRDAGTLLPLGRPYGFYARVTPRSQMNGVGAT
                     DLRQLSPRDAWIVLVATVVHEVDPAADPTVGDKAGHPEGLCAQDGLYLALGAGFRVFV
                     YDLANNTLILAARDADEWFRHGAGEVVRLYRCNRLGVGTPRATLLPQPALRQTLLRAE
                     EATALGRELRRRWAGTTVALQTPGRRLQPMVLLGAWQELAQYEPFASAPHPASLLTAV
                     RRHLNQRLCCGWLALGAVLPARWLGCAAGPAGPATGTAAGTTTMTAGTTLPAGASGTE
                     TEAAGGDAPCAMAGAVGSAVPVPPQPYGASAGGNAVCVPNADAHAVVGADAAAAVAAP
                     TVLVGPTAMAGPAASGTVPRAMLVVVLDELGAVFGYCPLDGHVYPLAAELSHFLRAGV
                     LGALALGRESAPAAEAARRLLPELDREQWERPRWDALHLHPRAALWAREPHGQWEFMF
                     REQRGDPINDPVAFRVSDARTLGLDLTTVMTERQSQLPEKYIGFYQIRKPPWLMEQPP
                     PPSRQTKPDAATMPPPLSAQASVSYALRYDDESWRPLSTVDDHKAWLDLDESHWVLGD
                     SRPDDIKQRRLLKATQRRGAEIDRPMPVVPEECYDQRFTTEGHQVIPLCASEPEDDDE
                     DPTYDELPSRPPQKHKPPDKPPRLCKTGPGPPPLPPKQRHGSTDGKVSAPRQSEHHKR
                     QTRPPRPPPPKFGDRTAAHLSQNMRDMYLDMCTSSGHRPRPPAPPRPKKCQTHAPHHV
                     HH"
     misc_feature    197218..232666
                     /note="US"
     gene            complement(198134..198604)
                     /gene="US1"
     CDS             complement(198134..198604)
                     /gene="US1"
                     /note="contains duplicated TT virus ORF2 motif; US1
                     family"
                     /codon_start=1
                     /product="protein US1"
                     /protein_id="ADD39154.1"
                     /translation="MASGLGDLSVGVSSLPMRELAWRRVADDSHDLWCCCMDWKAHVE
                     YAHPASELRPGSGGWPEHAEAQWRQQVHAAHDVWCNCGDWQGHALRSRSRTAESGRSS
                     SSSSVSVLSDGDQQPWWRRLRVKRPKFPSWARRWTQRHDSEERASQQAENDSTS"
     gene            complement(198922..199521)
                     /gene="US2"
     CDS             complement(198922..199521)
                     /gene="US2"
                     /note="contains potential transmembrane domain; causes
                     selective degradation of MHC-I and MHC-II; involved in
                     immune regulation; US2 family"
                     /codon_start=1
                     /product="membrane glycoprotein US2"
                     /protein_id="ADD39155.1"
                     /translation="MNNLWKAWVGLWTSMGPLIRLPDGITKAGEDALRPWKSTAKHPW
                     FEIEDNRCYIDNGKLFARGSIVGNMSRFVFDPKADYGGVGENLYVHADDVEFVPGESL
                     KWNVRNLDVMPIFETLALRLVLQGDVIWLRCVPELRVDYTSSAYMWNMQYGMVRKSYT
                     HVAWTIVFYSINITLLVLFIVYVTVDCNLSMMWMRFFVC"
     gene            complement(199936..200496)
                     /gene="US3"
                     /note="immediate early gene"
     CDS             complement(199936..200496)
                     /gene="US3"
                     /note="type 1 membrane protein; inhibits processing and
                     transport of MHC-I and MHC-II; involved in immune
                     regulation; US2 family"
                     /codon_start=1
                     /product="membrane glycoprotein US3"
                     /protein_id="ADD39156.1"
                     /translation="MKPVLVLAILAVLFLRLADSVPRPLDVVVSEIRSAHFRVEENQC
                     WFHMGMLHYKGRMSGNFTEKHFVSVGIVSQSYMDRLQVSGEQYHHDERGAYFEWNIGG
                     HPVPHTVDMVDITLSTRWGDPKKYAACVPQVRMDYSSQTINWYLQRSIRDDNWGLLFR
                     TLLVYLFSLVVLVLLTVGVSARLRFI"
     gene            complement(201209..201760)
                     /gene="US6"
     CDS             complement(201209..201760)
                     /gene="US6"
                     /note="type 1 membrane protein; inhibits TAP-mediated
                     peptide transport; involved in immune regulation; US6
                     family"
                     /codon_start=1
                     /product="membrane glycoprotein US6"
                     /protein_id="ADD39157.1"
                     /translation="MDLLIRLGFLLMCALPTPGERSSRDPITLLSLSPRQQACVPRTK
                     SYRPVCYNDTGDCTDADDSWKQLSEDFAHQCLQAAKKRPKTHKSRPNDRNLEGRLTCQ
                     RVSRLLPCDLDIHPSHRLLTLMNDCVCDGAVWNAFRLIERHGFFAVTLYLCCGITLLV
                     VILALLCSITYESTGRGIRRCGS"
     gene            complement(202186..202863)
                     /gene="US7"
     CDS             complement(202186..202863)
                     /gene="US7"
                     /note="type 1 membrane protein; possibly involved in
                     immune regulation; US6 family"
                     /codon_start=1
                     /product="membrane glycoprotein US7"
                     /protein_id="ADD39158.1"
                     /translation="MRIQLLLVSTLVACIVAKRVEDMATFRTEKQWQQDLQYQREFVK
                     RQLAPKPKSNIVVSHTVSCVIDGGNMTSVWRFEGQFNPHIASEVILHDTSGLYNVPHE
                     VQNDGQVLTVTVKRSVRADIAKVLISLKPVKLSSREYECRPQLQLPWIPRPSSFMYDS
                     YRLWYEKRWLTIILYVLMWTYLVMLLQYCIVRFIGTRLFYFLQRNITIRFTGKPTYNL
                     LTYPVKG"
     gene            complement(203066..203749)
                     /gene="US8"
     CDS             complement(203066..203749)
                     /gene="US8"
                     /note="type 1 membrane protein; binds to MHC-I; involved
                     in immune regulation; US6 family"
                     /codon_start=1
                     /product="membrane glycoprotein US8"
                     /protein_id="ADD39159.1"
                     /translation="MRRWLRLLVGLGCCWVTLAHAGNPYEDNDYYYYREDEPRQHGEP
                     NYVAPPARQFRFPPLNNVSSYQASCVVKDGVLDAVWRVQGTFYPEKGIVARVGWSGRH
                     GRKWGRLQAPECLVETTEAVFRLRQWVPTDLDHLTLHLVPCSKCKPMWCQPRYHIRYF
                     SYGNSVDNLRRLHYEYRHLELGVVIAIQMAMVLLLGYVLARTVYRVSSAYYLRWHACV
                     PQKCEKSLC"
     gene            complement(203774..204472)
                     /gene="US9"
     CDS             complement(203774..204472)
                     /gene="US9"
                     /note="type 1 membrane protein; possibly involved in
                     immune regulation; US6 family"
                     /codon_start=1
                     /product="truncated membrane glycoprotein US9"
                     /protein_id="ADD39160.1"
                     /translation="MILWSPSTCSFFWHWCLIAVSVLSSRSKESLRLSWSSDESSASS
                     SSRICPLSDSKSVRLPQYPRGFGDVSGYRVSSSVSECYVQHGVLVAAWLVRGNFSDTA
                     PRAYGTWGNERSATHFKVGAPQLENDGALRYETELPQVDARLSYVMLTVYPCSACNRS
                     VLHCRPASRLPWLPLRATPSDLERLFAERRYLTFLYVVLVQFVKHVALFSFGVQVACC
                     VYLRWIRPWVRGRG"
     gene            complement(204855..205412)
                     /gene="US10"
     CDS             complement(204855..205412)
                     /gene="US10"
                     /note="type 1 membrane protein; delays trafficking of
                     MHC-I; involved in immune regulation; US6 family"
                     /codon_start=1
                     /product="membrane glycoprotein US10"
                     /protein_id="ADD39161.1"
                     /translation="MLRRGSLRNPLATCLLWWLGVVAAATEETRKPTYFTCGCVIQNH
                     VLKGAVKLYGQFPSPKTLRASAWLHDGENHERHRQPILVEGTATATEALYILLSTELS
                     SPEGNRPRNYSVTLTLASRDCYERFVCPVYDSGTPMGVLMNLTYLWYLGDYGAILKIY
                     FGLFCGACVITRSLLLICGYYPPRE"
     gene            complement(205488..206135)
                     /gene="US11"
     CDS             complement(205488..206135)
                     /gene="US11"
                     /note="type 1 membrane protein; causes selective
                     degradation of MHC-I; involved in immune regulation; US6
                     family"
                     /codon_start=1
                     /product="membrane glycoprotein US11"
                     /protein_id="ADD39162.1"
                     /translation="MNLVMLILALWAPVAGSMPELSLTLFDEPPPLVETEPLPPLPDV
                     SEYRVESSEARCVLRSGGRLEALWTLRGNLSVPTPTPRVYYQTLEGYADRVPTPVEDV
                     SESLVAKRYWLRDYRVPQRTKLVLFYFSPCHQCQTYYVECEPRCLVPWVPLWSSLEDI
                     ERLLFEDRRLMAYYALTIKSAQYTLMMVAVIQVFWGLYVKGWLHRHFPWMFSDQW"
     gene            complement(206324..207169)
                     /gene="US12"
     CDS             complement(206324..207169)
                     /gene="US12"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     possibly involved in virion morphogenesis; US12 family"
                     /codon_start=1
                     /product="membrane protein US12"
                     /protein_id="ADD39163.1"
                     /translation="MVQIQFHQGEPLGHKKEKPPPVSPPSPPPIRRVTVITKDEDTLR
                     SVQHFLWMVRLYGTVVFQTSATIATTILFMLIPWRVTTPYLRDTLPFWSTLLPCALRC
                     HAYWLERQRRPGTLMLVMVYTTLTTISVSTIGLCFDRTVVIQAYVLSSMLCVWCTGLA
                     WLMAWNMQRRLAILCLLSFMLPILWLFIAVQSWEPYQRIILALTVSFIYGLKMVLIRD
                     TLTVLYRSPSNCYTDGDLLRTAMLLYMDQVIMFLLVVVPLTAPIWYPNYAGALGRTAH
                     WLFHK"
     gene            complement(207249..208034)
                     /gene="US13"
     CDS             complement(207249..208034)
                     /gene="US13"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     possibly involved in virion morphogenesis; US12 family"
                     /codon_start=1
                     /product="membrane protein US13"
                     /protein_id="ADD39164.1"
                     /translation="MDPPLPSLHSPQWASLLQLHHGLMWLRRFAVLVRVYALVVFHIA
                     ISTAFCGMIWLGIPDSHNICQHESSPLLLVFAPSLLWCLVLIQGERHPDDVVLTMGYV
                     GLLSVTTVFYTWCSDLPAILIDYTLVLTLWIACTGAVMVGDSFRAKRWELICSRVLTS
                     VFFITLWVIGDQTVFHHQRILLYGYGAIVFLMMTVTFYGTRYIRDELPAAQTLRGSLL
                     IYVGLVTMFKITLIVLSPNLWRLPWTTVFAAFRSSYCEGGGGS"
     gene            complement(208103..209035)
                     /gene="US14"
     CDS             complement(208103..209035)
                     /gene="US14"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     possibly involved in virion morphogenesis; US12 family"
                     /codon_start=1
                     /product="membrane protein US14"
                     /protein_id="ADD39165.1"
                     /translation="METVSTQRETASSETERTREAASAETTDATFRSLEEGSTISSRY
                     SETASTASEDAVCWLRRTAIVMRVYGLLTLETAFSVLISALVWLGYPSLGYECSDDPS
                     PLLLSCTPVLVLGALELTDHRHPSNGLVFALYVALLSFTTAGLNLCATAPIGVSSLIL
                     TWTLFVACNGVAWEHRLSSVWRDALFTSTLLTVMVSVLASTYTWLHKTLLCLYTVFVG
                     CILAVLFQDVRYIATKMPVSHIIRSSLVLYATETLIYHTTLLMLTPVVWSARWDQMFS
                     YLAKLGTYHHYRVDNGTLSVILNSTTATFQSRVA"
     gene            complement(209080..209868)
                     /gene="US15"
     CDS             complement(209080..209868)
                     /gene="US15"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     possibly involved in virion morphogenesis; US12 family"
                     /codon_start=1
                     /product="membrane protein US15"
                     /protein_id="ADD39166.1"
                     /translation="MRREKGFQAPTDGTVIYVPPGIQETRLATRSLAWVDCCRVALHT
                     YGAVGWQLAGLTALLSAFCYAAPATWFHHSRLCLTESSPSLVFVIPVTSVIFIHCYET
                     SHPSNIGVLLFYTLLHVPPLIVICLCLDGTLVVSAALFTLLAFLSCTGVALLAPERTV
                     RRQIVVVHALITLTFTAIVVVILRRGWSWCFKIVLSFSVLITCLAVSHFHEAALAVRY
                     ETPLERALLAAVKVFLSLVFTLLMVLRIMTLRTFLQTYFSSDKL"
     gene            complement(209928..210857)
                     /gene="US16"
     CDS             complement(209928..210857)
                     /gene="US16"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     possibly involved in virion morphogenesis; US12 family"
                     /codon_start=1
                     /product="membrane protein US16"
                     /protein_id="ADD39167.1"
                     /translation="MGLRFPTATQRQIVFRRLFDSGNNDDYDEAAVVAVLGWVHRFEV
                     VVRIAGLLLFQISAAVAVLGSFSLVFPTATLKSRPGFPCHVVWAPEVLLLVPVASALF
                     VYFRYERPVLAQRNRHPRCRRPFRQLVLLLAGLLAHIPALGVTCACQEPREVLTSFVL
                     TLVITLLCAEVVFICRDNCTLSDQFTLINGVWVVVFLANVLIVFTRPWTWPLRLLLGF
                     YSTVGLIFAGHFSQQVLFVRHVLMPRDVAHTSLQLFITFISLFFLILRIRNCQDLLSD
                     LRLLELPSSDAMTLTPNDLSHASSSTPLSTLSP"
     gene            complement(211002..211883)
                     /gene="US17"
     CDS             complement(211002..211883)
                     /gene="US17"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     possibly involved in virion morphogenesis; US12 family"
                     /codon_start=1
                     /product="membrane protein US17"
                     /protein_id="ADD39168.1"
                     /translation="MSPNSEATGTAWAPPPPRPSRGVIMISSVSTNDVRRFLLCMRVY
                     STVAVQGTCTFLLCLGLVLAFPHLKSTVFLCCTGFMPPLSLVVPTICLALLHGKRDEG
                     SFTSPPSPGLLTIYSVLTTLSVIVASACSSSTLVTFSGLLACVLFSLCSCVTGLAAHN
                     HRRWQVIITLFVIGVIAFLIALYLQPVPLGHKLFLGYYAMALSFMLVVTVFDTTRLFE
                     IAWSEADLLTLCLYENLVYLYLLILILFTTEDSLDKLIAWMTWLSSRATGATNAASIS
                     GCDLLREVQRNLTRTMA"
     gene            complement(212151..212975)
                     /gene="US18"
     CDS             complement(212151..212975)
                     /gene="US18"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     possibly involved in virion morphogenesis; US12 family"
                     /codon_start=1
                     /product="membrane protein US18"
                     /protein_id="ADD39169.1"
                     /translation="MGDTASVSEHHESPTVTIVPLHRSHALVAEQQLFQWLKRFKLLM
                     EVYHGLVWQLACTLTVCLLAWLAFPDVQGQCANGIVPALSSIVPVSTLAMLRGFAEFR
                     PHTTNFAHLTVACLLINTGITVCTGFCGERRVIGLSFALVMVFFVLCSGLTYLAGNNP
                     TRWKVIGIGYGWSVIVFYLLLYFSPVLWVSKIYSGLYVLVVTAASAVLIYETLDLIYQ
                     RGTLSKNSVCVSVVLYTIVMSLLNMSVAIFSGHVWVQQYAEKHGGRIDGVSLLSLL"
     gene            complement(213113..213835)
                     /gene="US19"
     CDS             complement(213113..213835)
                     /gene="US19"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     possibly involved in virion morphogenesis; US12 family"
                     /codon_start=1
                     /product="membrane protein US19"
                     /protein_id="ADD39170.1"
                     /translation="MLHVVPLEWTVEEVVPYLERLAVWLRASVLVAFQLTATVALSVL
                     SWWLMPPPVAELCERGRDDDPPPLSHLSLVVPVGCLFLLLRGPSLDRCPRKLPLLLAY
                     CLPHALAFLTLLMCQPSPQAFLSAALLALAVDLGCLGASLLGCDPGASLRRLWLPSVL
                     SLLCATALGLWLLRAAAPFFLGLHATTLLTVTLMLIHDLSLITCQSSFPESFQPSLRL
                     YVENVALFIGMYHLLRLWLWSP"
     gene            complement(213882..214646)
                     /gene="US20"
     CDS             complement(213882..214646)
                     /gene="US20"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     possibly involved in virion morphogenesis; US12 family"
                     /codon_start=1
                     /product="membrane protein US20"
                     /protein_id="ADD39171.1"
                     /translation="MQAQEANALLLSRMEALEWFKKFTVWLRVYAIFIFQLAFSFGLG
                     SVFWLGFPQNRNFCVENYSFFLTVLVPIVCMFITYTLGNEHPSNATVLFIYLLANSLT
                     AAIFQMCSESRVLVGSYVMTLALFISFTGLAFLGGRDRRRWKCISCVYVVMLLSFLTL
                     ALLSDADWLQKIVVTLCAFSISFFLGILAYDSLMVIFFCPPNQCIRHAVCLYLDSMAI
                     FLTLLLMLSGPRWISLSDGASLDNGTLTAASTTGTS"
     gene            complement(214753..215484)
                     /gene="US21"
     CDS             complement(214753..215484)
                     /gene="US21"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     possibly involved in virion morphogenesis; US12 family"
                     /codon_start=1
                     /product="membrane protein US21"
                     /protein_id="ADD39172.1"
                     /translation="MSLRGQVQIARSVFLLRIYILIWVQCLILMSVCAFCWLVLPHRL
                     EQLFSSVRLTLSCLMISIVCLGLLRWAEPNFPKNVWILLTYTLLTSVAVTASGFHFSH
                     RSVIYAMVATVTLFCFLTLATYLFARDVELQRSLLTGASTLILLLFAVFSLFPEAVSE
                     ILVMIAGLAVIVTSVVCDTQDILHDIEYESYIPGALCLYMDLMYLFVSVLYFMPSEPG
                     STHTAQTTVAATVAATAAASPQFVS"
     gene            complement(215661..217391)
                     /gene="US22"
                     /note="putative beta gene"
     CDS             complement(215661..217391)
                     /gene="US22"
                     /note="US22 family"
                     /codon_start=1
                     /product="tegument protein US22"
                     /protein_id="ADD39173.1"
                     /translation="MSLLTKAAAEAWGTYLRQRDERCEDAIRCDYGVFQFRNTVFQKT
                     LSMLQGLYLRQYDPPALRTYVQRHQGTTVALRNPANWFLVMREQAAIPQIYARSLAAD
                     YLCCDDTLEAVGVLAVRPPDSDLTRNTKQAQELPCVLMLSHYGTVYVYDWETDGLYEV
                     ASDIKAFSKNGLLWCEYVYRHPQTPFATTEPRYHVQKFLCTDPTDAAAVAKTAREMSG
                     LNLVIRTPGRTEVEPLLMLGSIEGLRACRPFDHMPAADFRDLLNFIRQRLCCEWYVVG
                     LVGYYLAYGPFVPSGLVLLDKFGVVYLHKIEDSDLYRIADNFHMFLKCGLLKLRGLCR
                     FDRGLRGECRLEELPVCHHTLKRDVLRWHGALGTITRSQLESALDWFLRPTRGTDKVP
                     NNSSAWGRTDLLPTGALQDNQNWAFPSHSVETLPALQGGLWEDNDETTQTVDGQRCFR
                     MPKFFPPPMCRAPYNECGVELPGGDSSDEDESGRPRRIANRIGDTPETPCNSENEDDT
                     TVEGTSGGPEAMDSQTPYPSEDSPTTEKEAWLQRGRRAKAMHARGHTLKQVPIPEPDQ
                     MGDDGPDPGP"
     gene            complement(217505..219280)
                     /gene="US23"
     CDS             complement(217505..219280)
                     /gene="US23"
                     /note="US22 family"
                     /codon_start=1
                     /product="protein US23"
                     /protein_id="ADD39174.1"
                     /translation="MWRTRWEDGAPTFTRNDEFLYCHTRYETFLRVMGDFQGIFECQY
                     SADVLRDWVRNHVDQVLSLGIPHNWFLQVRPGSTMPELRDQLLDDVICCPERLIVLGK
                     CVIMVEDHYEETELVLCMGGGTRLYIYEPSQEILLLCARHLDELARYGMMYTEAVYRQ
                     PQTPFATRVPHDVVAMLLRHGHDADALAACVGEHHGRDVNFHTPGRHAKTLKLLTSFG
                     CLTDCWPFEVAPAARLAECEMYVTLQLRCRWYLLGAVGSYRAGGFFDTSFLIIFDRFC
                     RFYVVIVKSHLDRSPPLQRLAGEIYRLADSLEELFRAGLMKVYVRRRYEHGLRRAARL
                     ERNGGCVHMGEAARLHFTMFDSGVDRDYARQFRWLCRGDRFRAEMLNNWDGWDAFTIW
                     QARVVRGDFAERRRPRSLGDGEEEDEGNDGRAMPVVRRRPPPMPRDDDEDNHVVPDNQ
                     NLEVIHDALADDEEQGEDDDDSGAEPMEPEENNVVPNVERGGEDAVAARMAAGHESDD
                     DEWEDLGFDLEEDTVFDLKDVDEWFEQRRLAEKERWHLGQRIVNAYRTEAEVSEAEVE
                     ARRINLNTDLSPEWVKSFDFREHFV"
     gene            complement(219376..220881)
                     /gene="US24"
     CDS             complement(219376..220881)
                     /gene="US24"
                     /note="US22 family"
                     /codon_start=1
                     /product="tegument protein US24"
                     /protein_id="ADD39175.1"
                     /translation="MMDPAAGSGPDGAAVVPPELPALPVAAEDPMALYRQVLRDFKEL
                     FFCLEPMEITRYVHRNEGRCLSLGPPKGWHVMLRTEDGIITAAKQAASKLICCREPLT
                     PLGYAVILLPEPRRDHHDGMVATPYVVFMGRFSRVYAYDTREKYMVLVSHNLDELARY
                     GVSRSEIAYRDVIHTTLRRMTVPVPRRYPKGARTMHVLFLNDTTPEGSYATAERILGC
                     DVKLHTPGYGTVIMRLMKTVQQLHRIWPFCALTEVESRRWWWAVRANLATPWYVLGVT
                     GRPRPGRSFVAEVLVLLDWFGAVYAIQMDDPNHYVRRVANTITEFFRMGLLKMVFRHR
                     RFERERQRQTRMEHRHLCPHHHERAVDHKRDILFNEDAALPDERRERERRILQQQYDW
                     LCLTERFDPHEGAWERLDPNTLVLHRYDTNSQSYVLDPDIVGVEAAEREAAGHQDDTG
                     PRLHCLVTTRSSTREGAERVITALVHQSRLVTYSDPFPLKSLTGVREYIQI"
     gene            complement(221515..223326)
                     /gene="US26"
                     /note="putative beta gene"
     CDS             complement(221515..223326)
                     /gene="US26"
                     /note="US22 family"
                     /codon_start=1
                     /product="protein US26"
                     /protein_id="ADD39176.1"
                     /translation="MRQSYRYASGAVVRRTLKGLRKLILCQDLRQDIRHLVRSYADMN
                     ISLPISAPPGWRLDFVEFEDIFGSAAVTDGPETPWGQLICCEESLESLGVLQFSTTVL
                     PRVHGPRSSSEDEDSDDDDFFVYVEEIEPPSQARLVLLLGRYETVWCLDRDRGVLYYL
                     AHSLDDFARHGLLHCEAIYGEQMRTPLLTTQPDHIICDLRLHDNSISELQRVTCRYRG
                     ECVPLRTPGEMTRPLLLCGQAENLKGVWPFICMETEQFNNLLKFFVDRLCCETMIMGV
                     VGESLPSGVFHADFVILVDRACEFFYFDVSRREIWRLADSVDMLLTVGLLKIYQAGRR
                     FHYAVDDAERLEVPGRCPHENFPFWDRFGTVERVRASTRHHELRYKWLIRKDRFIVRP
                     DWCSMRNSLDEVSGTADVSWDPRIRPDYPQTSDLECAKQYWQELNDHVREQTARYGPV
                     RRYSVWCGMSSRLERAVKRLQQRIPRQNLMNPSLMNQGLCVYYSDEEEDQEEDDTSDD
                     DDQEEETENPQNNIGSLTRTPSSPGSLKGVEERMLNVMKEAVAEQDRKKTQKKHKIDT
                     AQRRVLTRRAARAAVLEGRPTPKPTMPHPVSYLPFWM"
     gene            223692..224786
                     /gene="US27"
     CDS             223692..224786
                     /gene="US27"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     putative chemokine receptor; possibly involved in
                     intracellular signalling; GPCR family"
                     /codon_start=1
                     /product="envelope glycoprotein US27"
                     /protein_id="ADD39177.1"
                     /translation="MTTSTTTTTNIMLQVSNVTNHTLNSTEIYQLFEYTRFGVWLMCI
                     VGTFLNVLVITTILYYRRKKKSPSDTYICNLAVADLLIVVGLPFFLEYAKHHPKLSRE
                     VVCSGLNACFYICLFAGVCFLINLSMDRYCVIVWGVELNRVRNNKRATCWVVIFWILA
                     ALMGMPHYLMYSHTNNECVGEFANETSGWFPVFLNTKVNICGYLAPIVLMAYTYNRMV
                     RFIINYVGKWHMQTLHVLLVVVVSFASFWFPFNLALFLESIRLLARTQNETLQTVITF
                     CLYVGQFLAYVRACLNPGIYILVGTQMRKDMWTTLRVFACCCVKQEIPYQDIDIELQK
                     DIQRRAKHTKRTHYDRKNAPMESGEEEFLL"
     gene            224994..226058
                     /gene="US28"
     CDS             224994..226058
                     /gene="US28"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     broad spectrum CC chemokine receptor; constitutive
                     signalling; mediates cellular migration; involved in
                     intracellular signalling; GPCR family"
                     /codon_start=1
                     /product="envelope protein US28"
                     /protein_id="ADD39178.1"
                     /translation="MTPTTTTAELTTEFDYDEAATPCVFTDVLNQSKPVTLFLYGVVF
                     LFGSIGNFLVIFTITWRRRIQCSGDVYFINLAAADLLFVCTLPLWMQYLLDHNSLASV
                     PCTLLTACFYVAMFASLCFITEIALDRYYAIVYMRYRPVKQACLFSIFWWIFAVIIAI
                     PHFMVVTKKNNQCMTDYDYLEVSYPIILNVELMLGAFVIPLSVISYCYYRISRIVAVS
                     QSRHKGRIVRVLIAVVLVFIIFWLPYHLTLFVDTLKLLKWISSSCEFERSLKRALILT
                     ESLAFCHCCLNPLLYVFVGTKFRQELHCLLAEFRQRLFSRDVSWYHSMSFSRRSSPSR
                     RETSSDTLSDEVCRVSQIIP"
     gene            226221..227609
                     /gene="US29"
     CDS             226221..227609
                     /gene="US29"
                     /note="contains potential transmembrane domains"
                     /codon_start=1
                     /product="membrane protein US29"
                     /protein_id="ADD39179.1"
                     /translation="MRCFRWWLYSGWWWLTFGCARTVTVGFVAPTVRAQSTVVRSEPA
                     PPSKTRRDNNDTSYFSSTSFHSSVSPATSVDRQFRRPTYDRWDGRRWLRTRYGNASAC
                     VTGTQWSTNFFFSQCEHYPSFVKLNGVQRWTPVRRPMGEVAYYGGCCMVGGGNRAYVI
                     LVSGYGTASYGNALRVNFGRGNCTAPKRTYPRRLELHDGRTDPSRCDPYQVYFYGLQC
                     PEQLVITAHGGVGMRRCPTGSRPTPSRPHRHDLENELHGLCVDLLVCVLLLALLLLEL
                     VPMEAVRHPLLFWRRVALSPSTSKVDRAVKLCLRRMLGLPPPPSVAPPGEKKEPPAQA
                     ALSPPLTTWSLPPFPSTRIPDSPPPPYQLRHATSLVTVPTLLLYTSSDIGDTASETTC
                     VAHATYGEPPEPAQSTATVQECAVLTAPNCGIVNNDGAVSEGQDHGDTVHHSLDVVSQ
                     CAADTGVVDASE"
     gene            227413..228462
                     /gene="US30"
     CDS             227413..228462
                     /gene="US30"
                     /note="type 1 membrane protein"
                     /codon_start=1
                     /product="membrane protein US30"
                     /protein_id="ADD39180.1"
                     /translation="MGNPRSPLNRRLRFRNVPFLPPQIAASSTTTARSLKAKTMEIRF
                     TIAWMWFPSVLLILGLLTPPSNGCTVDVGQNMSIREQCRLRDGATFSKGDIEGNFSGP
                     VVVELDYEDVDITGERQRLRFHLSGLGCPTKENIRKDNESDVSGGIRWALYIQTGDTK
                     YGIRNQHLSIRLMYPGEKNTQQLLGSDFSCERHRRPSTPLGNNAKVPFTTRTSSTYGV
                     LSAFVVWIGSGLNIIWWTGIVLLAADALGLGERWLRLALSHRDKHHASRTAALQCQRD
                     MLLRQRRRARRLHAVSEGKLQEEKKRQSALVWNVEARPFPSTHQLIVLPPPVASAPPA
                     VPSQPPEYSSVFPPV"
     gene            228577..229062
                     /gene="US31"
     CDS             228577..229062
                     /gene="US31"
                     /note="contains duplicated TT virus ORF2 motif; US1
                     family"
                     /codon_start=1
                     /product="protein US31"
                     /protein_id="ADD39181.1"
                     /translation="MSLLEREESWRRVVDYSHNLWCTCGNWQSHVEIQDEEPNCEQPE
                     PAHWLEYVAVQWQARVRDSHDRWCLCNAWRDHALRGRWGTAYSSGSSASSSGFVAESK
                     FTWWKRLRHSTRRWLFRRRRARYTPSNCGESSTSSGQSSGDESNCSLRTHGVYTRGEQ
                     H"
     gene            229180..229731
                     /gene="US32"
     CDS             229180..229731
                     /gene="US32"
                     /note="contains duplicated TT virus ORF2 motif; US1
                     family"
                     /codon_start=1
                     /product="protein US32"
                     /protein_id="ADD39182.1"
                     /translation="MAMYTSESERDWRRVIHDSHGLWCDCGDWREHLYCVYDSHFQRR
                     PTTRAERRAANWRRQMRRLHRLWCFCQDWKCHALYAEWDGKESDDESSASSSGEAPEQ
                     QVPAWKTVRAFSRAYHHRINRGLRGTPPPRNLPGYEHASEGWRFCSRRERREDDLRTR
                     AEPDRVVFQLGGVPPRRHRETYV"
     gene            229933..230106
                     /gene="US33A"
     CDS             229933..230106
                     /gene="US33A"
                     /codon_start=1
                     /product="protein US33A"
                     /protein_id="AFP95541.1"
                     /translation="MSLKFPERVGYEKLGHRPYTKRVRVHDPLGLTRFIMRQLMMYPL
                     VLPFTFPFYVPRS"
     gene            230275..230766
                     /gene="US34"
     CDS             230275..230766
                     /gene="US34"
                     /note="contains signal peptide"
                     /codon_start=1
                     /product="protein US34"
                     /protein_id="ADD39183.1"
                     /translation="MNLEQLINVLGLLVWIAARAVSRVGPHGSGLVYRELHDFYGYLQ
                     LDLLGPVVAGNRSVRTWREQADRARGTFARRSGLNTSHILPVGSMYRGSDTLSAGLYR
                     SKEEVFLLLNRCHGPLSTPKNACLAEVGVVNGTFLSRFNVGDFHGASWENGTAPDGEP
                     GVC"
     gene            230760..230954
                     /gene="US34A"
     CDS             230760..230954
                     /gene="US34A"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein US34A"
                     /protein_id="ADD39184.1"
                     /translation="MLKFFLKLRKRRRPVVVPRFVRFIVYVVLFTVAVQRVKQERDAH
                     LRRYEERLRKNHARRRQSFP"
     gene            complement(231948..234350)
                     /gene="TRS1"
                     /note="putative beta gene; immediate early gene"
     CDS             complement(231948..234350)
                     /gene="TRS1"
                     /note="transcriptional activator; blocks phosphorylation
                     of eIF2alpha and host shutoff of protein synthesis; binds
                     dsRNA; involved in gene regulation; involved in
                     translational regulation; US22 family"
                     /codon_start=1
                     /product="tegument protein TRS1"
                     /protein_id="ADD39185.1"
                     /translation="MAQRNGMSPRPPPLGRGRGAGGPSGVGSSPSSSCVPMAATSTAG
                     TGASTAGSATPAHGVHRVEPRGPPGAPPGSGNNSNFWHGPERLLLSQIPVERQALTEL
                     EYQAMGAVWRAAFLANSTGRAMRKWSQRDAGTLLPLGRPYGFYARVTPRSQMNGVGAT
                     DLRQLSPRDAWIVLVATVVHEVDPAADPTVGDKAGHPEGLCAQDGLYLALGAGFRVFV
                     YDLANNTLILAARDADEWFRHGAGEVVRLYRCNRLGVGTPRATLLPQPALRQTLLRAE
                     EATALGRELRRRWAGTTVALQTPGRRLQPMVLLGAWQELAQYEPFASAPHPASLLTAV
                     RRHLNQRLCCGWLALGAVLPARWLGCAAGPAGPATGTAAGTTTMTAGTTLPAGASGTE
                     TEAAGGDAPCAMAGAVGSAVPVPPQPYGASAGGNAVCVPNADAHAVVGADAAAAVAAP
                     TVLVGPTAMAGPAASGTVPRAMLVVVLDELGAVFGYCPLDGHVYPLAAELSHFLRAGV
                     LGALALGRESAPAAEAARRLLPELDREQWERPRWDALHLHPRAALWAREPHGQLAFLL
                     RPGRGEAEVLTLATKHPAICANVEDYLQDARRRADAQALGLDLATVVMEAGGQMIHKK
                     TKKPKGKEDESVMKGKHSRYTRPTEPPLTPQASLGRALRRDDEDWKPPRLPGEDSWYD
                     LDETFWVLGSNRKNDVYQRRWKKTVLRCGLEIDRPMPTVPKGCRPQTFTHEGVQLMGG
                     ATQEPLDTGLYAPSHVTSAFVPSVYMPPTVPYPDPAARLCRDMRRVTFSNVATHYHYN
                     AQ"
     repeat_region   232667..235404
                     /note="TRS"
                     /rpt_type=inverted
     repeat_region   234656..235404
                     /note="'a' sequence"
                     /rpt_type=direct
                     /rpt_type=terminal
     misc_feature    235404
                     /note="unpaired T residue at 3'-end of upper strand;
                     complementary to unpaired A residue at 3'-end of lower
                     strand"
BASE COUNT        50578 a        67341 c        68081 g        49404 t
ORIGIN      
        1 ccattccggg ccgtgtgctg ggtccccgag gggcgggggg gtgtttttag cgggggggtg
       61 aaatttggag tcttggagcc gcgtgtgctg tggaggacgg tgacggtggt aagagtgtgc
      121 tgcggtgcgg ttgggacggc ggcggcgaat aaaagcggcg tgcggcgcgc acggcgaaaa
      181 gcagacgcgc gtctgtgttg tgtgtctttg accgcggcgg aacacacgcg gaaaagcgag
      241 tcccagggga cacacgacga gcgagtccca gggggggacg acgacggcca gggacgcgga
      301 aacgacgcgg aaaagaggaa gtccccaggg ggacgggcgg aaaagaggaa gcgcctaggg
      361 gaccgcgggg gcaggaacag acgaagtacg ccgcaacccg cgtcgaggac acacgcagaa
      421 gcggccgccc aggggagggg ggggggggga ctcgcgggcc ccggggcaca cttgttgttc
      481 cctccggccg ccgacacgca ccccgaagcc gcgcacaccg ccgacacacc cctgacacac
      541 ccgcgacaca cccgccacac gcccgacaca cgcccgcgac acacccgacc gacacaccct
      601 gacacacccc gccaacacac ccagccgcac ccgccccgcc aacacacccc cgacacaccc
      661 gacacacgcc cgcgacacac ccggcacaca cccacccacc cagccgcgcc cccgacacac
      721 cccgaacggc gccggtgcgg gacagggctc acggaggttt gcgggccgtg agcacgcctc
      781 cctttgtaca cactaccggt gcgtggcgtc ccacgctatt tgttcgcgag accggactaa
      841 gggaggtttg cggtgcgtca gcgcggggcg gcgtttgcgg cgtgtttcga ccagcgcttt
      901 gtgcgcgctg cctgtgcgtg tcgtcccatg gtctttgtca gcggcacggc gctggggacg
      961 gggtttcacc gcgctgaggg atctttctgc gggtgtgagg gacggagctt ttttcgcacg
     1021 ctgggcaccg ggctggggga cggggggtgt gcgggacggc ggtggggccg gggcgttgcg
     1081 ggtacgggga ttacgctggg aacggggact cgcggacccg ggctgaggga cgggggtggc
     1141 gggggtgttt gcggcgagga cgggggcctt ttgcggcggg gacggggact caccctcgcc
     1201 tatttaacct ccacccactt caacacacac atgccgcaca atcatgccag ccacagacac
     1261 aaacagcacc cacaccacgc cgcttcaccc agagtaccaa cacacgttac ccttacacca
     1321 cagcaacaca caaccgccta tccaaacctc ggacaaacac gccaacgaag aacaccgcac
     1381 gcagatggag ctcgacgccg cggattacgc tgcttgcgcg caggcccgcc aacacctcta
     1441 cgctcaaaca caaccccaac tacacgcata ccccaacgcc aaccctcagg aaagcgctca
     1501 tttttccaca gaaaatcaac atcaactcac gcatctactt cacaacattg gcgaaggcgc
     1561 agcgctcggc taccccgtcc cccgcgcgga aatccgccgc ggcggtggcg actgggccga
     1621 cagcgcgagc gacttcgacg ccgactgctg gtgcatgtgg ggacgcttcg gaaccatggg
     1681 ccgccaacct atcgtgacct tactgttggc gcgccaacgc gacggcctcg ctgactggaa
     1741 cgtcgtacgc tgccgcggca caggctttcg cgcacacgat tccgaggacg gcgtctctgt
     1801 ctggcgtcag cacttggttt ttttactcgg aggccacggc cgccgtgtac agttagaacg
     1861 tccatccgcg ggagaagccc aagctcgagg cctattgcca cgcatccgga tcacccccat
     1921 ctccacatct ccacgcccaa aaccacccca gcccaccata tccaccgcat cgcacccaca
     1981 tgctacgact cgcccacatc acacgctctt tcctatccct tctacaccct cagccacggt
     2041 tcacaatccc cgaaactacg ccgtccaact tcacgccgaa acgacccgca catggcgctg
     2101 ggcacgacgc ggtgaacgtg gcgcgtggat gccggccgag acatttacat gtcccaagga
     2161 taaacgtccc tggtagacgg ggtaggggga tctaccagcc cagggatcgc gtatttcgcc
     2221 gccacgctgc ttcaccgata tccaataaac ccatcccctc gccacgacgt ctccgcgtat
     2281 ctttgtagcc tcaggaatcc gtccccacgt ccatccatcc cgagcactcc acacgctata
     2341 acagaccacg gacacggcaa atgcatgcaa acttctcatt tattgtgtct actactctgt
     2401 gttgctacag ggagtgaagg gggtgaaggc aaagaaaaaa aaaaggaaca aaataataga
     2461 ttagcagaag gaataatccg tgcgaccgag cttgtgcttc ttttcttata aggaggcaaa
     2521 tatactaggg aaaacttaag aataggaaga aaccgaggtt tgggagaaaa gctgagataa
     2581 aatagcgcat tttccataca gaggttgttg tttttgtgga tcctaagagg tttcaagtgc
     2641 gaatctcaaa gttctcacga gaatattgtc ttcaagaatc gacaactgtg gtccaagatt
     2701 tttttttggt ctttttaggt tctgcgaggg acatcacgat ggatcgttgc gatgaagtca
     2761 cgcgtacgcc tctggtgtgg cgcggtgtcg tgacaggaga gtgtgttttc agtgcagagc
     2821 tgtcttgatt cctatatccg agtatctgtt ttctcgtaag gacggtaatc ttctttggtg
     2881 taagtacatc taaaagctgc aaactatatt ttaagggctg tctctaggtg tactttgatg
     2941 ctggagtttt tcgctgtgtt gatgtgaata aatctactac tactattata tgcagaaaga
     3001 gtgattatgc cgagacaaga ttgcattggc tgaactgttt caaaaacgcc tacactctac
     3061 ttatccgtaa acctaaggta atactatgtg taagttgttt ttttttcttt ttgtagtaaa
     3121 atggtgatac gtgcaattaa aactgtattc catgtttcca tcctttcatt tcaactttaa
     3181 aggcggcttt gagagcgaag aagtgcgagg ataaaaatgg atgactcctt cgtgtccagg
     3241 gagtcgacta ctgcaacgct gattgattaa aagatggtct ccgatgatga tgttgttatt
     3301 gatcgaatca tggtgcagaa cggcgacgga gaggagcgtg tccgccgccg ggaaggtggt
     3361 ctctttctct tttctttttt caagaaatct tccatgtgtt tatcgtagtg atcgaaatcg
     3421 actgatctcg ggttcttttt gttggtttct tttcggttaa tcatgtattg ttttcttttt
     3481 ttacagaaag atactttttt catgagcaat tcctcgcccg gcgccggcat gccgaggtgg
     3541 ggccactgcg atcagcggca tgccgacgcc gacccgggga tcttggattc accgttttct
     3601 ctcttctctc tctacataca gaccgggtgg caggagcggt aaggaatcat cgtcgtcttt
     3661 cattcttcga tgattatggt aatactaaat cttatctagg agcatataca tctaagattg
     3721 gagtactagt agtcgtttgt ggtttctatt ttttttatat ttatctatga cagtttttct
     3781 gtttttcgtt ttgataataa tataataaaa actcatggac gtgaaatctg gcttggttgt
     3841 ggtgatttca ttctcattat tgttgttttc tttccgtctt gcggatgaag atgttgcgat
     3901 gcggttgttg ttggtgttgc tatacaccga gagagatgat ctttttgttc ttctggttca
     3961 tttcctatga ttgtttggct gctgaccgac gcgtcaggat gtgcagggca tgcggggaat
     4021 caggaccgga cacgggataa tttcatctac ctatacggag atcgcggtcc tcgccatgag
     4081 gatcgcgaca ggcgcgtcga gggggcagga acacccttgc ggattgacat tcttggtggt
     4141 gtttcgttgt tgtcggtagt tgttgttgac gatgaggata aataaaaatg accttgtttt
     4201 tgttctgttt tctcttgttg ggaatcgtcg actttgaatt cttcgagtta tcggaaagct
     4261 gaggtaccca aatgtctgta gcttttttct ttttaccctc ttgtttatca tctgcgattc
     4321 gtggtaggta ggagagggaa atgataatcc gagattaagg aaaggagaag ataaaaaata
     4381 aaaaaaaaat aataaaacag aagccgaccg gccgccgacc cgttccccag gaccagccta
     4441 cgaggaatgg ataacgcggt ggcgacggca gcggtggtgg cgctgggggt ggcggcagtg
     4501 gtactgctga tggtagtcgg gacggaggag aggcgatgca tacatacacg cgtgcatgct
     4561 gcatgggtgg atggtacggc cgggagacgc ggaagagaaa ctcacataaa aaggtgacaa
     4621 aaagagcggt tgaaaaaaga aaacgagatt cgaccagaca gaagagaagg accggggctt
     4681 ggcgaccctt ccacgactgc tgttgtcatc tcggctcccc cgtcttctcc cggccacggg
     4741 cggctaagtc accgccgttc tccccatccg tccgagcgcc gaccgaccag ccggccgatt
     4801 cgcccgccgg ggcttctgga gaacgccggg gcagcagcga tctggggaag ccgctaaacc
     4861 cctgcgtttt tatatggtag ctctgccgag cgcgggctga cgcgttgagt aagcggaaag
     4921 acgtgtgtga cgaaaagggg tcccatggta tttcacgtga cgatgaggag atgcggtttg
     4981 gagcacatac ggtttagaaa aagggagttg tcgtgacaag ggctgaggga cctctgtctc
     5041 catgtgtgta taaaaagcaa ggcacgttca taatgtaaaa aagaacacgt tgtaaacaag
     5101 ctattgctgt atcattcggc tgactatgct tcattcggac tgattttctt ttcctaacgg
     5161 cgtaacttaa agtgattaac gtatgatatt tgttccccag agttatacta tagtcatcat
     5221 cctaaaattc agatataaat gaacacatgt cgtatgggat tattaagaaa ccgaaactct
     5281 ccacagttca ccatcttctt cgtcattcaa ccgatgaccc actccgtaca acgaatcagt
     5341 ctgctgtgtc acactgcaaa ctactagcga cgtatgcaaa caacttgaaa cacgggctgt
     5401 tgtattgacg accgttgtac cattactagt cacattgcat agagaccatc caccgtcatc
     5461 ccatctttcc cacccgatgg aaaaccgtct tctatcatca actatggtaa gatttcgacc
     5521 ctgcgaggta ttcagtttcc ccatatccat aacctggatt ttatcattaa accccaatat
     5581 taaacacttt tttagtaccc ccccacccac caaaaaatgt gactggaccg gttcctagca
     5641 gctctgggag ccatgttcag gttgaaccac agctacagcg aaaccgagtc cagtgaccgg
     5701 taaccacgtc cagcccctgc gtatgtacca gtccaagcac gtccggtcat tgttctacac
     5761 aggaaatcta actaggtcaa cgcaatttta ttccaccgtt acgcagaata ctaacaaaca
     5821 aacacacaaa tttaacgaat tacacgtagt ttattacatg aaaactgtaa gaacaccaat
     5881 tcactaagcg atacaacatt tagctgactt ccaagtgcca cacatcacca ctgtattcat
     5941 ccatgttttc accgaaccaa cgagacagat cgaagaagcc agaatctccc gactttaaat
     6001 tacataaatc caacgtatta tgaccacagc tcgacacaca aatagttgcg ttactattca
     6061 cagtagcatt acctataccc gtaacgttgc acaaccactg atcaccattg ttaccaaaaa
     6121 cggttttcca cttagttgtc aacggatctt tcccatgcgt aatggtcaaa ttactaccag
     6181 tcgtcgcttt tagctcatta cgagtattat ccgcatccac atatatcaac gtcatagcta
     6241 ggcacgctat aagtaccccc cccccacaat ggaatgttgc caaaccggtt ctttcccgtt
     6301 atagccatag cgttcccagg caaaagcaaa cgccaaacct aatgcagtga aaagcgcttg
     6361 cagccagaac cagcttatgt accagccaca atcacatccg gttattgttt ccacaggaaa
     6421 tcctaccagg caaagccccg cttgttttgt tcctgaccat cttgtttagc aattcgtaaa
     6481 ctgtcagcct agcgacgtcc gtttagatca aaagtcacgt atatagcgac gctgtttcca
     6541 cccgtttccc cgtcccgccg tttccgaaca acccacccgg gttcagacaa ccgaccacca
     6601 acagaaatat acacacagac caccgggagt tcagttaaag atttcatcag gtttattttg
     6661 gctgctgcta gtcttttgct tcttagaaaa aaaataccca tatagagaaa taatgatagt
     6721 ttgacaacac atatggcagg gatttcttct tcatcaataa gatatgcaat tcccccaggg
     6781 agagactttc aacaattgaa tttacaaaaa caaaattaca tcaggagaaa gagaggatac
     6841 attaataaat atattatatc tggtgtatat actgaatgct gctggttcat aaggtaacga
     6901 tgctactttt tttaattcca agatggtttt tctttgttag tcttttgttg acttgctggt
     6961 tcctaaaagt tcgcaaaaac gattgtgtga agattatgac gttggttgac tagttcatga
     7021 gattctgctg tacgtgtgat ggttattcgc tggttcgttc taagatgagt atcgtactgt
     7081 gtctgcgatg gtcgtctctt actggcattc tctcggctgc ctcttgtttt catgattgaa
     7141 aaggaaaaaa ggactccgag ggcgcggtca tcttttactt ttcggttttc tcgttggcgg
     7201 gtcagaggta gtcagatcat gagactgtcg tggtcgatga aactgtgtct gctcaagtga
     7261 cgtccatttc ttgtacggag aaaaaagtca tcgggataaa taaggctata caaggcgttg
     7321 tcaagcgtgc ggctctaaac aaattaagcg atacaaaatt acagtgatac gaataataaa
     7381 ttaccccctc cccctgtggt ccccccgagg cgagagccac ccatcgtgta ctctcgcacc
     7441 acccacgacc acagggggag acgggacgaa gagacgacgc agagcgccat ctcctcctgg
     7501 aggccggcgg cgttaactgc tacagctgcg gcggcgacga cagctgcgat ttgtcggccg
     7561 acatgccgat ggtatgggcg gcggcggcgg tggccgcggc agcggggagg agaggagaga
     7621 gaagaggagc ggggcgtccg aaggcgagga tggcatggtc tcgccggagc gcccggcttt
     7681 tatggaacac tcgcgtccgg ttgggtatca cccacaggaa gatgaatcac aacttccaaa
     7741 ccatcttgag acccgagtaa cggtttacag gtcgcacgcc agtctcagct aaaaacagcg
     7801 gacagtccca cgctgtttct gttgtggctc tctccagttt cctcatcgcc gtcttggtct
     7861 ccgtcatcat cggaagaata ccacccgctc tcatgcggca gtcgatcagc ctcgatgaac
     7921 gagacgcggc gacgcctttc tacggccgac tggttgtggt ggtgaaagaa gagcaccagc
     7981 aatcccagga ggagcaacaa gccctcacat gtccaggagg tcggggagag ggcctgtcgg
     8041 agatgaccgt gaggcatcac gtacggcagc tgaggagaaa cggagaagaa aggaaaatta
     8101 ccgtcagggg ccggggttct tattagagaa acagcacgta ggtcaggatc cagatgctaa
     8161 tggcaatcat gatgacgatg atcatgcagg ccaagacgcg gcgcaccaat gcagaatcca
     8221 atagccgccg tgcctccggt tggtggccgg cggcatctag agacatgatt tggggggggg
     8281 gaccggcggc gcaaaaagac agggagatgg acagtgccac ggtgttttgt tatgattagg
     8341 acatggggac cggaagccga gacagagtac tacagggtgt tgaagggtaa cgtgagggag
     8401 atcatgtcat gggcgggctg aagaccgtgc ggggaggatc gacgtgtgcg gtgcttgtgg
     8461 aacacggtgt tttaatatgt atccgcgtgt aatgcacgcg gtgtgctttt tagcactcgg
     8521 cttgataagc tacgtgaccg tctgcgctga aaccatggtc gccaccaact gtctcgtgaa
     8581 aacagaaaat acccacctag catgtaagtg caatccgaat agtacatcta ccaatggcag
     8641 caagtgccac gcgatgtgca aatgccgggt cacagaaccc attaccatgc taggcgcata
     8701 ctcggcctgg ggcgcgggct cgttcgtggc cacgctgata gtcctgctgg tggtcttctt
     8761 cgtaatttac gcgcgcgagg aggagaaaaa caacacgggc accgaggtag atcaatgtct
     8821 ggcctatcgg agcctgacac gcaaaaagct ggaacaacac gcggctaaaa agcagaacat
     8881 ctacgaacgg attccatacc gaccctccag acagaaagat aactccccgt tgatcgaacc
     8941 gacgggcaca gacgacgaag aggacgagga cgacgacgtt taacgaggaa gacgagaacg
     9001 tgttttgcac catgcagacc tacagcaact ccctcacgct tgtcatagtc acgtcgctgt
     9061 ttttattcac agctcaggga agtttatcga atgccgtcga accaatcaaa aaacccctaa
     9121 agctcgccaa ctaccgcgcc acttgcgaaa accgtacacg cacgctggtt accaggctta
     9181 acactagcca tcacagcgta gtctggcaac gttatgatat ctacagcaga tacatgcgtc
     9241 gtatgccgcc actttgcatc attacagacg cctataaaga aaccacgcgt cagggtggcg
     9301 caactttcac gtgcacgcgc caaaatctca cgctgtacaa tcttacggtt aaagatacgg
     9361 gagtctacct tctacaggat cagtataccg gcgatgtcga agctttctac ctcatcatcc
     9421 acccacgcag cttctgccga gccttggaaa cgcgtcgatg cttttatccg ggaccaggca
     9481 gagtcggtgt ggtcacggat tcccaagagg cagaccgagc aattatctcg gatttaaaac
     9541 gccagtggtc cggcctctca ctccattgcg cctgggtttc gggactgatg atctttgttg
     9601 gcgcactggt catctgcttt ctgcgatcgc aacgaatcgg agaacaggac gttgaacatc
     9661 tgcggacgga cctggatacg gaacctttgt tgttgacggt ggacgggaat ttggaataaa
     9721 agatgcgtaa cacctgtcga agatgcgata actttacata caggcaaaca gtgtatacaa
     9781 ttatagtatt ttgtatgttg cataaagtta catgcaacag tactgctaac agtactgcat
     9841 ccattacgct atccaacact gcctctacca cttttgtaac caacatatat tcaactccga
     9901 ataacaacac atcaacgacg ccacacacat ctgtcacctc acaagcgtca accattggca
     9961 acatcaccaa cgttacctcc gacttgagta ctttcacaac cgtatattct acattcaata
    10021 catcatttgc caatatatct aatacggctg tcactacaga attgatttca acaaatacca
    10081 acactatctc atcttttacc aacgtaacag caaacgctac atcatcttat aacacaacaa
    10141 tcaccgtaac tgtcacgtca gatgaaactt cgcacaacgt atccactaat aatgcactta
    10201 taagcacacc atggcctaca aattgcagcg ccacaacata caccacgtac aaccttacta
    10261 actcttccaa cgcttgtcac acagagacaa caatcatacg tttcaaggaa accaatacaa
    10321 caggaataga agggagtaat gtcaccataa agggtaattc tacgtgggac tgtctttcag
    10381 tcgcctggat acgacattac aatagatcca cacacggaca tcatctaggt tatcgtaaga
    10441 acgcacatac ccaatcttgg tattggctac gcatccttac ctctcacact gtatgtcatt
    10501 ctcaacatga aagaccttca ctgtaccatg acttatgtcg ttcgtgcaac aacacagaat
    10561 tacatctgta cgatctaaat atcaccaatt ccggcaggta cagcagacgt tgttttaaag
    10621 aaaattactt cacaggacat cacgaagatg aaaatttcta cctattagta acaccaaaaa
    10681 atcatactga agctattaat gctactttcg tttgccctag atacaacacc gatatcgaaa
    10741 atgaagatag agagaaagga agtcaacata ctaacaatac acatcaccac aaacgtaatc
    10801 tctatcatag ctcgcaaaga agccgcaccg tatggaccat cgtgttggtt tgtatggcct
    10861 gcatagttct gttttttgca cgacgagcct ttaacaaaaa gtatcatatg ttacaagaca
    10921 ccgtcagtga atcagaattc attgttcgat atcacccaga acatgaagat tgagctacgt
    10981 ttccgggcag acatcttatg aagctgaaca ataaactaaa acattctgta agactcagcg
    11041 ttcaaaggaa tattaatgcc cattgagcga aaactaatat tgcaatggac tggcgattta
    11101 cggttacgtg gaccgttact tgtgatggtt tcaattatac agtccataaa agatgcgatc
    11161 gcagttacga ggtaatcaac gtaacaggat acgttggtag caacataact ctaaaaaaat
    11221 gcaatcagac tgagaaatgg cacaatgtag actggattca ttatgagtac cccacgcata
    11281 aaatgtgcga attaggcaac tatcaccaaa ccacaccacg gcacgacata tgttttgact
    11341 gcaacgacac ctccctaact atctacaact taaccacaaa aaacgctgga aaatatacca
    11401 ggcgtcaccg tgataacggt caagaagaaa attactacgt aacggtgtta attggagaca
    11461 caacgttatt cactcttggc acatgccctg taagatataa agaatctacg aacactgaaa
    11521 acaccattgg aagtagcatc atagaaacca ttgagaaagc taacattccc ctgggaattc
    11581 atgctgtatg ggcaggcgta gtggtatcag tggcgcttat agcgttgtac atgggtagcc
    11641 atcgcattcc caaaaagccg cattacacca aacttcccaa atatgatcca gatgaatttt
    11701 ggactaaggc ttaacatgct gatcaataaa ctttttttaa ccaataacat gtctccgttt
    11761 ttttttgtta acaacctatg atataaagcg ttatattcag tcgttactaa acaaaaaaac
    11821 atgggcatgc aatgcaacac taaattgtta ttgccagtcg cactaatacc ggttgcaatc
    11881 atcctaattg gtactctagt gccgatactt ttacatgaac aaaaaaaggc gttttactgg
    11941 cgactttttc tgcaaagtca acatgtagaa gcacccatta cagtaacgca gggagacaca
    12001 gtctacctag acgctagcaa taatccctgt aattattcca gcttttggta ccacggtaat
    12061 tgcgaacttt gtggatggaa cggatatcta cgcaatgtta cacattacta cacaaacaca
    12121 tcgtgttccc cgcaattcat ctgcataaac gaaactaaag gtctgcagtt atataatgta
    12181 acattaaacg attcaggcgc ttatactgaa cacgtttacg aatgtgacct ttcgtgtaac
    12241 attactacta ataacgaata tgaaatactc aattattttg ataactgtaa ctacaccata
    12301 aatagcacca agcatattat caccgtggtg tcttcacgtc attctaaaca aacaaattcc
    12361 cacgtatcca ctcacgctgg ttgggcagtc gccgtggtga cggtaattat gatctacgtt
    12421 ctgatccact ttaacgtccc ggcaactctg agacacaaac tacgaactag aaacaacgta
    12481 aatcgcatag cgtgattata aagtatcgac gctaatttct ccaagataaa atttgattac
    12541 tccgtgcagt tctcaaaaac tgtaaggccc cgcttttcca ctccgtcatg aaggatcgca
    12601 atagaatact gctatgtatc atctttattt gcattatgtg cctcatttgt atttacttta
    12661 aacgtcgttg tgtttttact ccgtctccag acaaagcaga tctgcgagtg gaatttccct
    12721 cgttaccccc gtgtattggc atacagtgcg ctgcatgaga acacgcgtga cacatagcgt
    12781 acccctggac ggtacagttt atgataacgt aattcaggga aagtatacat tcataccaac
    12841 atgttatcac ataacacaca gattttctgc gtgttttata aaagagcgtc tcgaagcagc
    12901 ttgagccaca ctacggtcca gatgacgagc gtaattaaaa atatgccgcg cagtattcga
    12961 aagccgtact gagcgtgcga ggcgggtagg gtgccgaacg acggatatgc gtcgttgtca
    13021 tcttcgacta taaggatcgc gaccgagtct tcggccatgg taaacgtcac cctgtgtggc
    13081 tggtatgtag cgtatccggt ttggaattgt tctgctccag ctcgggggat agtgaggaat
    13141 tctcaaggga tacgggaccc aatgactgga taagagaagg gtttttcccc gtaagatgat
    13201 cctcgtatca catgaggtct ggatatgtat aaatgaagag tgaaataggc acagggaatc
    13261 agatgccagc ctcgtgatgc agccgctggt tctctcggcg aagaaactgt cgtctttgct
    13321 gacttgcaaa tacatcccgc cttaagcgat gagtctataa agcaccgttg cccgagtacg
    13381 gtaaaagtga cccggattgt agaacgtcct ttttttttgt ttttgcatcg tttatcgtca
    13441 ctactagtgc aatattttga ttgtaaggct gaaagagtat cgttatgatg cttagaacgt
    13501 ggagattatt acagatggta ctgcttgccg cgtactgtta ttatgttttt gcgacttgtt
    13561 caatcagcac gacgactgct cctgtggaat ggaagtctcc cgaccgtcag attcccaaga
    13621 atattacctg cgctaattac tcagggaccg tcaacggcaa cgttacattt cgaggtcttc
    13681 agaacaaaac ggaagacttt ttgtactggt tgttaggatg gggtcataag tccatttgtt
    13741 cgttcttccc gaaactccag ggtaactatg acgaacaaca ttacagatat gaagtagcga
    13801 acctgacgta taactgcacc tataaccgct tgacgttgct gaatctgacg acggaaaaca
    13861 gcggaaagta ctatttcaaa agggaagatg cgaatttcac cttctattac tcttgttaca
    13921 acttgaccgt gtcctaaaga tcgcacgtga agtttcacag agccgcgtgg ctgtagctat
    13981 tgtgtttacg ttgcttttga aatgttaagc gtccctacgg cgctaacatg tttctaggct
    14041 actctgactg tgtagatccc ggccttgctg tgtatcgtgt atctagatca cgcttaaagc
    14101 tcatgttgtc ttttgtgtgg ttggtcggtt tgcgtttcta tgattgtgcc gcgttcgagt
    14161 cctgctgtta cgacatcacc gaggcggaga gtaacaaggc tatatcaagg gacgaagcag
    14221 cattcacctc cagcgtgagc acccgtacac cgtccctggc gatcgcgcct cctcctgacc
    14281 gatcgatgct gttgtcgcga gaggaagaac tcgttccgtg gagtcgtctc atcatcacta
    14341 agcagttcta cggaggcctg attttccaca ccacctgggt caccggcttc gtcctgctag
    14401 gactcttgac gcttttcgcc agcctgtttc gcgtaccgca atccatctgt cgtttctgca
    14461 tagaccgtct ccgggacatc gcccgtcctc tgaaataccg ctatcaacgt cttgtcgcta
    14521 ccgtgtagct agttagccag ctgtgtgtag tgttttgctt ttgcatattt gttttcagtc
    14581 agagagtctg aaacggggtg ggagggactt ttgcgggtag tgcatgctaa gatgaacggg
    14641 tgggctgggg tgtgcttgat aactcactgt ttgaatacgc gctcacgcac atatgtagca
    14701 ctcaacatgt tagcttttgc ccgcacgccc cggggcgtgc cgagctgcct ttttaataaa
    14761 gtctgggttt ccagatacgc gctggttctg attttgatgg tttgtgcctc tgaaagctct
    14821 acgagctggg ccgtgacatc caatggactg cctaactgta gcacggtaac tagaacagcg
    14881 ggtcaagacg ctgaattgca cggtccggca ccgttaagct gtaatgtgac ccagtgggga
    14941 cgttacgaga atggaagcac acccgtgtta tggtgcactt tacggggatc aagcatgcga
    15001 gtctcattag gacaccgtgt agcgtttggc tgttcttgga aaacattttt tatttataac
    15061 gtttctgaaa gtagcggtgg cacttactat caaaaaggtt acaactgcac cgacaaacat
    15121 ataacactat cttgtttcaa cttaacggtg gttcctcgag cggttcaaag cacaaccacc
    15181 gtaatgacac ccacgctggt tacaaactcc acattcagtg tgtcacttgt tccgttgaga
    15241 ctgacgacaa attccagcgc gtttggacac gctatttatc aacgacaaca gcgtgttgaa
    15301 aacgggacgt tatccaagaa cataactaac ttggcattca cctatggcag ctggggcgtt
    15361 gcgatgctgc tgtttgccgc cgtgatggtg ctcgttgatt tgggtttgcc tcaatcggct
    15421 tggcgacgct ggcgaagcca cgtggacgat gaagaacgtg gtttgttaat gtaggaaata
    15481 aaaggcagtt tgagcatgac tgtttccaaa ccgtaacgtg gtaaataaat catggcttcc
    15541 gacgtgggtt ctcatcctct gacggttaca cgatttcgct gcagagtgca ttatgtgtac
    15601 aataaactgt tgattttaac tttgtttgcc cccgtgattc tggaatccgt catctacgtg
    15661 tccgggccac agggagggaa cgttaccctg gtatccaact tcacttcaaa catcagcgca
    15721 cggtggttcc gctgggacgg caacgatagc catctcattt gcttttacaa acgtggagag
    15781 ggtctttcta cgccctatgt gggtttaagc ctaagttgtg cggctaacca aatcaccatc
    15841 ttcaacctca cgttgaacga ctccggtcgt tacggagcag aaggttttac gagaagcggc
    15901 gaaaatgaaa cgttcctgtg gtataatttg accgtgaaac ccaaaccttt ggaaactact
    15961 ccagctagta acgtaacaac catcgtcacg acgacatcga cgatgatcga cgcgaaaagt
    16021 aacgttacag ggaacgccag tttagcacca caattacgtg ccgtcgctgg attctccaat
    16081 cagacgcctt tggaaaacaa cacgcacctg gccttggtag gtgttgttgt gtttttagtt
    16141 ctgatagttg tttgcattat ggggtggtgg aaattgttgt gtggtaaacc agagttatag
    16201 taatgtgctt tttatcaggg agaaggtttt gtgccaacaa tgactagccc gggactatct
    16261 gcgtcagaaa attatgacgg aaattatgaa ttcacggaaa ccgccaatac aacgcgtaca
    16321 aatagaagtg actggacaac gttagaaacc agtgcattgc tattgaaaaa cacggagact
    16381 gcagtgaacc tcagcaacgc gactacggtc atcccacaac ctgtagaata cccggctggg
    16441 gaagtacaat atcaaagaac ggcaacgcat tattcttgga tgctaatcat tgtcatcatt
    16501 ctcatcattt ttattatcat ctgtctacga gcacctcgaa aaatctacca tcactggaaa
    16561 gacagtaaac agtacggaca agtgtttatg acagacacgg aactgtgaca gtgatgtcta
    16621 agcgtttgca ggtatttcca tggataacaa ttttatttta cacatcaaaa tcccagtatt
    16681 ggaactatat ggcaatacca tgtaccccta cagttggata cggcagtcat aatattagct
    16741 tgcatccgct taataactca ttatttcaag acgatgtttt tgaatggtac atagacaaac
    16801 caatggttac aagttatgtc tttatcaaag taatgaacgc acaaaatcca atctagactc
    16861 tccaaatatt gtgtggcaat gcacagataa tcgtacacta attctcatga acttaaccac
    16921 aacatacagt agaaactatt attttcaatc ctttaaatat ctcggacgag gagtaccaaa
    16981 accgaataac ttgtgttata acgttagtgt acactttacc caccaaacac attgccatac
    17041 aactacatca tccctgtatc cacctacatc tgtacacgat tcattagaaa tatcacagtc
    17101 attcacctca accaacttca cacataccgc ggtccactac gccaccggta acgttgaagc
    17161 acaacacgac actaccactc cacatacaat gtggatcata cccctagtta tcgttataac
    17221 aatcatcgtt ttaacttgtt tcaaattccc ccagaaagct tggaataaat tcacacaata
    17281 cagatacagc ggtatgctcg ccgccgctta aagaatcaac gccaaggaaa ccaaaacgta
    17341 aaaagaatag atatgtacgt ttatttttca gctcactgtt tgaataccgt aaacataatg
    17401 acgtacatat acgtggttat acaacaggtg tttgtgttat gcggcgactg attaaccata
    17461 tcgtgaacca tgatcttttc cgatggtccg tcgtgaccgc aatgatattt tacagatatt
    17521 ccgaaacctg tatggaggtc actgtcagag taggtgatcc agttaccctc ggtagtggac
    17581 atggttatca tccaggacaa aaagtacact ggtataacca gtcatgcgtc ggcatcggca
    17641 acggcgaaaa tacgcatcct atctgcacct acgaccctcc taaacctggt agacaaaaga
    17701 caatgaaaac cactccgttg ccatcaccac tgttgtatga atgtcacaat tccacattaa
    17761 gcattcttca tgtaaacgtc tcagatccca aaaactattg caggcgaaaa tgtccaccaa
    17821 agggtaactg tgagtttcca acatgtttta cattatcgct gatttccaga acgacaacga
    17881 ccagaaaacc cggacaaaaa actacgttgt tgcgattaaa aaccacgccg aataaacata
    17941 cgcagcacaa aagatccacg cggagaacgt cacctaaaga ttacaatgta acgggtcttc
    18001 cgaaaggctt tgcggactcg tttaccggta acgtagaggc acatcgaacc aaagatgccg
    18061 cacacagcgc atggattctc attatcatca tcattatcat agtcgtcatt ctatttttct
    18121 tcaagattcc tcaaagactc cgagagaaat gggacaccag aggatacctt tacaaaggaa
    18181 ccgacggtct gcccactacg gactacttat cgtgagcgga cggatatctc cggtttcaaa
    18241 ctcactgttt gaatataggg acagtcccta cggaacctga gaacatgtgg aaatcacctg
    18301 tggtagaatg ctgctcaggt acattacctt tcatcgcgaa aaggtacttt acctaacggc
    18361 tgcatgcatc tttggtgtct acatcagcct ccatgatgcc tgcataccgg tggttggcaa
    18421 gataggtacc aacgttacgt tgaacgcggt agatgttatt ccccctcgcg atcaagttcg
    18481 ttggtcatac ggtccaggcg ggcaaggcta catgttatgc attttcactg gcacatcaac
    18541 aacaacgttc aacaacacgc gctttaattt ttcatgtttg agtaattaca gcctcctcct
    18601 cattaacgtt accgcgcagt atagtactac ctatcgtact atgacatcgc tagacgattg
    18661 gcgtcaccaa caacatagcc atggttttcg atggacttta gacacatgtt acaatctgac
    18721 agtgaacgaa aacggtacat tccccactac caccaccaaa aagcccacta cgactacgag
    18781 aacgacaact actacaacac aaagaacaac caccacgaga acaaccaccg ccgccaagaa
    18841 gacgacgata agcactaccc atcataaaca ctccagtccc aaaaaatcca gcacccctaa
    18901 cagtcacgta gaacatcacg ttggttttga agccacagca gcggaaacac cgttacaacc
    18961 aagcccacag caccaacacg tggccacaca cgccctctgg gttttagcgg ccgtaatcgt
    19021 tattatcatc attatcattt tctactttcg aataccgcaa aagctgtggt tgctctggca
    19081 gcatgacaag cacggcatcg tgctcatccc tcaaaccgat ctgtgagcaa gtcgcgtagg
    19141 aaatgattgc atgaaatcac tgtgaaacgc caactccgtg ccagctggcg cggcggacag
    19201 gcctttgacg tatttgaagc caggcgcgct ctcgataccg aaaggatccg agggggcttt
    19261 ccaaagccga cgtccctgat tcccttcata aagctgttga ccggccctag aaagaccaag
    19321 agcatgctgt gggcccactg cggtcgcttc ttgcgttatc atctgctccc gctgctgctg
    19381 tgtagactgc cattcttact ccttttccag cggccgcagt gggcccacgg cttggacatt
    19441 gtcgaggagg acgagtggct acgggagata caaggagcga cgtaccagct gtccatagtg
    19501 cgccaagcca tgcagcacgc cggattccaa gtcagagcag cgtcggtcat gacgcggcga
    19561 aacgccgttg acctggaccg accgccactt tggtcgggat cgctcccgca tttgcccgtc
    19621 tacgatgtgc gttccccgcg gccgttgaga ccgccgtcat cacagcatca cgccgtatca
    19681 cccgaactgc catcgcgaga cgggatacgt tggcagtatc aagagctgca gtatctggtg
    19741 gaagaacaac ggcggcgaaa tcagtcgcgc aatgcgattc cgagaccctc gttcccccct
    19801 ccggatccac catcgcagcc ggcagaggat gcacgagacg cggacgcaga acgtgccgaa
    19861 tcaccacata gtgcagaaag caccgtcagg cacgacgcga gtgaaaacgt aatgcggcga
    19921 cggcacgaaa gacggcgcta taacgctctg acggtccgca gccgggactc gctgctcctg
    19981 acgcgaatac gcttctccaa ccaacggtgt ttcggacgcg ggcgtctgag acatcccgcg
    20041 ggaagcggtc ccaacaccgg cggaccgcga cccggcggtg cgggactccg tcaactacgc
    20101 caacaactga cggtccgctg gcagctgttc cgcctacggt gccacggttg gacacagcaa
    20161 gtctctagcc agatcagaac ccgctgggag gaaagcaacg tcgtgagcca aacggccacg
    20221 cgaatacgta cgtggtttgt ggaaagaacc acgttgtggc gtcgcacgtg ggttccagga
    20281 cagaacccag cggccgaagc gcaagaactg gccgtcatac cgccggcacc cacggtgctc
    20341 cggcaaaacg aggaaccacg tcaacagctt acggaagaga aaacaagaaa ttcaacgcac
    20401 actcaacgtg aagaagtgga ggacgtttcg agagagggcg cgagagaagg gaatgatggg
    20461 agccgagcaa gtggaaacga cgagagaagg aataatgcgg gaagatatga tgatgatcat
    20521 gaggttcaag agccgcaggt cacttatcca gcgggacaag gagaactgaa taggaggtca
    20581 caggaggaga acgaggaagg tggaccgtgt gaatcgccgc caatgacgac aaatacgctg
    20641 accgtggcct gtccgccccg agaacccccg catcgtgccc tgtttcgtct atgcttagga
    20701 ctgtgggtct cgagctacct ggttcgacga cccatgacga tttagaatac accgagccat
    20761 tcctttattt ccccccatcc ccggtcgctt atgcgtgtca aacactacca ataaagataa
    20821 tttgccaatc gcaccttata tataatatgt ggtcgcgtgt ggtcttttta aggagctctg
    20881 aaacacagac aggtatgggc ggtggtcggc tgccgccgct gtggctgccg ctactgatcg
    20941 cctggagcga gtggggcaac tgctgcctcg atgcgcctcc ggtggtgcgt tcgccctgtc
    21001 tgcagccggt gcgcgaccgc aaccgcgagc ggaacccggg ctcaccgcag ttgctgcctt
    21061 acggcgaccg tctggaggtg gcctgcatct tccccgcgca cgactggcca gaggtctcta
    21121 tccgagtcca cctctgctac tggcccgaga tcgtgcgttc gctggtggtg gacgcacgca
    21181 gcggtcaagt gttacacaac gacgctagct gttacatcgc cggcgggcgc tggcgcttcg
    21241 aggacggcgg cgcggcgcag cggctaagcc tctcgtttcg gctcatcacc gagaccgcgg
    21301 gcacctacac ctgcgtgctg ggcaacgaga ctcacagcct ggcgaccgag accacggcgt
    21361 tggtggccga cgtgcacgac ctgcgccact cggaccgctc ctgcgaccta gctttcggat
    21421 ctcgctcaca gacgcggtac ctgtggacgc ccgatccctc caggttgcgc agtataaact
    21481 gtggttggga gggtgaacgg caccgcgtgg tccactacat ccccggcacc tcgggtctgc
    21541 tgccctcgtg cgaggaggac gagcgcgaac tgtgcgtgcc cttcatcagc cagagcatcg
    21601 cggacaacaa ctgcagccgc cggcatcggg tagacggcgc taggcggcgc tatcatctgc
    21661 ggagggatta ctggctgacg gatccgaaga tcgggctgct ggccgcggga tcggtggccc
    21721 tgacctccct ctgccacctg ctgtgctact ggtgttccga atcgtaccgg cgtctgaaca
    21781 ccgaagagga aaacgaggcg gcggaggaaa ctgccgcggg agaagcctct gcggtagcgg
    21841 cggcggccgt ctctgaggaa gagcagcagc gggagtaaac gaggagagcc atgaagcgga
    21901 tgattcgcag tcacggcagg aaaacggaat gtcagatgac gggcgccggc gagcgacgcg
    21961 gctccgccgt cggtgcgctc atctgcggca gcggtacccg acgcggcagc ggcgccaacg
    22021 aacgccgcga ctccgacgtc ggtcccatcg cccacagtag cggtaccaga cgcggttcgg
    22081 cgaatgaaac gtccgcctgt acgcggaccg atcaccagaa ggcggacatt gggctgtggt
    22141 tcatgtttct ggtttttgga ctgtgttcgt ggttggcgat gcggtatcgc gcacaataaa
    22201 ttttgaatcg atgtcaagga acgcgcgttt tgtattttat tgggaatatt ggcggggata
    22261 aaccggtttt ggatgtttac ccttaatctt accggggacc tcgttgtcct ctcctcctcc
    22321 ttcttcctcg gacaccgggc tccatgctga cgtaggtacc gactggggtc aaaagcctgg
    22381 gtacttatga ggagcgcgca caaaggaccg ttaggcgccg gcatggagcg tcgccgaggt
    22441 acggtaccgc tgggatgggg gttttttgtt ctttgcttgt ctgcctcttc cccgtgtgct
    22501 gttgacctgg gtagcaagtc ttccaactcg acctgccgct tgaatgtgac ggagttggcc
    22561 tcgatccgtc ctggagaaac gtggacgtta cacgggatgt gtatctctat ctgctactat
    22621 gaaaatgtga ccgaggacga gatcatcggc gtggctttta cttggcagca taacgagtcg
    22681 gtggttgacc tgtggttgta ccagaacgac acggtgatcc gcaatttcag cgacatcacc
    22741 accaacatct tgcaagacgg actgaaaatg cgaaccgtcc ctgtgactaa actgtacacc
    22801 agccgcatag tcactaatct taccgtgggc cgctatgact gtttacgctg cgagaacggt
    22861 acgacgaaaa taatcgagcg cctctacgtc cgattgggct cgctatatcc gagaccgccc
    22921 ggatccgggc tcgccaaaca cccctccgta agcgccgacg aggaactgtc cgcgacctta
    22981 gcgagagaca tcgtgttggt ctcggccatc actctgttct tcttcttgtt ggccctacgg
    23041 atcccccagc gactgtgtca gcggctgcgc attcgcctgc cgcatcgata ccagcggtta
    23101 cgcaccgagg actgaacgga taaccgcaaa ggccacgtgc aacgttcacg ctgctataag
    23161 aaggccatgt cctccgtgga cgggtctctt tgacacgagc gcggcacgcc gttgccacga
    23221 gcatggatca cgcgctcctc acacacttcg tcggccggcc ccgtcactgt cggttggaaa
    23281 tgttgattct ggacgaacag gtgtctaaga gatcctggga caccacggtt taccacaggc
    23341 gccgcaaaca tctacctcga cgtcgcgctc cgtgcggccc ccagaggccc gccgagattc
    23401 ccaaaagaag aacaaaggcg gccgtccttc tattttggca cgatttgtgc tggctgtttc
    23461 gacgactttt ctttcctcgg gaggactcgg agccactgat gtcggatccg gcacggtctc
    23521 ccgaagagga ggagtaaaca acacacggct aagaggatac atcatcaaag aagataggag
    23581 gggtcaaaac gcggactgaa agtatataac gctgatcatg tccgaggaac tgttaataaa
    23641 acgccatgat gacaacgtgg tgtctgacgt tgtttgtgct gtggatgttg agagtggtgg
    23701 gaatgcacgt gttgcgttac gggtacacgg ggattttcga tgatacatcg catatgacgt
    23761 tgaccgttgt ggggattttt gacgggcaac acttttttac ctatcacgtt aattccagcg
    23821 ataaagcgtc aagtcgggcc aacggtacca tttcttggat ggctaacgtc tcggcggcct
    23881 accccaccta cctggacggg gaaagagcca aaggtgacct tatttttaac caaaccgagc
    23941 aaaacctgtt agagctggaa attgcgttgg gttaccaatc acagagcgtg ctgacgtgga
    24001 cgcacgagtg taataccacg gaaaacggta gttttgtagc cggttacgag ggatttgggt
    24061 gggacgggga aactttaatg gagctcaagg ataacctgac actatggacg ggccccaatt
    24121 acgaaattag ttggttgaag caaaacaaaa cgtacatcga cggtaaaatt aaaaacatca
    24181 gcgaggggga tactacaata caaaggaact atcttatggg caactgcacc gagtggtccg
    24241 tcatctatag cgggtttcag acccccgtca cccacccagt ggtgaaaggc ggtgtccgaa
    24301 accacaatga caacagagct gaagcgttct gtacatctta cgggttcttt ccaggggaaa
    24361 ttaatattac ttttattcat tacggtgata aggtgcccga ggatagcgag cctcaatgca
    24421 atccgctact tcccaccttc gatgggactt tccatcaggg atgttacgta gccatctttt
    24481 gcaatcaaaa ctacacctgc cgcgttacac acggtaattg gacggtggaa atccccatca
    24541 gcattacctc acctgacgac agttcctcgg gggaggtccc tgatcacccc acagctagca
    24601 aacgctataa caccatgacc atcagcagtg tcctcctagc cctgcttttg tgcgctttgc
    24661 tattcgcgtt cctgcactac tttaccactt tgaaacaata cctacgtaac ctggcctttg
    24721 cgtggcgcta tcgcaaggtc cggtcgtcat gaccagcaac gccctgtatg agttgtttcg
    24781 acgtcggtta ccgcgtgccc ccgtcaacac ggtcatgttt ctcacgcgac gcactcgtga
    24841 tgggttctgc ggtcggttga cgtccatcgc cacgaattcc cactacacta tgttcgtgtt
    24901 agatcacgga tccgtgcgca tcgagcgacc gagtcagtca gaagtggatt gcgccagttt
    24961 aatggaaacg ctgaagcgga ttcggttacg aaattcgtgg gtagcgtcag aagacgagct
    25021 agatgtgagt cgcagggacg cgtgacacga aacgcgttca ggattaacgt aggttttcga
    25081 aataacctac gtccgtgagt gacgcggttt cgtgttgaaa cccgcgcccg gttctcacgg
    25141 tggtttatga tgaaaccggc gttggggatc tacgcgggtt cctcattcaa cctgcgaaaa
    25201 gaggaagttg cggtaaaacc acgtcaataa agacgtcaat gacacctcaa tgttgcgttg
    25261 gaacggtctt tatatataca aacgccgtta tgctctgtcc ggcaagatgc tcgggataca
    25321 tgctatgctg gtgatgctga attaccactg gatgcaggtg acaacgaaca atgacgcccg
    25381 aaataataat acaaatacca tctttgtatc tctccttacc gggcccaacg gagtcacccg
    25441 cacagccgtt ggaggtttgt attcaaacta caccgaccta accgggacat tcaatttcat
    25501 ccaaggcaac atatcagcta atgcgtccag tggagataat tggagcgtag ctaacctgac
    25561 aaaaaactgc atcaaccgcg gtgagtctta cctgattacc ctctggcttt tgaactgtac
    25621 tcaaaacgat acttattggt actctggaaa tgcctacaac tatacaaata acacctgtgg
    25681 aagtacagtc tcgggatatc ttttgggcat gtgcgaacta tggaaaaagt gggtcgataa
    25741 tgatacttct cataacacca ccagaatcga gttgttaaaa aatgaaacac gctgcacgct
    25801 gcccgctaaa cagtataccc tcaacaccac ggtggaatgg tacaacaaat ctgaaggtga
    25861 cgtaccaaag gaattcatga gttatgctat cctgaattcc gtggcggtgc ttacatgcgg
    25921 acttcatgaa gcttatatat tcgacatgac tcgtagaacc acgtacttgt tctccatgtc
    25981 ctgcatagga atcacaagta taatatccat catactcgct tccttatcgc tgcttatcct
    26041 catctgttac tatcgctgtg accgacttct gatatgccca cgcggctttg aacgcttgcc
    26101 agaattcact gaggaagagg aggaaaaaga aaacttgtta acgcacaagg acattgaagt
    26161 ccaggtgcct atccgcacgc ggcgactgct cgtcccttgg atccgggaaa gcaaaatgtg
    26221 gacattacca cctccacttc ctccacgacc tcctcactta atagaattcc caccgtctcc
    26281 tccgtcgtcg cctgagccca cgcacatggt aatctgcata ccatcatgac ggactttgga
    26341 ctgagcccca agcggtacgg actatatatt ttccacaagt ctacactgaa cttgagcaca
    26401 aaaatactga caatggactg gatatataga cttttatatg atccctgtac agatgtaaat
    26461 aaaatgtttt tatttaaaac tggtcccaat gttcttcggg aatcatgggg tggggacggg
    26521 ggacgcggta gggagcaaaa ccgggcacat gggggggaac atcgtccagc agtagcacca
    26581 gtggattggg caggggctgt tgcggaggtc ggtcgatgac gatgtcgatc tccatcggca
    26641 gatccggcaa catctcttcg tctccctcat gaaccagcac tcgacgctgt tctggatgta
    26701 tatgattctg gaaaagcctc cgacgagctc gcggcgcgta gaaagccaag cggcgcaaag
    26761 gccggcgagc ccgaaagtcc atgcgcacag atggcatgag tccttgagtg acggtggtga
    26821 gctggggaac agggctacct cccattgcga cggtgacagt ggatccatga gagaggcgcc
    26881 gcacgctgca tggctaaata ccgtgaatcc cctgacgtcg tctttcgtcc cgaacgcgtc
    26941 atgttggggg cgaggcgtaa accgtcgagg ttgaaaaacc gcgtatctgc gattcgtccg
    27001 gactacgttg tttttcagaa gcggccacat gacctcaaga tgtcgtcacc caaggtattt
    27061 aacggcacac agccagacgc gttcgtcatc agcgacgccg acaagacctc agcatggctc
    27121 ggaggctatg gatcttgagc gtactagccg tgaccttgac ggtggctttg gcggcacctt
    27181 ctcagaaatc gaagcgcagg taaacggaat ctagggaact caacacaggt aagagataca
    27241 aaaaatgacg tgattgtgaa cgcggttatc gtgtttttgc agcgtgacgg tggaacaacc
    27301 cagtaccagc actaactccg atggtaatac cactcgtaac aaggacgtaa ctctcagtca
    27361 gggggggtcc accaccgacg gagatgaaga ttactccggg ggagactatg acgttttgat
    27421 tacggataca gatggaggta accatcagca accacaagag aagaccgacg aacacaagga
    27481 agaacacacc aaagaaaatg aaaagaccca gtagcagcag cagatcccaa gggttaaaga
    27541 ccatgttgac tattttattt tttattaaaa agctgtaagg ttctgctcta aaaacacccc
    27601 gcctccggtc ttttttcttt cgtattcggc acgcgaaaca cggtttcttc ccatagcctg
    27661 tctaactagc cttcccgtga gagtttatga acatgtatct caccagaatg ctagtttgta
    27721 gaggctatgc gggatgctgc ggcggcgcga ccttccctcc ccacccagcc ccgtcaaaac
    27781 acacgcgact cgagcggttc gtatgaaaaa taaaaaacag ctttttattt acaggaacgg
    27841 gaaaaaaaaa aaaggcacac ggtccgtggg agacgcgggt tcacgcgttg tcaaaaagtt
    27901 ggtggtccac tccgtaagga caggtaggct gatttagctt ccgcatgctc ctggttccgt
    27961 aataaatgcc gttttcgtgg cagcgtgtca tgccgcgagt cacaaactcc atcaaactgt
    28021 cggccacgat gcaaacgtgc tgattgttgg cagcaaagac gcgcatacag tcgtccacga
    28081 agaggttgat cacgtcgtag gggctcacca accagcctaa aggttccacg tggttactgc
    28141 cgaccatgac cctccagtcg ttaatctcgc tccagtcgta cagccgaatc gtggagacgc
    28201 gaatgacgct gtaatcacct acgaccatga ttcggccgcg atacatagca cgccactgcg
    28261 cgaacgcgtg gatgtgcatg cagccggcca gcgctctaag cgaggcggtg tgcggcagct
    28321 cctctgggac ggtgatgaag ttgcagcgtc gcaaaccgat gttgagaaat tcagtgatgc
    28381 tctcggccac aaaggtcaac gagtcagagt agatgtggtc ggtccacagg tacatggcgc
    28441 ccgaggcgcc caggtacagt tcagacggca cgttgtgatc gcccttgtgt ttgagaaagt
    28501 tgtaggtgca gatgctgccg acgaaacgca gcggctcggg gcagcagagg tagctggcca
    28561 gacgctgtgc atcccgtcct tcgtcgcgca ccaagcgcca gcgacgccgg ataacgaggc
    28621 agcggtcttt gggccagacc agggccacgc gttgcccggg tttccacggt cgcgacgtct
    28681 taggaggcct ccagcggtcg agcagattga gaaaacagtc cttgattacc gacatcgcgg
    28741 ttgcgcgccg gtggacaaaa agaaatcggg ccgatccaga aaaaaaaaac gacggcaaaa
    28801 caccgccgtg ctcgagcgaa gggtggcgga gggccagaag aggcggcctt gacggcgttg
    28861 gcagcgaaaa aattggcacg cgagtcaaac gggaagtagc gtcggtgttt tatgccccaa
    28921 gcagcgtcgt cgtcactcgt ggcgtcacag tcaacggtgc tgacgtcctt tggggcagtc
    28981 gggcacgcga tcgtagatgc cgttgtggcc gctgaaacgt cggttttcaa acagcaggtt
    29041 aagtcccaga cacatgaacg tgttgagatt atctcccagc cggatgtagc ggtcgtcgcg
    29101 cacgtcgcag gcgtagacgg ccccggtata ggcgacgacg atggggataa ggtcgacggg
    29161 ccagcgcaag tgaggaaagg gcgcgttctc gcccttgagg ctgacggttc ccaagccgag
    29221 aacgcgcatt ccgaaagcgg ttttgatgtt gcgcagcaag tgaccgcctt ccacgctgtt
    29281 ttcgaaacac ctgaggttgc atagacgcag ttccgttccc ggcgggtacg tcagcggcat
    29341 gaactgcccg tggtgacgga tgatgaatcg cgccatggta tccaaaccga ggctccaggc
    29401 gcgcaacagc ggacgaaagt agcgcttaac caacgacgag gtcaggtagc gcatgcagtg
    29461 cagggtctcg acggcgcgca gcccgacgcg cgcaaactcc atgaggttgc gggccaggta
    29521 gtagacggcg gtgtcctcgc gtacatagca aaagacatag ccctcgtccg agatgaggca
    29581 cacggcggtc ttcttctgct gatccggcga caacacgccc tcgttcacga agcgacccac
    29641 gaaggccagg cgcgtctggc agcacaggta gtgactccaa gctttcacgt cctccggttt
    29701 gaagtcctcg tccgtctcga tctcctgcag cactaggttc cagcccggcg gccagaccac
    29761 gggcaacacc tggcctgcgt tgatgcgcac gtaagcttcc agacagccca ggccgaactc
    29821 ggccgtgagc gccaggctag ccagatcgct catgtgacgc gccgagtcgg tgggcgagcc
    29881 cgggggcccg tcgcacacca cgctccgtct tcttgtcctc accgcggcca gcgtggcgag
    29941 gacactttcc gcgcccgagg ctgtatcttc ggtttgcccg ccggagccgg ccctcactat
    30001 ataacgtccc gcccgggtct cctccatgta tgcaggtaag caactgagcc gaacgcacct
    30061 cagcagacga gaggatgtcg tcgcggcgcc gcagctcgtc acgtcgctct ggcgaaccct
    30121 cgacggtgat ttatatcccc tcgagcaacg aggacacgcc ggcggatgag gaggcggagg
    30181 acagcgtttt cacgaacacg cgggcgcgca gcgccacaga agatctggat cgcatggagg
    30241 ccggtttgtc gccctacagt gtctcctcgg acgccccgtc gtccttcgag ctcgtgcgcg
    30301 agaccggcgc cgccggcgcc gccaagaaac cgagcgacaa gaaacgatcg tcgtcgcgtc
    30361 ggcaaccgca gatcgcagcg ggcgcgcctc ggggctcgcc ggcgacaccc aaggccggca
    30421 agtcgcctaa agtctcgcga ccgcctagtg taccctcgct gcccgagaac ggcgccggcg
    30481 acggtggcga cgataacagc agcagcggcg gcagcagcag ccgcaccacc agtaacagta
    30541 gcagaagcac cagtcccgtg gcgccaggcg aaccgtccgc tgtcgagggc gatgagtttt
    30601 ccttctgtga cagcgacatc gaagactttg agcgcgaatg ttaccgggtc agcgtggctg
    30661 acaatctggg cttcgagccc agcgtggtcg cgccgcagca cgttgagtat ctaaaattcg
    30721 tgctacaaga ctttgacgtg cagcacctcc gccgcctcaa cgactgcata cccatgccgg
    30781 ccttcgcgct caccagcctc gtcgaccccg tcttaaacaa cgtagcgcct ggcgagcgcg
    30841 atctcacgcg tcggataatc acgcacgcgg tgatcatcaa ctattactac gtggcgcaaa
    30901 agaaagcgcg ccacatgatg gaggccatac ggaccaccgt gcgaagcgac acggtacgcc
    30961 gggtagccac gcaggtcaac aaccagagcc gttcggggcg tgcggccgcg ctagcgcttc
    31021 actttctcac gtcacgcaaa ggagtgacgg acggccagta cgccacgtct ctgcgacggc
    31081 tggacgaaga gctgcggcat cgcggcacgc ccgaatcgcc gcggctcacc gaggtctacc
    31141 agacgctacg cgattacaac gtgctcttct ataccgccca ctacacctcg cgcggcgcgc
    31201 tctacctcta tcggcaaaac ctgcagcgtc tcaacgagaa ccaccggggc atgctccggc
    31261 tgctttcggt cgaagagata tgcgaagagc acacgctcaa cgatctggcg ttcctagtag
    31321 gcgtcgagct tatgatcacg cactttcaac gcaccattcg cgtgctgcgc tgctatctcc
    31381 agcaccagct gcagagcatc tcggagctgt gttacctcat ctatgtacaa ctgccgtcgt
    31441 tgcgcgaaga ctacgcgcag cttagtgacg tgctctactg ggccgtcagt caaaactacg
    31501 actacgcgct ctacgcgagc acgccggcgt tgtttgactt tttacgcgtc gtgcgtcagc
    31561 aggacgcctt catttgcacc gactacgtgt actgcgccct gcgtctgctg gcctgtcccg
    31621 acagacctat tatcggtgac accggcggca gcagtagctc ccaacgcctc gtaggcgagt
    31681 ttatggtgcg tgatccgctg ttgcgcgacc cgcgcgccac ccacctgcgc cagaaactca
    31741 tcacccgcga catatgcgtg gcgcggttgc aagcgcagcc ctcgagtcga cacattccgg
    31801 tcgaacacac gggtgtctcc tccgtcaccc tgctcaaaat ctttagccag gtcccccccg
    31861 acgaacgcga agaagacacg ttacgcgaga tggctcttaa agcgtttatg gaagcgaacg
    31921 gtaatcaccc cgaacaaatc tgccgatccc caccaccccc gctgccgccg cgcgactatc
    31981 ctcaacgcga cgagcgggac cgtcaccgtc gcgaccgccg cgacagcggg gaatactgtt
    32041 gctgatggtg ggacgaagca gcaggacgga acagtttatg atagaaagtc acaggaaagt
    32101 atgtgtgttg tttttttttt taatgtacca agaataaaaa tgcgtctacg accaaagcgg
    32161 tgtgtggacg ctcgtcctct ctgtcttctc cgggtttttt ttttcacgtg tggttttttt
    32221 ccttcctatt ttgttacggc aacagcgctg atggcacgtt gccggcttcg aacatcgcgt
    32281 cggtgatttc ttgcttgccc ggcgtcacac ggtgacgcag cagcgcgcgg ctcacgtagc
    32341 aggccgactc gcggatgacc tggccgtcgg cgtcgcgtcg caggcccgag cggttgccgt
    32401 gacgcagtct gccctgcgca gcgcgctcca cgtcttcaaa gtagctgtgt agcaggccgc
    32461 gctccagcag ctgcggcagc gagtcggcgg cgcgcaccac aaagttctca cggctgatct
    32521 cgtagcacag cacgctgccg tcggccgcca cgccggccac gctgcggtcc caactgaaaa
    32581 ggttggcgag tccgatggtg ccgatgacgc gcaactgacc ctgggtcacc accagcagct
    32641 tccagtattc tacgtcgcgc ggggtgagga tggtctcctc cacgtcgcag acaaacaacg
    32701 tgtagccgcg cggatagggc agatccaggt ggcgaccgcg ctggcggcgc ataaaatcgt
    32761 ctaaattcaa accgccgtcg ggtgcgcgcc tgctcgtcat cgccgcgcct cgtcggtcga
    32821 tgaccccacg gtgcttataa cgcgccgccg cggcttcatg tggcgtgacc tccgacctcg
    32881 tgaggccgaa aacggcgtac atgaagacgc tcaaactttt gaatgtgggc ccggtagcgc
    32941 accgagggcc ccggggcggc gacgacggcg ggtccgagtt ccagcggggc cttgcggcgg
    33001 cagcggttgg cgtggttgct cagctcggcg tccgagagcg ccgagctgaa ctgcggcagc
    33061 cgcgtgcgat cctgcggcgc gtccccgtgt cgcagcgagt gccagagcag gcgctggacg
    33121 cgcgccgtct cgggcgtcgg cggcgcgcga cagccccggc gcagcttgaa aacgtgcagg
    33181 cacagcagct cgcgcttgat gcgcagcgac acgctgcggt agtcgggaat ccgctgcacc
    33241 agctcgagaa agtcgcagaa ggtctccacg aacgtgtcct cggtgaagcg aatgcgcttc
    33301 agatcgtgga cgtgtttgcg gaaccgcgac agttctcgac gttgcacggg gttctgagcg
    33361 agtcccttgc gcagcagcgc agcctcgcct ttaaacagcc tgatgagccg ctgcacgtcc
    33421 ccgctcaaca tacgtataca cgccgtgtac tcgtgacgta tactggcgcg cagcagccga
    33481 atgatacgca gggccagtac ggcgttggag gccaggtaca tggcgtagcc gcgacgcggg
    33541 ttggcacagg cccagcccgc ggggagcaga aagtagtcgt cgaccagcgt ctgcgaccag
    33601 tcggcgaagc ccaggtcacg tgatacgctg ttctggacgc gggccacgtc gccggccgtg
    33661 aggtggcgaa tcgccggcag gtgaaacgca cccaggtgtc ggttgcgctc cagcctcagc
    33721 tcggcgtgct ccaaacggga atggtgagac gccgccgcgg aaagcgacaa agaggagtgg
    33781 tcgccgccgc cgtggttacc gttgtgatta ccgccgtcgt cgcgcccgtc gccgcactcg
    33841 caaaaggccg cgtagaggtc ctttaacgcc gcttcggccc gcgccataaa cgtggcgtgg
    33901 aaaaaaacgg cggcgcggtg cgtccggtac ttgacgggca acccgcggca cagggccgcc
    33961 ggcaggcaac ggccgatgag ttcgcgctcc tcggggtcca gaaacaggca cagggtgccg
    34021 tccaggcgca ggtacagctc ctcggtcatc gagcatagct gccgcaagta atgggtgcgc
    34081 gtcccaaagg tcttgtaatc gagcaacgtg cacaccacgt attgccccgt ggccacggcc
    34141 agagcgatgc gtttggcggc gcgactgatc tctggcaagt actgcgcctc gtgcaccaga
    34201 cggcggaaag cgccggcgtt gagccagcga aaatgctgcg gatcgggcgg caagggcacg
    34261 cctcgaagcg cggcccagac agcgaggtcc gactcgagcg tcagaccgcg gatgtcgtac
    34321 ttgccgtgcg ccgtagcgca ggccgaatgg accagacagc tgcggcgaat gtacaccatg
    34381 gcgtgcttgg ggtgtttggg cgccggcgtt ttctttttct gaccgccggc ggccaccaga
    34441 tcctcgggcg tgcgacacaa caggccggcg cgcacagcct cctgtcgatt acgaatcggc
    34501 gtcaggtagg cgcgcaggaa ctggtgacaa aactcctcat catcacgaca gtcgtcgaga
    34561 tactcgtacg tggtgagcgg atcgcgaaat aggcgctcgt caccgtcgtc atggtcttct
    34621 ttagcctgct cctccggctg ctgggttggc agtggaggcg gcggctgatc cacggggttc
    34681 atgactgaga ggaagaagaa ggtggcgacg aagcgacgcg gagcgacggc ggtaaagcca
    34741 gacagcggct atatagctag tcatcacagt ctcctccttc acgacgcccc cgtgccgctc
    34801 acgctatcca gcacgctacg gcccgaaaac acgtactcgc tgacgtcgta cgcgggcgat
    34861 gtatggctgc tcaccggttt cgcggcgacg gttgcgctcg agtccaacgg cgagaagcaa
    34921 aaacgccgtg ggcaacgaaa ccagaaggag ccctgacgga taaaaccgcg caacgtctcg
    34981 gccaacttaa ccagcatcgt accgtacagc agtacgtgaa tgccgccgtg cgcgtccata
    35041 aatacggctt tgttcacggg ttccatccat ccgatgacta caaagtgggc ctgttctagc
    35101 acgccgatca caaaattgtt ggcctcgtcg gcctcggcca cgttccacga gccgaaagtg
    35161 aaagtacaag cgggcgagcc gcccaggcgg atcttgctac cggcgtggag ctgacatacg
    35221 cgcagcagat tggtgcggtc gtgcagtatc tgggagagtt cgtacatgcc cgcgaaggtg
    35281 tgcttaaacc acgcgccctc tacgatctca tccacgtagt cgcgctcaaa gaagctgtac
    35341 acggcaaaga ggccgttctc aaaaaactcg ccgaacgaga gccccagcac gtacaccttg
    35401 tcctcgccgg gcaggtacgc aaaggcgtgc ccgtgcccgg agacccagat ctcgggcgcc
    35461 gtgtttgcat ccggcacgca ttcgtacaca ctgacgaggc cgataaagta caagcggcca
    35521 gcctggcgca ggcacgagaa gcgccggtag gtcttgtgat cgcgcaccac cccaaagtac
    35581 tgagtgtcgc ccagcatgat gccgtgcagc ggcggccagc acagcgggag ccaacgaccc
    35641 gccgtggcgc gcacgtagcg ctgcaggtga accccgctcg cacgctcgcg cggcttcggg
    35701 cgcttgtggg tccaggcatc acgcagaccg cgccagatgc tgctgaactt gggctgcccg
    35761 cgcagataga gcgacgagag cgagtcaaag tagcccacga cgagcctgtc gggagacaca
    35821 agagcgcgaa aatcaaacct agagcgacga cggtgaaaaa accgattata agcgcgtgtc
    35881 tcaaacacgc tactttcggt tataaaaaca ccgtcgctct atttctgggc gtgtgtacac
    35941 tgatgactca cctacgcttt ttgaacggca gtctcagctc gggattggcc tcgtacagcg
    36001 agctgcggtc cacggggccg atgctctcgt agcgaaagtc gtcgatgagc agcgccagcc
    36061 ccacgcgcac gaagcccctg aggtcgcgcg ccagccgcac caacttatcc tgccccacca
    36121 gcgctgcgta cacggtgccc gtgtcgccgc agagaatccg cacgcggtga aagaaggtct
    36181 tgtcctcggc gccctcgatc tcgcccagcg gcatgacggg ctcgcgcgtg tacaacgaac
    36241 gttgaaagcg gcgcagcatc gaggccgaga gccccagatc gcgcgccgtg cgcagcacca
    36301 gggaatgctt ctcgggccag atgagggtca gctgcgcctc gcgatgcgcc tctacgtagg
    36361 cgcagcgagc ggcggtgtcc tcgcaagcca gcaactcgcg gaaagccagc agcgaacgta
    36421 ggtagcggcc gcgagcggag gcgcgcgagc ggcggcacag ctcggcccga tgatcgggat
    36481 gcaccaaggg cacgttgggt tgcagacgcg cgcagatgga ttcgtgcacc gggtcgcagc
    36541 ggatcatgcc cttggcaaaa aatccggcca gatccgaggc caactcgtac aggcagtcct
    36601 cttgcgcgtc gtaggcgaac acggcgccgt acgcgtccac gaacacctgg taccggcagg
    36661 tggcgtgcga gaccgtgcca atgagatgta gagctcggaa ttcgccgaaa aagtcgttct
    36721 ggcagtgctc cagatcgatc tcggtcagcg agtgcggcga atgctcgccc ccgaccacgt
    36781 agatgcactg cgagggccag cccagcgaca cgcacgagcc ctcgaagcgc cgcaagtaac
    36841 gccgcaggcc ctcatagtcg cgtcgcacgc acaggtcggc caagtcgcgc gtgcaaaaga
    36901 cctcgggtac caagcagcgt ttgcgacgcg gccgacgtgc gtgcccgggc agaggaggaa
    36961 ggcgcgacgg cggcgacgac gaggaggaag acgccgtggc cgccgagcag cccttgcgac
    37021 ggccggacat gccggcagtc cgcgacgatc cacaggagac aaaaaagcag aagcagcagt
    37081 agcctcggcg acccgctcca ccccgtcctc cacacgctca gccgcgactg aacgccgggg
    37141 cgcgccgcta cttgggtttt tatagccatc tgccccccgt ctcgggcacc cgggagcgat
    37201 ctacggagac ctgacagcag ttgggcaaca caagataggg aaatacaaag acacttttaa
    37261 taaaaaacga gactactttg tgtgtgtgct ccgtaaactg tttattctcc ccctccgctt
    37321 cgctctggat gggctccggg tccgtcaaca cgcgacccgc gcggcaaaag gcacgctgtt
    37381 gacggcgcga gagcccgtcg tgatagtcca tcatgccccg gagatcgtgc acaaagcagc
    37441 tgtcgccgcg cagaaaccga cgcagcgtct ccacatgctg cagctgccgg cgcgtatcag
    37501 gagccgtcat cgctgatgtc gtcatcgccc tgacaggcgc gtagatggct ccgcgagatc
    37561 atgcgcgttt tcaaccgccg tgacacatca ggtccatctt gagctggcgc cgggcctcgc
    37621 gcaggtgtcg cacgcgttgt gagcgggagg cgagttcggc ttcttgctcg aactcctgct
    37681 gctcactgtc cgagagggtg cgataaaagg cggcaaagtc ctccaagtcg gctacatgcg
    37741 ccctgggtct gacgctccaa agcgtacgca gtctgatgaa gcggacccat cgagcgtcac
    37801 ggcacgccgt cttgaacgcg gggcccggga agaggttctt ctccccggcg cgctcgggcc
    37861 ggcgaggccg acgcggttta tatacaccgt ctcggacggc gggacgccga gcccgcgccg
    37921 cggccgctca tccggagacg gcggaaaccg cggcgccgga ggaaacgggg accggcaacg
    37981 acggcggtgg cggcgaccag attatggggg acaaacccgc gcttgtgacc ctgttgaccg
    38041 tcgccgtgtc gtcgccgcca ccgtcgtcgc cgctgccgct cgtcagcttc acggagctgc
    38101 tgttaccgcc gccgtccgtc gccgccgctg cggtggcggc gacagcgacg agcgaggtgg
    38161 gcgagaaaac cgcggagcaa gaggtagcgg ctgcgggtcc ggagaccggg aatgagagaa
    38221 gagaaaacag ggagaacgaa ggaggggaga caagaacgac aggcaccacc gcggtcaaaa
    38281 ggtcgcacga cggtatccct cgccaactgg cagagcgcct gcggctgtgc cgccacatgg
    38341 accccgagca ggactatcgt ctgccggcgc aggacgtggt gacctcgtgg atcgaagcgc
    38401 tacgcgacgc ggaccgcgac aactacggtc gctgcgtgcg ccacgccaag attcaccgtt
    38461 cggcctcgca cctgacggcc tacgagtcgt acttggtgtc catcaccgag cagtacaaca
    38521 cggcctcaaa cgtgacggag aaagcttcgt acgtgcaggg ctgcatcttt ctctcgtttc
    38581 ccgtcattta caacaacacg cagggctgcg gctacaagta cgactggtcc aacgtggtga
    38641 cgcccaaggc ggcgtacgcc gagctcttct ttctgctctg ctccaccagc gagagctccg
    38701 tggtgctaca accgctcatc accaagggcg ggctctgctc gtccatggcg gtttacgacg
    38761 aggaaaccat gcggcagtcg caggcggtgc agatcggttt tcttcacaca caactggtca
    38821 tggtgccctt cgtgccgcac gcctgcccgc attacgccgt gcctttcacg acgccgggaa
    38881 agccgggctg cggcggtgct ccgagcggcg ttgcggggtt ggaggaggcg gcgccctttg
    38941 gacgggtcag cgtcacgcgg catggcgcga cgctgctgtg tcgcgtggac catctgacct
    39001 ggatcagcaa gcgcgtaacc acgtacggac acaaaaaaat tacgcgctac ctcgcgcagt
    39061 tccgcggcac gatggacgac gacgaggcgg cgctacccgg cgaggacgag gcgtggatcg
    39121 cgtccaaaaa cgtgcagtac gaattcatgg gtctcatttt caccgtcaac gtggattcac
    39181 tatgcgtgga cgcggaacag cgccaactgc tgggcaccgt ggccacctcc ttctgtcacc
    39241 gcgtctcgga caagatcacg gcgcgcaaca tgccgcgcgc cttttccttc tacctgctga
    39301 cgagcgcgca gcgcgggtac gacctgcgat tcagccgcaa cccgtcactc ttttttagcg
    39361 gcgacgcgct caactgtccg cttctcaatg agcccaacgt gttttcgctc acggtgcacg
    39421 cgccttacga tatccacttc ggggtgcaac cgcggcagac ggtggagttg gacttgcgct
    39481 acgtgcagat cacagaccgg tgtttcttgg tggccaactt gccacacgag gacgcctttt
    39541 acacggggct cagcgtgtgg cgcggcggcg agccgctcaa agtcacgctg tggacgcgca
    39601 cgcgttccat cgtgatcccg cagggcaccc ccatcgccac gttgtatcaa atcaccgagg
    39661 gcgacggtaa cgtgtactcg tacaatcacc acacggtgtt tcggcagatg cacgccgccg
    39721 gagcaaccac gttctttctg ggcgacatgc aattgcccgc ggacaacttt ctcacgtctc
    39781 cccatccctg accctccgtc cgtcctcctt tcccgacacg tcactatccg atggtttcat
    39841 taaaaagtac gtctgcgtgt gtgtttctta actattcctc cgtgttctta atcttctcga
    39901 tcttttggag gatgttctgc acggcgtccg acggcgtttt ggcgcccccc atgccggcag
    39961 aacccggttg cggccccgta ccgctcttct ggggcgacga taggtcgaaa gccaccgttt
    40021 tcatgcccgt cgtgctcttg acgggggaac ctacggcggc ggtccccgtc gagcggcgtg
    40081 attgcaaagc cgcgctcgcc cccggtttca ggatggaggg ggaggccaca ggcggcgcat
    40141 tcgatacgct gcttttggcc gtagacgacg gtgggtaaac ggtggttacc gcgggatacg
    40201 tcggcgtggt cgaggcggcc cggctggtgc cggacaggcg acccggcgcg ctaccgctca
    40261 cggggaccga gggcggtcga cctaccaccg ccttgccgcc caaagtaggt ttcaaggaag
    40321 gaacaacacc gacgcggctg ccccggcctt tcaccggaga cgggggggca ctcttggccg
    40381 gggacggaga ggctgacgaa agcatgggca gcggcgatgt ggcgggagac acgatatcat
    40441 cctccgtggg cgacaaaacg gacgccgaag ctgacggctg tcgagccgaa gcggaagagg
    40501 ttcccgcgcc agaagccacg ttccttgatg acgtcgtttt agacgaagcc ggttgaggtt
    40561 gcaacagcgt ggcgggtacc gtcgacggcg tgcccgacac ctgtttctct acctttccct
    40621 gaaccggtgt cgacgtcacc gtctgcgctc gggcggacgc gtgcggcgtc gcgactcgct
    40681 tgcccagcac cggtttctgg ttcgtggatg tcgtcgtcat tggagacgat aacttagctt
    40741 tacgtattct ggacggcgtc gactgctcgg gcgtctgact gggaggcgaa atgacgtcgt
    40801 tgtaatcgga cgacggtgtt gtgtgtccca ggctgacgac ggagccggtg tccgaggagt
    40861 cgtcgtcttc ctcctcgctg tcttcgaccg gtgactctgc agtttggtcc cttaaagccc
    40921 aaacctcatc agcggtgttc tgagacgctg tttgtgtcac cgcggcgcgt ggagtcgacg
    40981 gcctccgagg ggtggtggac acggtgtttt gagaagccgt ggaagtcgta ggcatcctga
    41041 agggattgtg agccaggtga ggattcctga gggcccacgc gcgttcgcgc ggccagttgg
    41101 cggggttcat atccccgggc aacggcgccg tcggagccca gggcgagtta ccgttgaccg
    41161 gggtttgggt acccgcgaag gtaggtgtcg gggccggagc gggggccgta gaaggattga
    41221 caggcgtcgg cgtgaggatg gcagcgccgg cgccagcagg gacgttaact ccggcgccga
    41281 acgtcaacgt cggttgctcg aacttgtacg cggtggtgac gggcggtttg acgttcgtct
    41341 cggtatccgt gatatccacc agcgtgtcgg tgaaacgcgg atcctgacgg ttggggggat
    41401 agccatccga gctgtcggaa tcctcgtcgc ccgagaaaag atcccctctg gtctccgtga
    41461 gcggcctcac gtcccacgcg ctgtcccgac ggacccttcc cgggctggcc ttggtcacct
    41521 gcggggagac gagactgaaa gccgcgtgac gctgttgttg ctgcgggatg ttcaagggac
    41581 cgctggtcgg tttctgactg cccgaggata acaggccgct gaaaatgctg gaaacaccgc
    41641 caccactagc ggcgcccttg ccgctagttc ccggtttctt gatgggcgta aagatgtttt
    41701 tctcgtcatc atcatcatcg tcgtcgtcgt cctcgtcggc actggagcca aagagcctcc
    41761 gggaggcgct tggtttacgt gccgggggcg gtggttgctg ctgacgttgc tgcaggttct
    41821 gctgcctctc ctcccaagcc ttcagctgct gtttctcacg ctgcactacc tcgtcgtcca
    41881 cccgtttctg ccgctcgcga cgcttttcct cttcgtcgta atagccgacg gccgccgaac
    41941 gggcagcgtg ggcttcggcg gccggtgcca gagaaccatg ggcctcgaag cggaacggtt
    42001 tgtgtccctt ccagggactg gcgatccagc tccagccgtc cagcggctgc gtggggacat
    42061 gtttcttggg taccgacgag aaggctgaac cgccgccgag cgagaggaga ttggcgtcat
    42121 catcaaactc caacgacggc gagcgcgcgc ccaaaaaggt gtgcgccgac tgcgggaagc
    42181 tgtccacgta gatgtcaaag tcctcgatga gcagctccag cagcgtgtcg gccgagtcgc
    42241 cgttttccac ggcgtgcttg aggatattgc gacagtagtt ggaatcaaag gaaaggcaca
    42301 tgcgcagctc cttgaccagc agcttgcagc gctcctgaat gcgcgccaga catttgcgct
    42361 ccagctcctc ccaagacctt cgcacgttca tgatgagacg gcccgtgtac acgagcttgt
    42421 tgacggcgtt gaccagcgcc gtgttggcgt gccggtccag gttaaggtcg agcggtttca
    42481 cgcagaacat gttacggcgc acaccctcca ggttttcttc aatgcgctgc acctccgtat
    42541 ccttgaggtg cacaaaagcg atgggttccg tctggccgat ggctgtgacc agcgtctcgc
    42601 gcaccgacat cttggccaga atgaccgcgc ttacgagcgc gcgctccaca atctcagcat
    42661 cgtggcgcac gtccgtatcg aattcggtac ggtctagcac agccaggtgg tcacgcgcct
    42721 taccacgatc accgaacggg taagtgtagc cgcgacgcgc cacggccgcg caacgcacct
    42781 cgaactcctc gagcaccgag gagaggtcgg ggttgtggaa acgcagctcg cggtagtatc
    42841 ccaaccaaag catgagctcg ttgaacagca ccgtacgccg gtgcaggcgt ttttcgccac
    42901 attttttcag gatcttgggg tgtgcctcga gatccacgtc gggcttttgc gtgagatggc
    42961 gcagaaagtt gaccagggac accacatcgc gccgctgtag accgataaac tgcaaactca
    43021 tgctggcttt tctccagaac ccggaagcgt cgtcgccccg gactgcgccc gcggtctgct
    43081 attcgcccgc gatggacacc atcatccaca actcggtgag cgtcccaccc aaagggaggg
    43141 ggggtagttt aatagcggag gcggatacgc ggttttcttt taagcgccgc tgacttgttt
    43201 cttctgtttt ttgcaccgtg tgctgtttcg cccagacccg caacaccact actccgcaca
    43261 tcaatgacac ttgcaacatg acggggccgc tgttcgccat ccgcaccacc gaagccgtgc
    43321 tcaatacgct tatcatcttc gtgggcggtc cgctcaacgc tatagtgttg gtcacgcaac
    43381 tgctcaccaa tcgcgtgctt ggctattcga cgcccaccat ctacatgacc aacctctatt
    43441 ccactaactt tctcacgctt accgtgttac cctttatcgt gctcagcaat cagtggctgc
    43501 taccggccgg cgtggcctcg tgcaaattcc tgtcggtgat ctactactca agttgcacag
    43561 tgggctttgc caccgtagcc ttgatcgccg ccgaccgcta tcgcgtcctt cacaagcgaa
    43621 tttacgcacg ccaatcgtac cgctccacct atacaatttt gatattgaca tggctcgccg
    43681 ggctaatttt ttccatgccc gcggctgtct acactacggt agtaatgcat catgaagcca
    43741 atgataccac taatgccact gggcacgcca cctgcgtact gtactttgtg gccgacgagg
    43801 tgcacacagt actactttcg tggaaggtgc ttctgacgct ggtgtggggc gccgcacccg
    43861 tgatcatgat gacgtggttc tacgccttct tctactcgac cgtacaacgc acgtcacaaa
    43921 aacaaaggag tcgcacctta acttttgtca gcgtgttgct catctccttc gtagcgctac
    43981 agacacctta catctctctc atgatcttca acagttacgc cacaaccgcc tggtccacga
    44041 aatgtgaaca cctcacactg cgacgcacca ttggcacgct ggcacgcctg gttccccatt
    44101 tgcactgcct cattaatccc atcctgtacg cactgctggg tcatgacttt ctgcagcgta
    44161 tgcggcagtg tttccgcggc cagttgctgg accgccgcgc tttcctgaga tcgcagcaga
    44221 atcagcgagc tacagcggag acaaatctag cggctggcaa caattcacaa tcagtggcta
    44281 cgtcattaga ccccaatagc aaaaactgca atcagcacgc caaacgcagc gtgtctttca
    44341 attttcccag cggtacgtgg aaaggcggcc agaaaaccgc gtccaacgac acatccacaa
    44401 aaatccccca tcgactctca caatcgcatc ataacctcag cggggtatga gctttcctgt
    44461 tactttattc agaaagcacc agaacccgtc gccatttccc ctcatatacg gtacacgtcc
    44521 ccctgatctg tcatcacggt acacagattt cgcccgattg cggacgccga cggccaatcg
    44581 cgtggcgtag gagtggcgcc ccggcttcat tataacgcca cgtcggagcc cctgcgcgcc
    44641 acaacgccgt ccggcgcaac ttctgtctcg gcacggtacg ataaaaacga cgtcccccgt
    44701 cgacgttgtt ttctccgagc ggtgatcgtt cccgtccctc tcctccctcc gcggccccca
    44761 cggcggcggc ctgctcgcac ggacctatac tattaccgcc ccaccgccgt cgtcgtcatg
    44821 aacttcatca tcaccacccg agacttctcc aacgacgatt cagtcctgcg agccgccgag
    44881 atgcgtgaca acgtggcagg ctcgatttcc aaagcgtaca agggcacggt acgcgccgaa
    44941 ggcaagaaga agctgctgct gaagcacttg cccgtaccgc ccggcggctg ctcgcgccgc
    45001 aacagcaacc tcttcgtttt ctgcaccgag cgcgattacc gcaagttcca ccagggcatc
    45061 gcacagctca agcgcgcgcc ggccgaactg gacccccacg agatccagca agtcacggcc
    45121 agtatccgct gccgcctgca gcccagtctc cgcgagccgc ccacgccggc cgacgagctg
    45181 cagacggctg tgtcgcgcgt gtgcgcgctc ttcaaccagc tggttttcac ggcccagctg
    45241 cgccactact gcgagcacca ggacaaggtg gtgagctacg cgcgcgacga actgactaaa
    45301 cgctgcggcg aaaaatcggc gctgggcgtg gaagtgcatc aactggtagc cctgctgcca
    45361 cacgagcgcc accgcgaact gtgccacgtc ctcatcggct tgttgcacca gacgccgcac
    45421 atgtgggcgc gctccatccg tctcatcgga cacctgcgcc actacctgca gaacagcttc
    45481 ctacacctgt tgatgaactc aggtttggat atcgcacaag ttttcgacgg ctgttaccac
    45541 agcgaggcct accgcatgct cttccagatc ggtcatacgg actcggtgtc ggcagccctg
    45601 gaattctcac acagcgcggc ggccgggccg cccgaggccg atgagaacaa cgacgaggga
    45661 gaggaggacg acgacgagct ccgtcacagc gacccggcgc cgcttcacga gtccaagaag
    45721 ccccgcaacg cccgtcgtcc ccgcacacgc atgccgcctc acgagcaaaa gcccgaagaa
    45781 aacgaggagg aagaagagga gctgtttccc tcctgcaagg caaccgcagc attcctgcgg
    45841 gcagaaccct ccgtctccaa cgacgacggc aacggcggcg aacgctgcga cacgctagcg
    45901 accgccctgc ggcattgcgc cgacgaagaa gacggacctc tagccagcca gaccgctgtg
    45961 cgggtcgccg cgaccccctc accttcagtc accccagccc ttacccccgt cacgtccccc
    46021 ataaccccgt tgtgtattta acgtcactgg agaacaataa agcgttgatt tctcaagttc
    46081 cgctctggtt ttggtttcgt tttcaaaggg agccccatca tggcccaagg atcgcgagcc
    46141 ccatcgggcc cgccactgcc cgttctcccc gtggacgact ggctcaactt tcgggttgac
    46201 ctgtttgggg acgagcaccg gcgcctgctg ctcgaaatgt tgacccaggg ctgctccaac
    46261 tttgtggggc tgctcaactt tggcgtgccc agccccgtat acgcgctgga ggccctggtt
    46321 gacttccagg tgcgcaacgc ttttatgaag gtaaagcccg tggcccagga gattatccgt
    46381 atctgcatcc tcgctaacca ctaccgcaac agccgcgacg tgttgcggga cctgcgcacg
    46441 cagctcgacg tgctgtactc ggagccgctt aagacgcggc tgcttagagg gctcatccgg
    46501 ctctgccgcg ctgcgcaaac cggcgtcaag cccgaggaca tcagcgtgca cctgggcgcc
    46561 gacgatgtga cattcggcgt gctaaaacga gcgctggtcc gactgcaccg ggtacgcgac
    46621 gcgctggggc tgcgcgcgtc tcccgaggcc gaggcgcgct atccgcgcct caccacctac
    46681 aacctgctgt tccacccacc gcccttcacc acggtcgagg cggtggatct gtgcgccgag
    46741 aacctgtccg acgtaacaca acgtcgtaac cgaccgttgc gctgcctcac ctccatcaaa
    46801 cgcccgggct cacgcaccct ggaggacgcg ctaaacgaca tgtatctgtt gttgacgctg
    46861 cgacacttgc agctgcgaca cgcgctggag ctacaaatga tgcaggactg ggtggtggaa
    46921 cgctgcaacc ggctttgcga cgcgctttac ttttgttaca cgcaagcccc cgagacgcgg
    46981 cagactttcg tcacgctggt gcgtgggctg gaacttgcgc ggcaacacag cagtccggcc
    47041 ttccagccga tgctgtacaa tctgttgcag ctactgacgc aactgcacga ggccaacgtg
    47101 tacctctgcc cgggatattt acatttcagc gcgtacaagc tgctgaaaaa gatccaatcg
    47161 gtctcggacg cccgcgagcg cggcgagttc ggggacgagg acgaagagca ggagaacgac
    47221 ggcgagccgc gcgaggccca gctcgatctc gaagccgatc ccacggcgcg cgagggcgag
    47281 ctctttttct tctccaagaa cctgtacggc aacggtgagg ttttccgcgt gccagaacag
    47341 cccagccgct acctgcgccg acgtatgttc gtggaacggc ccgaaaccct gcagatcttc
    47401 tataacttcc acgaaggcaa gatcaccacc gagacgtatc acctccagcg catctatagc
    47461 atgatgatcg agggcgcctc tcggcagacg ggcctgacac ccaagcgctt catggaactc
    47521 ctcgacagag cgcctctggg ccaggagtcg gaacccgaga tcacagaaca tcgcgattta
    47581 tttgccgatg tttttcgccg tcctgtgacc gacgcggctt cttcgtcgtc cgcgtcttcg
    47641 tcgtcgtcct cagcatctcc gaattctgtt tcgctgccgt ctgccaggtc gtcatccaca
    47701 cgaaccacca cgcccgcgtc cacgtacacc tcggccggga cttcttctac cacgggtctc
    47761 ttgctctcct cttcttcctt gtcgggatcg cacggcatta gctccgcgga cctggagcag
    47821 ccgccccggc aacgacgccg catggtcagc gtgaccctct tttcgcccta ctcggtagcc
    47881 tacagccacc accgacgtca ccgaagacga cgcagcccgc cacccgcacc ccgagggccg
    47941 gcccacacac gcttccaggg acccgacagc atgccgagca ctagctacgg cagcgacgtc
    48001 gaagacccgc gggacgatct ggccgaaaat ctacggcatc tctgaacgcg gttttcctct
    48061 ttttctacgt gtctgtctca ggacgagacg tcgatatcaa taaaaatacc gtcgacgtgg
    48121 ttttctaaca gtgtggtttt ctttattgac cagcggagta cacagtttac gagtaaaaaa
    48181 gacagggaaa ggttatataa aatgctgtat tatatacaaa aacatgcaca tagacaaacg
    48241 ggaccaccgt gctcgtcatc ccctccttaa tcagttgttc atgtaggcgt gtggcggggt
    48301 gaggggcggc atgccgttgg cggcgccggg aataatatgc cgtcgaccga cgtcgcacac
    48361 cttgaaacgc cgtcggcgca cgcagcggtc gcaggacggg atatcccaga ggaagcccat
    48421 gtaggtctcg gggtcctcgt cgtgaaagcg gtaggagagt tcaaagtggt gcaacgagcc
    48481 cgtccgagct cgcagcttct ggcgaacacc ctccacgtca tcggtgcaca gcgacagtgc
    48541 tgggctgtca cacagggcct gaagctcctg cggccacagg tgcgtggcca ggggcgagtc
    48601 cgtcgtcacc agtttgacgc agtgcatcag gttctcggtg atggcgtcgt acaggcgact
    48661 ctcagcctcc tcgtgcgtca tcacgtttcg aggcagcgac agctcgtcgt cgtcatcctc
    48721 gtcaaacatg atcatggggt caggggtttt tttgggatgt tgacaggtgg gtgtcttttc
    48781 cagacgcacg atggcctcac gccggccgct gaaacggtgg tttcggtgtc ccttctttcc
    48841 catgacgcag gtgaacataa ccacgtcctc ggccaaacgg tagacggcgt ccatggcggg
    48901 gtcgtagccg tagacgacgc cgaaagtgtc caccaagaca tactggcgta cgaggaactc
    48961 tttgcgttct ggcacctcgt ggcccagcgc gcccaacaac tggtggtaac aggtgatgcg
    49021 cggcacggta cggatcatga gctccatggt ctggatgctc ccgcctgcgc ggatgacgct
    49081 gaaggatgtt tccttgaact tcataacctc tgtgttgtgg gtccagaagg cgaaatgggt
    49141 gtcgggacac tcatcgaaag ggtcgtcgat ggtgtaggaa gcgtagcccc gcttggtcac
    49201 ctcggccgac aggctctcca cgtcaccgcg atagagcatg acggcgttcc agtagtcgtc
    49261 gtactgcacc atgggccgct ggtagtcgcg catagtgtgg aagtggtcgc agtgacgaaa
    49321 gccatgccgc agaaagtcct tcatggtggg cgccagctcg tagacgcagt cgcgcaggtc
    49381 atcgtagcag taaacgccgc cgcgctgccc gatgagcacg atgagttggt agcgcataaa
    49441 gcccggaccc tcgacgaagc cgaaggggtg caggtactcc tgacagcaga cgtaagcacc
    49501 tggtagagaa ataatagaaa aaaatccacg cacgttgaaa acacctggaa agaacgtgcc
    49561 cgagcgaacg tcctctttcc aggtgtcttc aacgacgtgg ggcttacctt gcgaacagac
    49621 ggtgcccatc ttgcccacga agggccccag ggcgctgcgc gaacggagct ggatgaagca
    49681 gcgttcgggc caggccacgt gcagccgggt gccgcattct tgctccagaa agtcgttgag
    49741 accgttaaag tccccggctc ggatggcgat gcagccgtag gccatcagcg tgtcccgtag
    49801 gtcgtccatg acggactcct ctaccttcgc tcgccgacgc tgcgcttctc cagccaccgc
    49861 tgcggtcgac agactcctcc gtccgccttc ggagaactac ggcgcggcgg cacggccttt
    49921 atagacacta tcagcgttga cgtcagacga tccgatgaac gtcgtttttt gtgctggaac
    49981 ttccctcgtc ccgacaaatg tagcggaaat cttcaagcaa atcgcgacga agtccgatga
    50041 ggaggatgca aaagaggctg agcaacgcga tgctgcccgc cgccacagta catatgctca
    50101 acaacgccca gtgtcccaac gcgcgacttt tggctcggag cagagccgaa cggcggtttt
    50161 tccacatgat ggataacgta gtccaatacc tccatccttc gcattccgat gtccacatgg
    50221 gaagcgatgt catgttagtt cccgtaaacg ttgtgttttt tttattgttt tttgtaagct
    50281 taacgctcct cttgagaaat cgcggacaca tgtcttgtag aaaaatataa tcactttccg
    50341 catataccgt taagattgac atcacagtga cggtgttgtt ttctgaagaa gtcacgttgt
    50401 cggtgacgtt ggtttcctcc caatttacgg atgactcaaa cggactcgtg cgcgccagtg
    50461 ctcgcaatac gtaactgcgg ccggtaaggt taagcgtcag ctgtcccatg gtaatattag
    50521 tgtcatttgt aaaacacgca acctccccgt agacctcggt gacgttgata tcgcggctct
    50581 cgttcaggat gcgcagggga aaccagcctt ccaggtggta ctgaaaacca aacgtgagca
    50641 tgacgctgtg ccactgccga cgtgattgcc gaaacgttac gttcaagggc agtttggatt
    50701 cggctccggc gcaggggccg ttgtagattt gcgtatgatt gcacgtgcag tttaacaggc
    50761 agttcatact cgtggcgttg gaagtgacgt taatgtccgt accgtggtac gtacatcgaa
    50821 cagaaacacc gtatcccgtg ctccaaaaca gcgtcaacaa cagccacaca gacacctacg
    50881 tggggacgac acgggacttt ttattgacgg agactcatgt ttacaccctc ccctttccca
    50941 taggtaaaaa cccacgttta tcacacacgt tgtttttacc tgaaacccgc gcagcccgtg
    51001 gacgcgacaa aaaaccgcgg cactagaaag aaaatgaaac aagtatgttt attaagcagc
    51061 atgtggggct aatagggggg ataactgagg tatagcaact atgaaaaaat actacaaaaa
    51121 aaaaaagctg aacatggtca tctagcagca aagttctcct tctagaccac gaccaccatc
    51181 tgtaccacgt cgccctcccc ggccgtgtac atcacatcct tcaccacgac cggcggcaac
    51241 ggcggcgacg aggacaactc gctctcgacg gaggccggga cgacagagga cgggggggtg
    51301 gtggcggcgg aggacggagg ggtggcggcg gcagcggggt cttcttccga cacgggcgac
    51361 ggcaggctcg gcggcgcgga cagcacccgt tgcgccgggg cgtgagaagg ctgagccccg
    51421 gtggcctgga tgtgggccaa cgaattggct cgcagcgagt cgcgatccac gaaggtcata
    51481 ggaattttcc cttcgcggat ccgccgctca gattccagga tggcgcgcac gtagctgttc
    51541 accgacttgg caaaagtgcg cggcccctcc gtattcttgt cgcgacgcgc ttccagcacc
    51601 tgcttttcgt agtccagctg gtggaagacc atcaccaggt cgtccatagt gtgcgcgtgc
    51661 tgacggacgt gggagcgcac ctccaccggg aacaaagcgt tccaatactc cagcacgatg
    51721 gcaccgtgcc agaactgcgc catgctgggc gccaggaaaa acaggatacc ggagtcgtag
    51781 ccgaacacgt cccacttggg cgtcatgaac aacaccagct gacgcgtggg ccgcatcgaa
    51841 gcttcctccc aggcctcgat gaccccgaac atgatgagct cctggtccaa cggggggcag
    51901 tgtcgctcca gccaactgat cttactcagg ttcatctgca gaaactcgta agaggggtcg
    51961 cagatgcaca cgtagagacc cgagtcgtgc cgcagcctgg ctccgcgctt catcagtttc
    52021 ctcaccgcgt agcgaagcgc caccttgccc aacgccgacg cctggatcag tccccccacg
    52081 tccatctgcg tctgtcgcca ctcggcctcg tccagcaggc tcatgatagc ggcggtgcta
    52141 tgcgtggccg tagtcatcct ttctatcctt ctctatgaat agcagcaata gcggtaaagt
    52201 cccttcttat actatcccgg agtctgtggt tttttttgtt tacccctgct tactggtgag
    52261 actgctgggg gccgttgtgc tgcagcagct gagctcgtcg ccgccgttgc cacaggaacc
    52321 ggtgcctccg cagggccttt ttgagggcct cgcaggcttc tcgcgcaagt cctgagaggc
    52381 cctcggcgtc gatggggttc acctcgggcg tccgagcctc gttttcttct tcttcatcct
    52441 ccctttcctc ctccgtgtcc tcccgctctg tgtcctccgt tacgctctcc tccccggcct
    52501 cggccaagag cgcggccacc aagtccacgg accgctcggt ctccgagttc tcaccgtcaa
    52561 ttacgccatg ttggcggcgt aaccggtgcc gagaacgccg ggtgagcgca catgcttttt
    52621 tccttcttaa ccaaggcggg agaggatctt caaggcgttt tcgctggatc cagcggtagc
    52681 taaagtacca aaaggccagc aggcccacgc tacctaacag attcacgtag actggagaca
    52741 taattaaaga aagaagtgaa acccgcgtgt gggtctcacg tcgtcttgaa acaccgtctt
    52801 atatacatga agatgccgga catgacgcgc ccaagacacg tggggttttc cccttaggcg
    52861 acccggtttc ttaagatgtt tttcatcttc gcacgcgatg tactacatca aagggtcggc
    52921 tgaccgaccg cattgacgca gtttccgagt acacgcgtct cggagcacct gacggtgagc
    52981 cacccaactc acgcggatag gggacaacac tgacgtgagg ggcgattcac gtcactgacg
    53041 gctgacggga ataggacggg tgaggaattt ccaccttttt cttaagtgtg actctcctta
    53101 cggtaaatcg cacctgtgac ctcttaaccc ctcctccctg gtacccgata acagtgaaaa
    53161 acacacacca cacgtcacga caccgatcga ttttctttat tcttagtgtg atgataggta
    53221 agggcactcg tgaggatgtg caattatcat tatcaagcct ttttcaaggc gtagtgatga
    53281 tcgttgggta aaacccccag gctcctagcg atctgggaat agaaggagga gaacgagccc
    53341 agggccagaa tgcccacagt gtacatggcc caggtctcca gaccgaacgt ggcgggccgc
    53401 agcttcagat gataggccac ccgctccgag agttgtgaat gctcgttcag gcaacaggac
    53461 tgcaggtggg tgagcccaaa agcgctttcg tttacgccgc gcacgtgcac cgtctgggcc
    53521 gggcattcct ggtgttgcgc gcgaaaatga tcctgacagg agattccgtc tacgtggcgg
    53581 cgcgtgttgt tacccacttc gatcagcaac gtgttatcgg caggatgatg cgagaacgcg
    53641 acgacggtgt tgctggaggt ctggcggcag cagtacacgt cgagcgtcat gagggccatg
    53701 tcgccttggt ggtacacggc gtacgcccaa ccctggaaca cgagcggaca ttgcggaccg
    53761 tgagcggaca tcgcgccggc ggttgttacc gtcgtctcgg caggagaaga caataaactc
    53821 ctgatcctca tacacaggag tccaagcgtc agaactaaag tccgcggagc cataaccgcg
    53881 caagtgaagc cgatacgagt gttgctgaat ttgttcattc tgccgactgt tgctcacgag
    53941 cgttcggagg cggtgccaca ggctgttggc cattaaaaag tcctggcccg aatgacgacg
    54001 agacagagcc cgaggcgaag aaaaaggcgc ccgtcatgaa gacgtaggca ggggaattcc
    54061 catattttta tggcttcttt taaaagtctg tatccgactc catccggcgc ttttcccaaa
    54121 ccgtggtctc ctcgtcgtcc gactcggtac ccaggaggtg gtaagtcttt tgccgcacgt
    54181 agaaagcttt caacgtggag caaaaaatga gaataaagac cccgaaaacg aaacaaacca
    54241 cgccgatcat gccgatgcag acgttcatgt cgacgtagcc ggcggtgctg ttggcggtgc
    54301 ggcaaaagag tgtcatgtcg tgcgtgcaca aaaaacaaca cacaccacag gccaggtcgt
    54361 agcgtagtta ttattccgta gcagcaatga tggtacagtc aagcacatgc tctatttccc
    54421 gttaccccga tgatgtaccc gttgtagtgg aattgtcccg gttaatcacc acggtgaaca
    54481 ccacggccaa gaaaatgatc cctaatatag caaccactaa gagagcaaaa gtccatttcc
    54541 agccgttgtc aaagtacgcc cccgtggtgg gatgcatggt ggcgggcatt tccatcatat
    54601 ccatgtcgaa cgtgtgtcgc ggcgacggcg aactaaccag gcagtacggg ggtcgatagg
    54661 gcggtgggct gcagtcgggt ggtggcggcg gtggcgtgga aaccgtcgtc gggcacagac
    54721 ccatggcctg ctcgtaggtg gggggcgcgt cgtcgtgatc ccggtcgcgg agcatcggcg
    54781 tgggctccat gtcggtggca gtgacggcga cggtggtaac tgtggtggag acggtaccga
    54841 cggcgtccgc ggctcacctt cgagcaaaga gccccttctt tttgcgcaaa cgacggcaaa
    54901 acagttctct gggacagccg gtggcgcggt aagcgggtgc cacgctttca gggtgggtaa
    54961 aacagtcgcg ggcgaagcag tagttgttgc agaaccgcaa gaacccgacg cgaaagaagc
    55021 ccaggagtcc gcgcgccaga aagtgcgcct gccgcgtctc gggatgcacg ccgaagacgg
    55081 cgccgctctc gttcaccagt atggagatgt ccaggcgctg ctgcgactcc accggcacgg
    55141 cccgcaccac aaatacctgc agcacgttca gcgagcacgt ctcttttaac cagttgccgt
    55201 gggccggatc ctcgtaagtc tggctcccgt tcaagacgac cgtcgtcagc gcctcattac
    55261 cgtctcgcca gctgaagatg gaaccctcgc gcttcatgca caggcgccac agggccagca
    55321 ggtcgcgcgc caacatgaac tcgcgaccca cgtcgccgcc ggtctcgaag cgaacatagc
    55381 ccagttcttc gcgcagcggc gcgtagttgc gcaggccctc ctgcacgaag ccgcggaaac
    55441 cggaccgcga caccaggtac agcgattcca ccacgggcga gtagacgtag acgcggccgc
    55501 cctcgccgat gagtacgggt agcggtgggc ggccgatggc ttcgcaacga ctcacagtgc
    55561 ccaccggcag caggaacttg tcgcagcaca ggaaggtctt ctccaaacct ttaatattga
    55621 gatgtccaaa gtagccgacg cgtaacaggt cgcagtaggt gaaaaaccaa ccgttcggcc
    55681 agctgagacg cagcaccgtg ccgctgacgc gacgaaccag cttctgcagg tccttgcggg
    55741 cgtcggcggt gacagagcag cggaaggtct cgttgaccag ctcgacagcc agcgcgtcct
    55801 ccagcgtacg ttccttcatc tcgtcgttga tgctctggcg gcgccgccgg atttcgtcga
    55861 aacgggccgc ggaggcggcg accgacgcgg aggtcgtccg aacgccctct gtgacgctgt
    55921 cgtccggcca gtcaagaaag ctaaggctgg cgctgcgccg cctaaagtgt ccgatccgcg
    55981 cgggacgtcg ctgagggacg gtggctggtc tgctgggacg ggtacggccg cgggtgtccg
    56041 cggacacgtt agttatacac ggaattgagt cacgtggcac gttgccagct gaaaccgccg
    56101 tcgtctccgc cggcgttttc tccatcacgg gaccgcgccg tgcgcgcgtt cccaggcacg
    56161 cggcccacgc tctacccgca cttttgcttc ttggtgttag ggacgaactc gaacgttaca
    56221 gaatcctcgc tgtcgctctc ctctttcgcg tcgttgaagt aattgccgga gttgcgatcc
    56281 aaaccgccgc ctcctcctcc tccgccgccg cccgatccac ctttggacgt caggtagctg
    56341 gtgatcttgt gctgctcgta tttttccttg gaggaaagac cgtggtcgtg atcaccgccg
    56401 ccgccaccgc tgctcatttt ccgcgtaccg gaaccaccgc caccaccgcg gtcgtgcttc
    56461 ttgccgccac cgccgccacc tcctcccaga ccgccgagac ccatgggctc gttcatgaga
    56521 tcattatcca gacccgggcc gtcgtcgtgc agaccgccgg cattggccag cgaagagagg
    56581 ctgccgccac caccgccgcc gccacgcgac ttgccgctgt tcccgacgta atttttatcg
    56641 aagggatcgc cacgctggaa aggttcctcg gtgagaaaat tctccacggc gaacagaccg
    56701 ttgcgactgg ccacgtacaa cagcgtgtcg tgctccgtaa ctatacgcaa cgtgcacggc
    56761 agtttggtga cggcgcaatt gagcagcgtc tgatagaagt tcttcagctg cacgttgata
    56821 cgcatgtttt ttacgccgtg gaaactgacg cggttattgg ccgtgaattc cagctcgctg
    56881 ccgttggtca ggataaactt gatggccggt ggaccggcgt gcaccagaat ctgcacggtg
    56941 cccgtagggc agggcgcttt tttaacgtta cgcttgacgc gggtatgcgg cccgatccac
    57001 ttaagcaggt cggccaccac gccgaaatct agatccacgt gcacggccga attctcgctt
    57061 tcgcgcacaa tgtcttggcc gtgcacgcag gccgagctga actccatatt gaaatcgggc
    57121 gcgcacatgg agatcttggc cgaaaggtcc gagatgtcct gcacgtagaa cttggtcagg
    57181 tccttgctgg aagtcaggta catgaaatta ccgagcagcg gcgtggaatt gttaatggtc
    57241 ttgggctgaa acgacttgtc agtgatgtag aggcatgagc tgttaaaagt gatttttgac
    57301 acgcagtgac tgcgtaccgt ttgcaagata agcgacggcg tgggcaagaa ggtaaccgtg
    57361 gtgttctcct tgagcgcacg gatcacagat cgcagctgct ggatagccgt cttgtacggc
    57421 ttcagccgca gcgccagcgt cggcggctcc gagaggcgcg tcttgcgatc catcccggac
    57481 agcgtgcaag tctcgactaa ggagcgggcg cgagcgagcg aaagttttat agagagcaca
    57541 cacgacgacc gggaacgctg cgaagacgcc cggcgtctaa taatacagcc gcgccgagcc
    57601 agcgggcccc cgactaagag gcacagtact tatatactcc gaccttaaag cgccagtggt
    57661 accacttgag catcctggcc agaagcacgt cgggcgtcat ccccgagtca tagtagaaaa
    57721 ccagggccac gcactggtcc acaaacacgc tcaggttcac agccgccatt tccacgtcgt
    57781 tttggatcgc cggcgccgcc tggaacagac actgcgtcgc cttgccctcc tcctggtgct
    57841 gctccaacca cgcgtaattc accacgggca cgcgcagcgg cctccgcacc acggtgggga
    57901 agtaacactc acggttgggc gggcacaatg accacaccgt ctcctcctcg aacacggtgc
    57961 cgcgcgaagc ccacactgac ggcgtcacgc cccacagatg cgccacctcg tcgtcgggac
    58021 ccaccgccag aaactgacag ttgcgcaatc cgaactcgag catgtcggcg cgcagcgctt
    58081 cccagcgcgc gctggcgata gagagccgcg gcaaccgata caattcgaaa atgaatttgc
    58141 cctcttgata gatggtgcgt tcgaaccact cgcagcgcgg caaacccgac ttgcacaaat
    58201 cgacgctagc gcgcaccgcg gcaaagtaca tgtgctcaaa gatgcgctcg atcaagtccc
    58261 aagaggcaaa gtacgtgaac cctaaccgca tgagcgccgt gtgcaagccg gccacgccga
    58321 tgtgcagcgg acgcagtttt tccagcgcgc tctctaccca ccattccgac gctgacatta
    58381 gcgcgtccag gcgcgcgttg ccccaaacca ccgcctcggt caccaactcg cgcagcacgc
    58441 tcaaatcaaa gtaacgtcgc gtgttcccca aaaccacgtc gggtagatgc agcttctgct
    58501 cgtcgctacg cgcaaacacg cagcgagcca cgttcaccgt cagccgctgc accggcatgt
    58561 cacactcgcc aaagtggcac gacgccatat cgggactcaa gcacggcggc aggcacacgc
    58621 tgtcggccat aatcgagtac ttgactacgt gatggacaaa gaccaccgag gcacggccct
    58681 tgagcgcgca cagcaacatc tttttcagaa aatcgtccgt gttcaccacc accttggggc
    58741 acgattgctc gcagcgcgaa tattctttct cgaaagccga ctcctgaccc aggtccgaga
    58801 gccgccggga gacaggccgc ccgaacagcg agtagcgctg ctcacgcgca cggtagcgct
    58861 tcattaacac gctaggcacg ttgaaagcgt agcaaacccc cgtcaactcc gacgtgcttt
    58921 ctttgagaat aaagttaatc acgcggatag cggccacgtc ccacatgtcc acaaacacac
    58981 gtaccacggg tcgatgcacc tccttctcgc gtatcaaatc gcagtatccc cccaggcaac
    59041 gaatcacgct gttcacatcg gcgttaagtc gcgttacgtt caccgacaca gaaacaccgc
    59101 aactcaaggt gctcatccat ttgcacatgg ccgcccaact ggcgtcacgc gaaaaagggt
    59161 cggccgagat cagaaagtca tactgcggca cgcgatcaaa acccacggta gacatggtga
    59221 aggtggacag cgacagctgc ccatcgcgac agcgcttcaa caccgattcc aacacctcgc
    59281 cctcgaaacg cgcatccaaa tggaaacgat agatacgcga gtgcctactg ttctcgatag
    59341 cggccgtcaa cgccacggcg atgcgcaaaa acacgccgcc cgggctctcg tcctgtccgt
    59401 gcagttggcg gcacacctta tccaaacaca aaatggccgc gtacaaaccc cagcaaccag
    59461 ccaattccac aaaacgcgcc gtctcctcgg ccagcttggg tagatcctcc atgtgacgca
    59521 gcacaaaacg acgcaccgac tcatcgcaca gctccgaagc gtaacacagt ggcgtgcggc
    59581 tttcacgcgc caagttggct ttgaaataaa agcgacccaa cagcagatcg caacgcggcg
    59641 agtgacgaat cagacaggga ccgtggcgca tgatgagctg aaacagcctg aaactgccca
    59701 aaccggcact gtgccgcgac acggtgtcca tctcgcgcca cagcgcgttc ctgtcggacg
    59761 gcagctcccg cgccggctcc tgtacgccgc aaaagcgaaa cttgccccaa tagccgtgac
    59821 aatgacactt tttgcccatc aacatgcgcg tagcctgtat cggcggcgac actttgcaga
    59881 gcgaagctcc gaaatcgtcc tcctcctcaa cactgtccag ctccattctg gtcgcgccgg
    59941 ccggattgaa ggtgctcaga ccgctactca cgcgtccacc gcgactgggc acggcgggac
    60001 cgctgtcacg cgtcaacgac agcacagacg gcgtgccgtc gggagacggc gactcgggac
    60061 gccaactgac gacgccgcca ccactcgtaa agcccgctac acacgctacg ccgctcgata
    60121 cgttggtatt tccagcggac gcttccttgt cacccccggg cagcggcccc tcctcgagct
    60181 cgctgtcatc tcccccggta gtatcagcgg cggcctctgc cgacgattcc tccgtctcgg
    60241 tttccgagcc gcggcttgga atcctacctg gccggcaccg atgtgcgggc accgaggaca
    60301 cccgctgttc ctcgtccgcg tcagccggat tcataagttt acgaggaaaa taacaaagaa
    60361 atcaggtaga tttcaataaa gtgagtctag atggcgccga taactacggt ttataaagtc
    60421 tgtgtgcgat gtgtttattt ttttcttctg tgtctcctcc ccgtatgctg tcagcgccgc
    60481 tcagacgaat tctcgaaagt ctcccaattc gacgctaaag ttgtccaaac ggacgacgga
    60541 cagtttgagt tctttgtgta ccaggaacga ggtgtgaatg tcgtcagcca ggcaccagcc
    60601 cagcttttgt atgaccccgg tacacagagg gatctggcgc gggcgcgtga tgcgacggtt
    60661 gacaaagcta cagcgctcgc gggcgaactt tccgcgtgca acgtcgacca gggtctgcca
    60721 gtgtgcgatg ctggaggtga gcacgtagat gccgggacgt gtttcgggcc cgtcatagtc
    60781 atagacgatg attaaataca cgtattgcag ccgtccccgg gtctcttccc acgtcaggta
    60841 catgtctttc ggtatcatca acgcgaacac ctccgttttg agcgtgttgt aaaggtagcc
    60901 gcgcatgacg caggtgagca acgaggtgat gcccagcgag acggtcttga cgcagcccag
    60961 cgtctcgagg cggcggtgca gcagatgcgg gcccaggtcc agccactgca gcgcggcgcg
    61021 cgcggccgag gccgtgtaca cgctttcgag caggcagcgc gtgctggccg agacgttgga
    61081 ggcgcgaatg cctaacaggt agaggctgat gtagaggtgt cgcggcgagt cgcaacccgt
    61141 ctccatgcgg atgagcagcg cgcccggctg cgcctcgaac tctaccaggc cctcgggcac
    61201 gaagaaacgc gccgtgagcg cctggtgatc ggcgtggtag aggtagcgca ccgatatagt
    61261 atttacctcg cgtttggctt tgagcgccgt cactagttca ttgtcctcgt cggccgggtc
    61321 gcgcggccgt ttggccaccg cgcgcgcgtc catgatggcg aggcgcacgg tagatttcaa
    61381 aaagttgata gagcagctgc gggcacgggc cacggacaaa gcggaggcgt taaataccgt
    61441 gagccaattg gagatcggcg cggtggatgc ccaggacgtg accgcgagcg ccgtgcgcgc
    61501 cttcgtgggt gcgttgccga gctcgggcta ccactttggc ttcgtgcgtc agaacgtggt
    61561 cttttacctc ctaagccacg ccacggtaca gacggcgcgc gacccactgt acgccgccga
    61621 gcagttgcac gaacagctgg accgcttcct acgacaccag cacgacggcg gcggggacga
    61681 ggaccggttg ccgttctacc acaacggggc cacgctgacg gctttccaga agctgttgca
    61741 gaccctgcgc gagatccaga ccgtaatagc cgaacagagc ggcggcgccg cggcggcggc
    61801 ggacttgatc gccagtaaca acgcgtcggc tgagcgccgc ggcaagaagg gcggttcgag
    61861 ttccgggggc cagcagccgc tggtccgccg ggtgatcacg cagctggaaa cggctgtcac
    61921 ggaggcgcgg ccctacgtca attgtcgcgc cgtggccgaa ctcctggacc tgacctacca
    61981 gcggctcatc tactgggcct gcacgctcat gccctacgtg ttgtttcggc gcgacaccga
    62041 caccgaactg gacacggtgc ttctgatgca ttttttttac acacactacc gttcggttaa
    62101 cggcgatttg gccgtggagt ttcaaaacta cgtcaagaac agcgtgcggc acatgagctc
    62161 tttcgtcagt tccgatatcg acggcgacca gaagcccggt gccgaacaca tgcgtgacgt
    62221 cagctacaaa ctgttcgtgg gtaatctgca ggcgcgtgac gccagcggcc tcatgtttcc
    62281 catcattagc acgcgcatct ccaccgtgaa cctttacctg tcgcccgaac gtatgttttt
    62341 ccacccgggt ctgatctcgc gtctattgag tgaggaagtt tcgccgcgcg ccaacctaga
    62401 cgcttacgcg cgcgtgtgcg atcgcgtgct ggaagaccac ttgcatacgc cgcgacgcgt
    62461 gcagcggcta ctggatctga cacagatggt aacgcgactg gtggaactgg gtttcaatca
    62521 cgatacctgc gcggcctacg cacaaatggc gctgatccag ccggccagtc agaagagctc
    62581 gctctttgtc agcgagattc gcgagaaact catacagatc atctacaatt tttacacgtt
    62641 tttcatgtgc ctctatgtgt acagccccac gttcctgttc gaccaccggc ggcggttgat
    62701 tttggagcag catcgatcca cgttgatcgg ctccaaggag gaactacagc acgtctggag
    62761 caacgtgaca ctgaacgtca atacgcactt tgcggttcag tacacggaag aagactttga
    62821 ggcacatacg aagggtgcca cggaggcgga gcgcgagtac ctgtatcggg acctgcacag
    62881 caagtggggc gtgcacctgt ttaccttgcg tccgtctcgc ggcgcggccg gcgcggcctc
    62941 gcctttgcct ccgcttgacg gcgtcacacg ctccgacatc ttacgcgaat gcgcgctcgt
    63001 taatctgaac gaaggccgcg tcaactacgc ctccctgcta gccttcagcc atcatcccga
    63061 gttccccagc atcttcgcgc agttggtggt ggtaactgaa ttttcggaga tctttggtat
    63121 cccgcagggc ctgtttcaag ccgtgggttc gccgcgtctt ttcgcgctca ttcagctgtg
    63181 tcgtgtattg ttgcccgagc aggtgacgct gtaccagaac ctggtctcca tctacaacct
    63241 gaccaccttt gtcaagcaca tcgacgccgc ggtttttaag acggtacgcg attgcgtctt
    63301 cgacatcgcc acgaccctcg agcacctcag cggtgtaccc gtcacgccca atgtggacct
    63361 gctggccgag ctcatggcgc gctccgtagc gcataacctg tacaccaccg tcaacccgct
    63421 gatcgaggac gtgatgcgca gcagcgccgg cagtctgaga aactatctgc gacacacgcg
    63481 actttgtttc ggtctggcgc gcggccgggc gcgcctctcg gaggacggcg tgacggtgta
    63541 cgtggaggta cagggtcagt acggactgcg cgtaccaacc acgcgtttcg tagaacagtt
    63601 gcgcgagctg gttcgccgcg atcggctgtt ggccgagaat ctgcgcggct tgaacgagcg
    63661 cctgctgagt gttcgcgtgc gcgtacgtca gatcagcagc gacacagagg aagtaagccg
    63721 acacgccaag ggtcaccgca cggtggccca gatgagcaag gcgctcaaaa agacggcctc
    63781 caaaatcaaa gtgttggaaa cgcgcgtgac cttggcgctc gagcaggcgc aacgttccaa
    63841 tggcgccgtc gttaccgcgg tgcagcgcgc gctagccgtc tttgacgtac taagtcgcga
    63901 gaacttggaa cgccgcggcg cacagctctg tctgacggag gcgacgagcc tgctgcaccg
    63961 acatcgcgcg ctagcgccga tgacctggcc cgcgggcacg ggcgttgcgg cggcggccga
    64021 ggcggatcgc gccttacgcg agttcttgga ggcgccctgg gaatcggcgc cccaaccgcc
    64081 gcgactccgc atgacgcccg acaccgatca cgaagaatcg acggcgggcg cgacgtccgt
    64141 accggaggtc ctgggtgcgc gctacgaacc cacacacctg gccgcgagcg acctattaaa
    64201 ctggtacatc gtccccgtaa gccaggcgca gcaggacatc ttgtcttcga tcgacccgcc
    64261 cgccggctcg acatcggtgt ccctgccgcc ggcctcgcca tgaaagtcac gcaggccagc
    64321 tgccaccagg gcgacatcgc ccgctttgga gcgcgagcgg gcaatcaatg cgtctgcaac
    64381 ggcatcatgt tcctacacgc cttgcacctg ggtggaacga gcgccgtcct gcagaccgag
    64441 gcgctggacg ccatcatgga agagggcgcg cgtctggacg cgcggctaga gcgcgagttg
    64501 caaaagaagc tgcccgccgg cgggcggctg ccggtctacc gactgggcga cgaagtgccg
    64561 cgccgcctgg agtcgcggtt tggccggacc gtgcacgcgc tctcgcggcc cttcaacggc
    64621 accaccgaga cgtgcgacct ggacggctac atgtgtccgg gcatcttcga ctttctgcgg
    64681 tacgcgcacg ccaaaccgcg tcccacctac gtactcgtca ccgtcaactc gtcggcgcgc
    64741 gccgtggtct tcaccgagga ccacatgttg gtctttgatc cgcacagctc cgcggaatgt
    64801 cacaatgccg ccgtgtatca ctgcgagggt ctccatcagg tgctgatggt gctcacgggc
    64861 ttcggcgtgc agctatcgcc cgctttctac tatgaggccc tttttctcta catgctggat
    64921 gtggcgaccg taccagaggc tgagatcgcc gcgcgtttgg tctccaccta tcgcgaccgc
    64981 gatatcgacc tcaccggcgt cgtccgagaa agcgtggaca cggcggcgac aacgaccacc
    65041 gccgcacctt ccttacctcc gctgcccgac cccatcgtcg acccgggctg ccctcctggc
    65101 gtggcgccca gcattcccgt ctacgatccc tcgtcctcac ccaaaaaaac acccgagaaa
    65161 cgccgcaagg acctcagcgg tagcaaacac ggaggcaaaa agaaaccccc gtccacgacg
    65221 tccaaaacac tggccaccgc ctcctcctcc tccccctcag cgatagcggc ggcctcttct
    65281 tcgtccacgg taccaccgtc ctacagctgc ggcgaagggg ccctgccggc cctgggccgc
    65341 taccaacagc tggtcgacga ggtagagcag gagttgaagg ctctgacgct gccgccgttg
    65401 cctgccaaca ccagcgcctg gacgttgcac gcggcgggta ccgaaaacgg cgctaacgcg
    65461 gcaacggcca cggcgccgtc cttcgacgaa gctttcctca ccgatcgtct ccagcagctc
    65521 atcatccatg ccgtcaatca acgctcgtgt ctgcgtcgcc cctgcggccc gcaatcggcg
    65581 gcgcaacagg cggtacgcgc ctatctgggc ctatccaaga aactggatgc ctttctgctc
    65641 aactggctgc accacggcct ggatctgcgg cgcatgcacg actacctgag ccacaagacc
    65701 accaaagaca cgtactcgat gctggatcgc gcgctgctgg agaagatgca agtcgtcttc
    65761 gatccctacg gacgccagca tggcccggcg ctcatcgcct gggtggagga gatgctgcgc
    65821 tacgtggaga gcaaacccac taacgaacta tctcaacgac tgcaacgttt cgtaaccaag
    65881 cgaccgatgc ctgttagcga cagcttcatc tgcctgcgac ccgtagactt tcagcgtctg
    65941 acgcaggtca tcgaacagcg acgtcgggtg ttgcaacgtc aacgcgaaga gtaccacggc
    66001 gtttacgagc acttggccgg tctcatcacc agcatcgaca ttcacgacct ggacgccagc
    66061 gacctgaacc gacgcgaaat tctgaaagcg ctgcagccgt tggacgacaa cgccaagcag
    66121 gaactctttc gcctgggcaa cgccaaaatg ctagagttgc agatggacct ggaccgtctg
    66181 agcacgcagc tgctgacgcg cgtgcacaat cacattctca acggcttttt gccggtagag
    66241 gacctgaagc agatggaacg cgtcgtcgag caggtactga gactctttta cgacctgcgc
    66301 gacctgaaac tgtgtgacgg cagctacgaa gagggcttcg tcgtcatacg cgaacaactg
    66361 agctacctca tgacgggcac cgtgcgcgac aacgtaccgc tactgcaaga gatcctgcag
    66421 ctgcgacacg cgtaccagca agccacgcag caaaacgagg gtcgcctcac gcagatccac
    66481 gacctgcttc atgtcatcga gacgctggtg cgcgatccgg gcagccgcgg ctcggcgctc
    66541 acactggcct tggtacagga gcagctagcg cagctggaag cactaggcgg cctgcagcta
    66601 cccgaagtgc agcagcgcct acagaacgcg caactcgcgc taagccgcct ctacgaagag
    66661 gaagaggaaa cgcagcgttt cctcgacgga ctttcgtacg acgatccgcc caccgaacag
    66721 accatcaagc gacacccaca attacgcgag atgttacgtc gcgacgaaca gacgcgtctg
    66781 cgactcatca acgccgtact gagcatgttc cacacattag tgatgcgact ggcgcgcgac
    66841 gagtcgccgc gaccgacgtt ttttgacgcc gtcagtctgt tgttgcagca actgccaccc
    66901 gactcgcatg aacgtgagga tctgcgtgcc gccaacgcca cgtacgcgca gatggtcaag
    66961 aaactggagc agatcgagaa agccggtacc ggcgcatccg aaaaacgctt ccaagcgtta
    67021 cgagagttgg tttacttttt ccgtaaccat gaatatttct ttcaacatat ggtcggacga
    67081 ctgggcgtcg gacctcaggt gacggaactc tatgagcggt atcaacacga gatggaagaa
    67141 cagcacctgg aacggctaga acgtgaatgg caagaagagg ccggcaagct cacggtaact
    67201 tctgtggagg acgtacagcg tgtcttggcc cgggcaccga gccatcgtgt catgcatcaa
    67261 atgcaacaaa cgttaaccac caagatgcaa gactttttag acaaggagaa acgtaaacag
    67321 gaagaacagc aacggcagct actggacggc taccaaaaaa aggtgcagca ggatttgcaa
    67381 cgcgtggtgg acgccgttaa gggcgagatg ctctccacta tcccgcacca accactggag
    67441 gccacactcg agctgctctt gggcctagat caacgcgccc aaccgctact ggacaagttc
    67501 aaccaggact tgctgtcggc gctgcagcag ctgagcaaaa aactagacgg gcgaatcaac
    67561 gagtgtctgc acggcgtgct gacgggtgat gtggagcggc gctgtcaccc gcaccgagaa
    67621 gcggctatgc aaacccaagc ctcgctaaac cacttggacc aaattttggg tccgcaactc
    67681 ctgatccatg agacgcagca agccctgcaa cacgccgtcc atcaagcgca gttcatcgag
    67741 aagtgtcaac agggcgatcc aactacagcc atcacgggca gcgagttcga gggcgacttt
    67801 gtacgctacc gcagcagtca acagaagatg gagggacagt tacaagagac tagacaacag
    67861 atgaccgaga ctagcgagcg gctggatcgc tcgctgcgcc aggatcccgg gagcagctcc
    67921 gtcacgcgtg tacccgagaa acccttcaag ggtcaggagc tggcgggtcg aatcacgccc
    67981 ccgcccgccg acttccagcg gcccgtcttc aaaacgctgc tagatcagca ggccgacgcg
    68041 gcccggaaag cgctcagcga cgaggccgat ctgctgaatc agaaagtaca gacgcagttg
    68101 cgacaacgcg acgagcagct gagcacggcg cagaacctgt ggactgatct ggtcacgcgc
    68161 cacaaaatga gcggcggact ggacgtgacc acccccgacg ccaaggcgct gatggaaaag
    68221 ccgctggaga cacttcgcga gctgttgggc aaagccacgc aacaactgcc gtacctgtcg
    68281 gcggagcgca cggtgcgctg gatgctggcc tttctggagg aagcccttgc gcaaatcacc
    68341 acggacccta cgcacccgca tcacggaagc aggacccact accggaacct gcaacagcaa
    68401 gctgtcgaga gcgccgtgac gctagcgcat caaatcgaac aaaacgcggc ctgtgaaaat
    68461 tttattgcac agcatcaaga ggcaactgcc aacggcgcgt ccacgccgcg ggtcgacatg
    68521 gtccaggcgg tggaagcggt ctggcagcga ctggaacccg gacgcgtagc cggcggcgcc
    68581 gcgcgtcatc aaaaagtgca ggaactgttg cagcgcttgg gtcagacgct aggcgaccta
    68641 gaactgcagg aaacgttggc gacggaatac tttgcgctgt tacacggcat ccagaccttc
    68701 agctacgggc tggactttcg gtcgcagttg gaaaagatcc gcgacctgcg gactcgtttt
    68761 gcggaactgg ccaagcaacg cggtacacgt ctctccaacg agggagccct gcccaaccca
    68821 cggaaaccgc aggcgacgac ttcgctgggc gcctttacac gcgggttgaa cgcactggaa
    68881 cgacacgtcc agctgggtca ccagtatctg ctcaacaagc tcaacggctc atcgctagtc
    68941 tataggctgg aagacattcc tagcgtgctt ccgccaacac acgagaccga ccccgcgctg
    69001 atcatgcgcg accgcctgcg tcgtctatgc ttcgcgcgtc accacgacac cttccttgaa
    69061 gtggtagacg tcttcggcat gcggcaaatc gtcacgcagg ccggcgagcc cattcacctg
    69121 gtcaccgatt acggcaacgt agcctttaag tacttggcgc tgcgagacga tggccgaccc
    69181 ctggcatggc ggcgccgctg tagcggcgga ggactcaaga acgtcgtcac cacacgttat
    69241 aaagccatca cggtagccgt ggccgtctgt cagacattgc gcactttctg gccgcagatc
    69301 tcgcagtacg acctacgacc ctacctcacg cagcatcaga gccacacaca ccccgcggag
    69361 actcacacgt tgcataacct taagctcttt tgttatctgg tgagcaccgc ctggcaccag
    69421 cgcatcgaca cgcagcagga gctgacggcc gccgatcgcg taggaagcgg cgagggtggt
    69481 gacgtagggg aacagagacc gggccgcggt accgtgctgc gcctaagtct gcaagagttt
    69541 tgtgtactca tagcagctct gtacccagag tacatctaca ccgtcctcaa gtacccggtg
    69601 caaatgtcac taccctccct cacagctcac ctacatcagg atgtgataca cgcggtagtc
    69661 aataacacac acaaaatgcc ccccgaccac ctccccgaac aggtcaaggc cttctgtatc
    69721 acccccaccc aatggcccgc catgcagctc aataaactgt tttgggaaaa taaactggta
    69781 cagcaactgt gccaggtagg cccgcaaaaa agcacaccgc ccttaggcaa gctatggctc
    69841 tacgccatgg ccacgctggt ctttccacaa gacatgctgc agtgtctgtg gctagaactg
    69901 aaaccccagt acgccgagac atacgcctcg gtgtccgaat tggtacagac gttgtttcag
    69961 attttcacgc aacaatgcga aatggtgacc gaggggtaca cgcaaccgca gctccccact
    70021 ggagagccgg tgcttcagat gatccgcgtg cgacgtcagg acacaaccac cacagacaca
    70081 aacacgacca cggagccggg acttttagat gtttttattc aaacagaaac cgccctagac
    70141 tacgcgctgg gctcctggct tttcggcata cccgtgtgtc tcggcgtgca tgtagccgac
    70201 ctgctgaaag gtcaacgtat actagtagcg cgccacctcg aatacacgtc gcgagaccgc
    70261 gacttcctcc gcatccaacg ctcccgggat ctcaatctca gtcaactgct ccaggacacg
    70321 tggaccgaaa cgccgctgga gcactgctgg ctacaagccc aaatcagacg gctacgcgat
    70381 tacctgcgtt tccccacccg cttagagttt attcccctag tcatttacaa cgcacaggac
    70441 cacaccgtcg tacgcgtgct gcgaccgccc tccacgttcg aacaggacca cagtcggctg
    70501 gtgttggacg aggccttccc caccttcccg ctgtatgacc aagatgataa ctcatccgcg
    70561 gacaacgtcg ctgcgtctgg cgccgctccg acaccgccgg tacctttcaa ccgcgtgcca
    70621 gtcaatattc agtttctgcg tgaaaacccg ccacccatcg cgcgagttca gcagccgccg
    70681 cgccgacatc gtcatcgagc ggccgcggcc gcagacgacg acggacagat agatcacgta
    70741 caagacgata catcaaggac agccgactct gcattagtct ctaccgcctt tggcgggtcc
    70801 gtctttcaag aaaaccgatt gggagaaaca ccactatgcc gagatgaact tgtggccgtg
    70861 gcgcccggcg ccgccagcac cagtttcgcc tcgccgccta tcacggtgct cacgcagaac
    70921 gtcctcagtg ctctagaaat actgcggcta gtgcgattgg acctgcgaca actggcgcaa
    70981 tccgtacagg acactattca acacatgcgg tttctctatc ttttgtaacc gacactgaca
    71041 gtagcgggta ataaaaacaa taggattttt atcgtttttt atgttacaaa acaacgtatc
    71101 actttcacgg tgatttattc ttgctattct ttttcccctt gggctgtcag cgccgggtgc
    71161 gcgacacggc taccatgcgc aacaggtcca gcttaaaggc gcacttgtcg ttaaacaggc
    71221 tggacatgcg cgtgtacttg ctcagcatgg tggccaacac cgggtgggtg gcctctgaga
    71281 tctcggtcgg cagctccaaa acgacgttga cgacgtgacg gtgtttttcg tcccgcttgt
    71341 tggccaccgt gggtcccggc gcggtgttag acatggggca ggccgtgggg ggaggacgag
    71401 gaggaagtcg ctgctaaacc gccgcgcgcc tgctgcacaa tgtggccgcc gacgtggcag
    71461 gcggtctgtt taaccagcgc gcagccccga cacagcgggg cgccgtcttc gctttccaaa
    71521 cagctgtcgc ggtactcgcc cgtctgacag cgcgcgcaca gcaggccgtg cccgtgcgaa
    71581 gtgaggcgca ggagacgcgg gaccgtcacg ccgcgtacca ccacagtgga gtcgcaggtg
    71641 cgtgccgcgc agggcagaat gacgtcgaaa gccagccggt gatcgtacac ggcacaagcc
    71701 gcgttgaggc ccagcacggc tttccagccc acgcgtacgc agcgctgtcc aaagagcgtc
    71761 tcggagacga gctcgtagac gcgctgccgc accacccgct gactgccgca gagcgagcag
    71821 tgcacgagct cggcgtgcgt gttgaagatg acgctctttt cttgacggtc ccgataatag
    71881 aacatcgagt tgagcggaaa gttttgctgg cagtgtagct tttccttacc caggttgagg
    71941 cagtgtccgc actgccgaca gaccacggcc accagcgagc gcgcgtccag atggcgctcg
    72001 cacttgagtc gacacagaca ccagagcggc aggtcgatga cgctgccgat gaggccgccg
    72061 cgcagcgcgg cgctgagtgc aaagaggacg atcttggtgg gctctacgtg acgcgcctgc
    72121 tgtccggcgc ccgcgtgtcc taccgccgca gctgccgccg tcgagcctcc tccgcgcgtc
    72181 tcgtcgtgca gacccagtgc ccgcaacggc accaggtatc gcggacacgt gtcgcaaaac
    72241 gtctgcaccg cttgtcgggc cagtacgtag agcgggtttc cgcagggtac cttcccggcg
    72301 tgccggcgca aggctgcgat gaggccccgc agctgcggcg accgcggctg ccgttggtga
    72361 caccactggt tacggtggta tacggccaaa tcagcgcggg cgtcgaagcg cttggcgcgt
    72421 agtagtgcta ggcacggcga gctggtgggg tgaagcacgg gcagccgaag gtccaccccg
    72481 aaaaggaatc ggtgaaggtc acctagcagc gaggaggtga caccgtccaa caacgcgtgc
    72541 agccgctcgg gcgggtagag ccgcagacgg cgcagcaggt agtcggtgtc gtagcgttcg
    72601 aaacgcagaa aggccatcgt gcggacggcc acggtgtgca gacagtccat gctgtagacg
    72661 taagcgagaa acacaaagta gggcttggtc ataaccatac gctgaaaaag cgccgtcacc
    72721 gcctcccgct cggcctgccg acacaccagc cattcgcgca ggaagcgttg gtagagacgg
    72781 tcgcccagct cgcgattcag aaagcgctta tccgtcacga agagatgaag gacgcaagaa
    72841 cgtggcacgt gatgcaccag ctgctgctgg aggaccgccg acgtctgcgc cgcaaactgc
    72901 gccggtggct gcgacgtttc taccgccgct tcctccggct gcagcgcacc gcggccgatc
    72961 accagctgca catggaaatg gtcctcgtga acgcagaggg gcgcgaagag acggcgcaga
    73021 gcctggtgga actcctcagt cgcggtgtgc ggagcgtgtc ggagacggcg attggccatg
    73081 accgcgccac agcagagcca gcaccagcag gagagccagc accagcgggc ccagagtcgc
    73141 aaagcgcgcg ggcagccacg gcccagactg cggtcgcgat ggcccggagc gcgctcgcca
    73201 ccacgatgac ggtgcccaac gataaccagt ccgctccaag gacggcgcgc acggcggaga
    73261 cggcggatga cggtgatggg tcgacacccc tcgccgacga ctcacgtgct cctccagagg
    73321 ccgacgcgcg gaccctccga catcctggcc cgccgctgcc gctgccgcct tcccttctcc
    73381 cgccagagcc agcaactcct cctcctcttc atcagcgtct ccctcgcttg cgcatccgca
    73441 tcgtcccata caggcctcac aacgacacag ccgccacgac cccgccgcca tgggtggcgg
    73501 cggcggccga ggcccggcag cggcgccgcc agcggcgacc atggtgggag agcaactcgg
    73561 atgacgagga ggaggaggag ggggagatgc ggtccgagag gaccgctttc ccgccgttcg
    73621 cgtgagcgcg gccgacatgc gggcgcgcca cagggacgga ccgctgccgc tgtgactgct
    73681 tacggtgacg tggttccgga ccgccaacga cgtcgacgcg gctttcttgg cgtacagctc
    73741 gcgcagcaga ttctcgtact cgccctcgtt ttcgggtccg aaggcgatga gctcgatgtt
    73801 gaagaccgac gccgaattgg atttgcgcac cacgcacttc gtcagcactc cgtaggccga
    73861 gggcttgatc tcctcgatgt ccttgagcgt gacgatgagc gactcgttca ccttaagcac
    73921 attgaactca cctacgtggc gcgccggcga gacgagcttg acgggcgctc gcacaaaaca
    73981 gcagagggag acggcacagc cagtgttttt aaagataaaa caaggcacgt ggtctgtgcg
    74041 gctctcccag tagctgagca gatactcgac acaatagacc gtgtctgtct tgagcatggc
    74101 gtcgcacacc gagtaattgg ggtttttaca gatgaggccg gcgtcggtga cgcgcagctc
    74161 gctgggaccc aacttgagga tacgccgcgt ggcctgcacc agatcctgat ggagaacctt
    74221 gttcatctcc atcgcaccga cgccaccgcc gatttattta cccggcgccg gctcgtcttt
    74281 tccctccagg attccgttaa tgtccatgag cttgctgacg atcgccgtta atagttgcgt
    74341 cttctcgcgg aggatctctc cgtgactgca ggtcgcgcag tcgccgtgca cgtacttgag
    74401 gaaggcggcg tacttctgac ccgcgttcac gaaatttaag cgcgcgtcca gagagggcag
    74461 caacagatcg tagacgcgcg gcagcatcgg ctcgaactgt aatagcagat cgtcgtcaag
    74521 atcgggtagc gcgtgcccgt cttcaccgtc ctcgtcgtca ccacctcccc cctcgagccc
    74581 accgctcgta ccagccgcgg gctccgcgtc ctcgtcgatc accagtggtc gcgtcggcac
    74641 cggagaatcc acgtcatcct gcacgtcgtt ttcctcctct ccgtcgtcat cgtccagaaa
    74701 cggcacccgc tgcttagccc aggacattct ttttccgcgt cctcaatcag cggcgccgat
    74761 cgccatgaat ccgagtaccc acgtgagcag taacggccca acgactcccc ctcacgggcc
    74821 ccacaccacg tttcttcccc cgaccagccc ggccccgtcc accagctccg tcgccgccgc
    74881 taccttgtgc agtccgcaac gacaggccgt ttcacgttac agcggctgga gcaccgagta
    74941 cacccagtgg cactcggact tgacaactga gctgctatgg cacgcgcacc cacgtcaagt
    75001 acctatggac gaagcgctgg ccgccgcggc ggccgcctca taccaggtga atcctcaaca
    75061 ccccgccaac cgttaccgtc attacgaatt ccagacgctc agcctcggca cctcggaggt
    75121 agacgaactg ctcaactgct gtgcggaaga aaccacgtgc ggcggcacgc aatccaccgt
    75181 actcaccaat gcgaccaaca ccactaactg cggcggagcc gtcgccggca gtagcaacgc
    75241 aggacccgcc ggcgcttcgg ccgcctgcga cctagatgca gaactggccg gcctcgaaac
    75301 ctcggcggcc gactttgaac aactgcggcg actgtgcgcg ccgctggcca tcgacacgcg
    75361 ctgtaaccta tgcgccatca tcagcatctg cctcaaacaa gactgcgacc agagctggct
    75421 cctcgagtac agcttgctgt gcttcaaatg cagttacgcg ccccgtgcag cgctcagcac
    75481 gctcatcatc atgtccgagt ttacgcatct gctgcagcag cacttttccg atctgcgcat
    75541 cgacgacctg ttccgacacc acgttctcac ggtcttcgat ttccacctgc acttcttcat
    75601 aaatcgttgc tttgaaaaac aagtgggcga cgcggttgat aacgagaatg tcaccctgaa
    75661 tcatctggcc gtggtgcggg ccatggtcat gggcgaagac acggtgcctt acaacaagcc
    75721 tcggcgccac ccgcaacaga agcaaaaaac caacccttat cacgtcgaag tgccgcaaga
    75781 actgatcgac aactttctag aacacagctc acctagccgc gaccgcttcg tgcagctgct
    75841 tttctatatg tgggccggca ccggcgtcat gagcaccacg ccactcacgg aactcacgca
    75901 cactaagttc gcgcgactag acgcgttatc cacggcctcg gaaagagaag acgcaaggat
    75961 gatgatagaa gaagaggagg atgaagaagg agaaaaagga ggagacgatc cgggccgtca
    76021 caacggcggt ggcaccagcg gggggttcag cgagagcacg ctaaaaaaaa acgtgggtcc
    76081 catttaccta tgtcccgtac ccgctttttt taccaagaac caaaccagta ccgtgtgtct
    76141 gctgtgcgaa ctcatggcct gctcctatta cgataacgtc gtcctgcgcg agctgtaccg
    76201 ccgcgtcgtc tcgtattgtc agaacaatgt gaagatggtg gaccgcattc agctggtatt
    76261 ggccgatctg ttgcgcgaat gcacgtcgcc gctcggcgcg gcacacgagg acgtggcgcg
    76321 ctgtggactc gaagcaccca cctcgcccgg aggcgactcg gactaccacg gcctgagcgg
    76381 cgtcgacggc gcactggcgc gacccgaccc ggtattttgc cacgtcctgc gtcaggcagg
    76441 cgtcacgggc atctacaagc actttttctg cgacccgcag tgcgccggca acatccgcgt
    76501 caccaacgag gccgtgctct tcggacgcct gcacccccac cacgtccagg aggtgaaact
    76561 ggccatctgt cacgacaatt actatataag tcgacttccg cgacgtgtgt ggctctgcat
    76621 cacactcttc aaggcctttc agattacaaa acgcacctac aaaggcaaag tgcacctggc
    76681 ggactttatg cgcgatttca cgcagctgtt ggagagttgc gacatcaagc tggtggaccc
    76741 cacgtacgtg atagacaagt atgtctagcg tgagcggcgt gcgcacgccg cgcgaacgac
    76801 gctcggcctt gcgctccctg ctccgcaagc gccgccaacg cgaactggcc agcaaagtgg
    76861 cgtcgacggt gaacggcgct acgtcggcca acaaccacgg cgaaccgccg tcgccggccg
    76921 acgcgcgccc gcgcctcacg ctgcacgacc tgcacgacat cttccgcgag caccccgaac
    76981 tggagctcaa gtacctcaac atgatgaaga tggccatcac gggcaaagag tccatctgct
    77041 tacccttcaa tttccactcg caccggcagc acacctgcct cgacatctcg ccgtacggca
    77101 acgagcaggt ctcgcgcatc gcctgcacct cgtgcgagga caaccgcatc ctgcccaccg
    77161 cctccgacgc catggtggcc ttcatcaatc agacgtccaa catcatgaaa aatagaaact
    77221 tttattacgg gttctgtaag agcagcgagc tactcaagct ctccaccaac cagccgccca
    77281 tcttccaaat ttattacctg ctgcacgccg ccaaccacga catcgtgccc tttatgcacg
    77341 ccgaggacgg ccggttgcac atgcacgtca tcttcgaaaa ccccgacgtg cacatcccct
    77401 gcgactgcat cacgcagatg ctcacggcgg cgcgcgaaga ctacagcgtc acgctcaaca
    77461 tcgtgcgcga ccacgtcgtt atcagcgtgc tgtgtcacgc cgtctcggcc agcagcgtca
    77521 agatcgacgt gactattttg caacgcaaga ttgacgagat ggacattccc aacgacgtga
    77581 gcgagtcctt tgagcgctac aaagagctca ttcaggagct gtgtcagtcc agcggcagca
    77641 acctatacga ggaggccacg tcgtcctacg cgatacggtc tcccttaacc gcgtcgccgt
    77701 tgcacgtagt ttccaccaac ggctgcggcc cctcctcctc gtcccagtcc acgccgcctc
    77761 atctccaccc gccgtcgcag gcgacgcagc cccaccacta ctctcaccac cagtctcagt
    77821 ctcagcagca tcatcaccgt ccccagtcac caccgccgcc gctgtttctc aacagcattc
    77881 gtgcgccttg acactgtacg gcagaaaagc cggctccaag tgcaagcgcc gcggcagcac
    77941 catgtgcaaa aacttgtcct tgcgcgcggt ttcgccgccg ggaaagacgg gcgacagcac
    78001 gttggttaca gccttgagaa cctgctcaaa gtacttgtcg gcgtgaatgg gcacgccgtg
    78061 ctcgcgcacg tagctcggat cttcggctac ctcgtagttg cacacggccg acggtggttt
    78121 ccgcgccctc ttctttgccg gctctcctcc tctcctgttg ctctcctcta ccccgccgcc
    78181 gtcagcgtcg tcgtccgtgc catcaatcgc gtccgaccgg gaaaccacgc cggcggttac
    78241 agaatcaccg ttgtcggagg aaccctgcgg cgccgtccgg acaccgggcg ccgtcagaac
    78301 gtaaaagacc cgatccccga ccgagggtag ctcctcagaa cgggccgcca atcgcttaat
    78361 gacggcaatg tgcggcaggt tagattgacg gtacagcgag atgtccttag agagcaccga
    78421 cgaaagcacc aggtcctcga cacgcacacg gtgcaggtac agatcgtcgc gggcctgcac
    78481 caagcggcgt aagatacgcc agaaaccgcg tggcacgccg tacttcttga cttcatcgag
    78541 tgagaggcgc gacaggcgca cggctgcttc cgagacctcg cgatcctcaa agagcagcga
    78601 gaggacgtca cgcgtgacgc ccttgacgaa ctcgcaggcc gtcttgcgca ccagatccac
    78661 gcccttcatg ctcagacccg aggcgccctc cactttgccg atgtaacgtt tcttgcagat
    78721 catcataaga gagacgaaga ccttttcaaa ctccagcttg acgggctcca caaaaagaca
    78781 ggccgtcacg tagtgcgcca ggctgggccc acgcgccacc agagcctgcg gcgtcaggcc
    78841 acgaaagcgg acaaacacgc tgtccgtgtc cccgtagatg acccgcgcct ccacccgccg
    78901 ttcgtccaag ccccctgatg atgtttcgag cccctccggt aacgtgctgc tctcctccga
    78961 atccccctcc cgcgttccta ctacatagtc ttcctgatta aaaaaattgt gcaaaaaaca
    79021 cggctctgaa aagttgtctt tgatgaaccg cgccgtgcgc tctagcatgt cgcgaccgat
    79081 gcgcgtaatg ctggcggcga tgggcagaca cggcatcatg ccgttgacca cgccggtaaa
    79141 accgtagaaa gcgttgcacg ttactttgag cgccatctgt tccttgtcga gcagcatacg
    79201 gcgcacaggg tcttgacact cgcgcatgca ttcgcgcacg gcacgccgct gcgaaaccca
    79261 cttgttgagc agttccgaaa gcaccgagac gcgcaccgaa gcacgcacaa agcggtgtgt
    79321 cacgccgttc tctagcgtga cgctgtatac gtcggcaggg tccacggggt actcgccacc
    79381 cggcaccagc agggtggagt agcagaggtt gtgagccatg atgatggaag ggtagaggct
    79441 ggcaaagtcg aacacggcca cggggtcgtt gtagtaaccc acctcgggct caaacaccgt
    79501 ggcgccctgg tacgaaaccg ccgcagtacc gccggcgccg tgattgtcgt tggaaacgcc
    79561 gacgccgcca ctactgccgg agccgacgct gaaaacgccg acgctgctac tactgttact
    79621 gccggagccg ggtgaaacgc cgtcctgact ggacggcgca gattgcaagg gcggcgacat
    79681 ctgaaacata gccgccacag aacccgcgtc gccgggcacg gcggcggtag agatgatagc
    79741 agcgttaggt gacacagcaa cgctattcgt ttcgggcacc gtcgtacctt tgctgtagtg
    79801 gttgggcagg ataaaatcgc ggcaggcgca ctcgtccagc agcgaggtgt agatacggat
    79861 ctgctgtccg tcaaagatga cacgccgcaa cggaatttta gccagccgcg cgatggcccc
    79921 ggcctcgtag tgaaaattaa tggtgttgaa cagatcgcgc accaatacgg cgtcctgcag
    79981 acagtaacgg cctacctggg cgcggccctc ggcattagcc acgaaacaac gtgggatgtc
    80041 cttgtaggac aggtcatcct tgcgttgccg caggtaaagc tcggccatag tgttgagttt
    80101 atagttgggc gagttagtct tggccatgca tacggggtac atgtcgataa ccaccgaacc
    80161 cgcaatatac accttggtgg cggccgtgct ggccggattg ttgtgagaag ccgagggaaa
    80221 ggcggcggcg tactgccgct taaaacccac ggcggggctg tgtaaaaaga aacggccgcc
    80281 ctgcgccgta ggcaacttgc agaagcgctg cgagtccacc ttatacaggt actcgagacg
    80341 cgtgaggatg tacttcaagt caaaagagtt gatgttgtaa ccggtcacaa aggccggcgc
    80401 gtaccgttga aagaaaagca taaagcccag cagcagctcg tattcggaag ggaactcgta
    80461 gacgtccacg tctgggccca cctgcccgca ggtgccgatc gtaaagagat gaagacccga
    80521 gtgcccaaag atcacaccct ccgaagtgca gccccgacca tcgttcccgt ttgggatccc
    80581 ctgatccacg gcggtgtttc cccccgtctc gtagcacacg cacgagatct gaatgacaat
    80641 gtcatcggac ttctcagcgc agggaaaacc accctcgccg ctcatgcact cgatatcgaa
    80701 ggacaggcat cgatagcgcg gccacgagct gtcgtcgggc acggccacca ggtcagagac
    80761 atcgcagtcg acctcgatat cacaagtcga cgcgcgaccc tgctgccgcc agtcgtaacg
    80821 attcacggag caccagccga acgtggtgat ccgccgatcg atgaccaaac gcgtcagcgg
    80881 atccacacgg acctcgtaca cgggaaaacc ctgctccagc agatactcgc cgatttttct
    80941 ggccatggtc cagttgctga tagacacaca ctgcaaatcg ggcacgggtc gcgtcccgta
    81001 cccgtagatg gaggtcttgg tggccggcgt gacagacacg gcgtatggtg tccgcggttc
    81061 gggcactagt tcgcccacgc tggcaatgac ctcacgcagc ctatcggtgt cgctgtactc
    81121 acagtaaaag tagctgcgct gcccgaaaac gttgacgcag atactgtagc cgtgttctgt
    81181 ggccccgaag aaacgcaaca cgttccccga aggcaccaga tgctgacgat agcgcggcga
    81241 cacgttttcg ggcgagtcga agaagagcac ggcgtccgtc tgatcgtagg tgtgaaaacg
    81301 aataggtccc accacgcgac ccaccagggt ctcgcgccaa ggacacggcc aaaccatgtc
    81361 atgactcaac aaatgtttaa tctctcgata gaacatgaga ggcagccgtc ccgtcttatg
    81421 cttgatcaac cccgtctgac cgtcgaacat gacgcctcgc ggcacgatct gcaaaaactg
    81481 tttctgtggc ggccgcttgc ccgagccctg cgcggagccg ggctgcgaac gctgacgccg
    81541 gccacccgcg accgcaccgc cggtcacgcc gccgctcaga tacgggttga aaaacatagc
    81601 ggaccgtgag aggctgacag cttacgaagc aaaatcacaa agaaaataca catgcagcac
    81661 ctagatatcc agtttaaccc cgtatatcac aagtctctgt gtcacttttt ttgtctgttt
    81721 ttttttcttc tcctggttca gacgttctct tcttcgtcgg agtctttcaa gtgtcggtag
    81781 ccgtttttgc gatgtcgcag tcggtctagc aggttgggct tctgtccctt atcctgcgta
    81841 ccagtctgtc cgtccaaaga atctgtaccg ttctgctgcg ctcgctgctc tgcgtccaga
    81901 cgggccaggg ccagaagcat ctggtaagcc tgctcgttgg tgtaaggcgg agccgccgtg
    81961 gatgcatcag acgacggtgg tcccggtcct ttgcgaccag aattataaac actttcctcg
    82021 taggaaggcg gagcctgtaa cgacgtgtct ttggtgttgc ccgacgtcac ggtggtcccg
    82081 tcggcggaca ccagataggg aaagaggttt tgcagcggct gcatgcagag acgccgctgt
    82141 cgagtataga tcaaataaat gataatgacg acggctatgg ccacgaggat gatggtgaag
    82201 gctccgaagg ggtttttgag gaaggtagca acgccttcga ccacggaggc caccgcgcca
    82261 cccactgccc caatggctac gccaacggcc tttcccgcag cgcccaggcc gctcatgagg
    82321 tcgtccagac ccttgaggta gggcggtagc gggtcgacta ccttgtcctc cacgtacttt
    82381 acccgctgct tgtacgagtt gaactcgcgc atgatctcct cgaggtcaaa aacgttgctg
    82441 gaacgcagtt ctttctgcga gtaaagttcc agtaccctga agtcagtgtt ttccagcggg
    82501 tcgatgtcca gggcaatcat gctgtcgacg gtggagatgc tgctgaggtc aatcatgcgt
    82561 ttgaagaggt agtccacata ttcataggcc gagttcccgg cgatgaagat cttgaggctg
    82621 ggaaactgac attcctcagt gcggtggttg cccaacagga tttcgttgtc ctcacccagt
    82681 tgaccgtact gcacgtacga gctgttgaca aaattaaaga tgaccacggg tcgtgagtag
    82741 cagcgtcctg gcgattcttt cacgttcata tcacgcagca ccttgacgct tgtttggttg
    82801 atggtcacgc agctggccag acccagaaca tcacccatga aacgcgcggc aatcggtttg
    82861 ttgtagatgg ccgagagaat ggctgatgga ttgatcttgc tgagttcctt gaagacctct
    82921 agggtgcgcc gttgatccac acaccaagcc tcggcgatct gcgccaacgc ccgattgatg
    82981 tagctgcgca acgtatcata ggtgaactgc agctgagcgt agagcacatt tcgtacagat
    83041 tcgctttcag gcgacagggt ggtcgtgttg cccgtacttc tcttggttct acgcgtggag
    83101 ttcacaccgg agctattggc caaacgttcc agttccaaca aagatttttg cttgatacct
    83161 tgccagaaca ccaccagacc gcctgtggtt tcaaaaaccg acacgttacc gtacttttcg
    83221 tatgtttgat tgtacgaggc gttgaagatc tgttgtagct tatctagagc ctgattacgc
    83281 acacaatcca acacggggtc ggacatgttc acttcttgtt tcttagacaa aaaagttgca
    83341 gtcattttag cagaagaaaa gtggtacgag tcttcggctt cggaacgaat agtacgttcc
    83401 gaggcttccc agaaggtgag ctgacaggtg acattcttct cgtcctgtat atcccaggag
    83461 atcaccgagt ccgcacgttc aagaaaagcc accaacctgt gggtctctgg cgcagaattc
    83521 gctcttccaa agtcagagac aatagtgtag ttcgggaaaa tgaaaaactt gtcggcgttt
    83581 tctccaaagt agctggtatt gcgattggtt ccgttgtaga aaggagaaat gtcaaccacg
    83641 tcacccgtgg acgtggcgaa aaaatggtaa ggatacttgg aacgcgcagt agtgatggtc
    83701 accatacagt tcagattaca ggtctcacga tagagccagg tgctaccgcg gctgtgccac
    83761 tgatccttga ccgtcacgta acggatgctg tgggtgttgg aataatcgtc gagcattaat
    83821 tgcatggttt tgttttcata gctgtcccta tgatacgcca cgaaaaccgt gcctgctata
    83881 acgcggctgt aagaactgta gcactgactg tggctgttga tatgatgaat ctcccacata
    83941 ggaggcgcca cgtattccgt gttgctgccc agcagataag tggtgtggat gtaagcgtag
    84001 ctacgacgaa acgtcaaaac cttctggtag acccgtacct taaaggtgtg cgcgacgatg
    84061 ttgcgtttgt agactaccat gatgccctcg tccaggtctt cattgatggg cttcatcggg
    84121 gtgcagacga tattacgttc aaagcgaata agatccgtac cctgggccat ggaacacacg
    84181 cgataggggt acttggtggt gttgaccccc accacatctc catacttgag ggtagtgttg
    84241 tagatagtct cgttggctct atgactgacg gctttagaag acgttacgtg ttgagaagag
    84301 actgaccggg tttgagcaga cgtcgtacga gaagcatggc ttccattgtg agtagaagaa
    84361 gttgcatggg aagtagaaga agaggaaacc gcagcaccca gacagacgat acacaagtta
    84421 acgcagacta ccaggcacca gatcctggat tccatgttcg tcgcgggcca aatccagcag
    84481 cgatgaggcg cgtcgtggtc tcttgcgtgt tgcgcggacc cttcgagaaa cgcccgcggt
    84541 cgaggaggag ggatacggac ttggcagcca aggtcggtcc ggctccctga agacgcccga
    84601 gacggccgcg gcggccgtca gggtggaggg cttggccacg ggagctgttg gcacgtcgcc
    84661 actctcatcc ggtctggaca gatgcctgta gaggaggaga tatagatctt tggacttata
    84721 aagacttcct tcgtgacgaa gcagcagcgg ccactctttg ttatacgtga gaatcacatc
    84781 tctgtccggg tgcagttcgt cgcgcaggca cgcgatcgag agttgtttcc cgaaagtttc
    84841 attatatagt gcgacggaga gcacgagctc ccgcacgtgc atccacatct ccttctgcag
    84901 cacgtttagg tcctgacagt ccgaaaaatt gaaaaaaccc atgtacttca ccaccatcca
    84961 ctcactggga tacacggtac cttccgcgca tttgaccaaa tcgtccttga catggggtag
    85021 tacgcccgcg ttgtcgcagg cataggccat gtccacattg tgagagaggg gatagcgatc
    85081 ggtgcagtgg gtgaaaagag gcccgttaca caactcgtag atctgctgac ccagtagcgg
    85141 gagggattcc acaggcagac tcttgtggat caggttattg accacataca ggtgctcatc
    85201 ataggtaaac tgatccccca cgtccaccac gtcttggtcc tggtggtatt ggctgcggta
    85261 tagaaaccca ttcatgagct tagagataaa gtccagacac aagggcccca ctaggttgac
    85321 atcgatgagt ttgctagtca gacgctcctg cgttttgatg caacggatca ccttgccata
    85381 gcccacctcc gagaccttct gcaggtaggc gcgtttgcgc acgttcacct cgcgggtgac
    85441 gttgtggatg cgggaacgcg cgtccaccaa gtcgagagcc tcgtgttcat cgcagttgcg
    85501 cacccgtaag ccgttctcgc tgccgtcgcc gtcctgccca ttcacccctc cccctaccac
    85561 tttcttgcct cctccacgag cccggccgcc gccaccgtta ttcctctgac tgtgagtact
    85621 gctgttgctg ctgttgctgg ccgtcatcaa agtcgtaccc gtccccgaca tcgcctcccg
    85681 tccacgcagg tgaatagcct cgccctcggg gccgtcgccc cccgtgccat cgggcagcgg
    85741 acgtcgaatc tcctcgagaa tatgcttgat tttggtgtac atctcgttgc tttcgtggag
    85801 cttgttgaac accgggttgt cctcgaaagc ttgaatgctg agggatgtga tgaggtcgat
    85861 gatcctgttg ggggcggcaa agaccgaccc cacgaacatg cgctcctccc cgtccaacgc
    85921 cttttccccg agcacgaaga tgtcctccac gtcctccccg tacagatggc gactgatgcc
    85981 gttcatgagc gcccggcaca gctggtgata cacatttagc tgctggatgg tgatgcccac
    86041 ccgcttgacg ataacctccg aggtacggga ccagtaggta aaatccgaca aggaatatat
    86101 tcgttccggt atatccgtaa acaggttgta ctccctcagc gcctcctccg cctcctggat
    86161 gtagctgtgg taggccgatg aagaagagaa taggcttttg agggccgaaa ggactccagc
    86221 caagtggggg atgcgcgttg tcaggtccag caggtcctgc tccaccgtct ggatattcac
    86281 atcggactgg cttgacggac ggtggaccgc tatatggttg cacagcaagc cctgcagccg
    86341 cttgttcagc gagcggccct gattcgggat gatggtcagc tcctcgtagc attgggcgca
    86401 tgtcgtccct tcgacgtaca cttcctgacg cgccaccggc gagatgccgc ataggcgacg
    86461 gaggagctcc agcagctgcg cgcagacctc caggccggcc tccggcgcca ggatcccgta
    86521 cacgtagttc attttgcaca ggaagcgctc gatgtcgttg agtgtggcca gactgacgct
    86581 gaaacggacg ttgtccgtaa actggagctc cacggtgtga tggcgatcgc agcgatccaa
    86641 acggaggacg gtacggtaga aggccgcccg gtccggctgg cgcgagtagg ccatcagcgc
    86701 ccgatccagc aaagccgtat cctcgtgcag cgccttcagc agcatctcca gatagagcgt
    86761 cagcagcgaa ctctgcgtac gattctgcgc caccacctcc gggtagatct tccggtacag
    86821 atacactata gccgccgcgt ttctcttgaa cggcgtggac tccgccagta acacgttcgg
    86881 atcgcagtac tttagacact ccagctccat ggcgtattcg ttgcatttcg aacacactac
    86941 gcatagtttc tgtaacaaat tcatctccat gactcgactc gctcacgtac gagacgctgt
    87001 cgtccggtct ggcgccggcc agagacatgg agtcggtgca caaataactc gcgggccgct
    87061 cgctatgccg actgacgttg acgttaatat ataacgacgt cgtcgacgac gcgggttctg
    87121 ctcccgaagc tgttgccgcc gcttgcggcg caacctcctc caccaccgcc gccgccggct
    87181 cctccgcctc gggcgacggg ggctcggaga tgaccggctg tgtctgacac tcctcccctt
    87241 cctcaggcgg cccgggcgcc gacgcgaatg tcggagtttg ccagcgcggc ggcggtctct
    87301 gtctctggtg ccgcggcgct aaccttcggg gctgttgctg ctgttgatga tgcgacgccg
    87361 tctgtcgccg ctgttgcggc ggtagctgat acggtatcgc ctggtgctgc tgtgtcggtg
    87421 gctgctgttg ctgctgttgt tgcggtctga aaagcggcca cgggggctgc gactgttgct
    87481 gctgttgttg caacgctcgt ggctgcggcg gccgttgtcg cggcgtttgc tggcggttac
    87541 aaccggctgc gtttggccgg caataacccg ctgcccccgc cgcccccgct gctcccgccg
    87601 acgccgccag cctcgtcttc gccggcgttc acgagaaagc agccacctcc cgtctcgccg
    87661 ggcacgccga agcaaatgga gttgcccgcg acggactcgc cgagaagaag accgccaccc
    87721 ccgacgccgg acgccgcgcc gacgccactg ggcgcgaaga gcgccgacag gtcgtgcacc
    87781 tcccccccgg cggcgtccgt caatcgctgg gcgtcggcgt ccagcacgcg tcgcaagttc
    87841 tccagcgaaa agtcctccac gccctgctcc tgcaacgcgg caaacttgtc catcagcgac
    87901 gcggccagcg cctcgcagcc gtccacgaag aagagcacat cgtcggacgc ggggatctcc
    87961 tcgcgcacgc tcagaatctc gtacacggcc atcacttcgg gatcgcaatc caagttctcg
    88021 gcgtccagcg ccagcatgac gcgatttttt ataagatccg cgtcaaaaag cacgttctcg
    88081 cggcgcgagc gtttgatgag cacgtcggcc agacgcgtag ccaagaggta gcgctggcgc
    88141 atgaaacgat aatcttggcc gctcatagag ctcacgttaa ggctgcgttc cacaccgttg
    88201 cccgaaaagt agccgatctg cccaaactga tagatctcct tgctgttgtt gatacccgca
    88261 tatttttcca cgctcacggg cacggtcacc aaggaacgat gctcaaaaac gctccgtacc
    88321 aacgattcac gcgccacagt ggcggccatg ggcgccggca cgcctgcggt cttcaagccc
    88381 ttgacatgca acgcaaattc ggcgggcgac gagaaacgcg gactagcacc taacacgtga
    88441 ggaaactgcg cgtggttctg cgtcgttaaa cgcgtcgtta acccgtgcag cgagccgatg
    88501 tagtctttga agccgtagta gcagaggaat ttgttatgga aacggctttc cacgtaactc
    88561 agcacacagt ctggcgccac atccagcaga tcgtgctcct gatagtcagc cgtcacagcc
    88621 accagaaatt tgacgaaagc attgaactcg cccatgtcac ctatgggcac attcttgggc
    88681 aacgcgttgg aacagacctt ctgccaaaac tgtaagcagg ggagaccaca ttcaggaaag
    88741 agtcgctcgt gatgtcgata cagcaggaat cccaagcagc ccttagccgg attgcgacgc
    88801 ggaacgtgat cgcggcgaaa aaacacgctc cccgcgttgc ccttgcccgc gcggtagatg
    88861 ggtcggtttt tcactcgcac catgatcaac gtgggtaccg acagccgcga gagcttgatc
    88921 tccatgggca ccacggcgta cgtgccctgc gcgtacagcc taaagtccag cagacggtca
    88981 tgatccgaat tcttggacga cttgatctgc ttggtgaaga gaaagccctt gcgcgacgac
    89041 gtagtggaga acgcgccgtg aatggattga aaatgctgcg tcatccattt ggataccaag
    89101 ttggtggtca acggattgtc cacaatgtat gaggtagcgg taataagcgc cacgttctgg
    89161 atcacgtaaa agacggatct gaaataggcg taggccagca gcggctggaa ggctacggcg
    89221 tagggattca aatccaggtt gaaggcctgc gtggcgcccg ccacctcgtc gcggctgctc
    89281 ttgaggcgca cctccgaaac gaaacccagg gcctcgtcgt ccacaaactt gttgagcgcc
    89341 gaaaagacgg ccacaaagtc gcttttgccg tgcgcgctaa aggtatcctc gcccgtcacg
    89401 gggtcgatga gccgcatctt gcggcagtaa tccaagatgc gattgagccg ataggtacgg
    89461 tccacgctag cgcccagcat gcgaccgccg cgccccatca ttcccccgga atccccgcca
    89521 cccccaccac cacgaccgcc gcccagaccg tcgctcgggc ccccgctcac gtctcgtcca
    89581 ccacccccgc cagcaccgcc gcccggaacc ccgtcgtcac ctttgccgtc caaacccccg
    89641 tccttggcgt cgacgttgta acgccgaccg aagctgccca aaatatccac gtcgttgaga
    89701 aaacgcgact gcacggtgat cacgcagggc tccttcttgg gctgcttggg caccacgggc
    89761 aagcgggtgc gcacccgcac gaaggccgtc tgataacacg tgtggcaaca agtaccccca
    89821 caggcctcgc acagccccgc ggcgcagccc accaggtgat tcgtgagcgt cgacgaaccc
    89881 gacaagcccg tattatacac cgagacacga tttagatacc agacgaagcc cgaaactagc
    89941 tgcggacacg tgccacacac caacgccaaa tgctgcggcc catagcgttc gtccttgagc
    90001 ggcgcgcctt gaaacttgag caccttgcgc gcgtcgttgt agacgtcttc gcaggccgcc
    90061 gacaacccgt tggtgaactg aatagccttg agcaacgtct cctgactggc cgtaccgccg
    90121 gcgctgggat gccgcgccga cgactggaga tacaccagcc tgtgctggta gagcaccgaa
    90181 ttagcgctga agaccaaggc ggccacgtgc gtcgagagat gcaacttgag ctcggtcagc
    90241 gcgcggatca gatcgcggtg atcggttgcg ttggtcacta aaggccactc ggaaaagagc
    90301 atagactcgg caggttggta ggccgaatcg aaaaataccg aggcaaaact gaaggccaac
    90361 tcgcaaacca ccgcgtcact cagcatcaga tgatcctttt ccagactgct gagtcgctgg
    90421 ctcatgtacc ccaagtagcg cttatgtggc gccagcttca ccgactgctg actgtcgtgc
    90481 acaaactgcc gcaacgccgc ctcgatcagc acacgcggct ccgagaagcg cagcgattga
    90541 caccatgacg tgtacacgta gtagaaaagc gtctcgctta cggccggcac gtagagccct
    90601 cgcgtctcca caaaagcgct gcgcgcatcc agcgagacct cgtcggcttc ggcgtcaagc
    90661 tgcagcgaat taaagagcgt aggcgggtac aacggcacgc gcaccgcctc gccgccgtgc
    90721 agtcgcaccg tggtcgcctc ctccacgcat ggaatcagct gaccggcaaa aagaaactcc
    90781 ttcaagccgt tgcccaccac cacgtgcaca gtcgtctcgg acgcctgaca gcccaccgcc
    90841 gcgcacaacg ccgccagatc ggtaggcacg cgatccgcct cgggcgtgta ggcctccaac
    90901 gcgtacttct ggcgggcgtc ctcgcacagc cgatgcacgt ctccgtgatc ctcggtaaaa
    90961 gccacgatgc cttgcgtatg atgaaagtag agcgcaaaag gacaaaagga cgtgactttc
    91021 gtgagcaccc cgccgtcgta acaaagcaca ggcgtgcgca cagagacgcc gaaatccgcc
    91081 tccaccgtga gccccgccaa cagaggagcg atcaccacgc tcgaggaacg gtcgcatagc
    91141 gagagagtgg ccagaatctc ctgcgtttct gcgttcaacc tgctgaagta gagaaaagcc
    91201 gcgggcccca ccggcgctag cgcggttagt tcctcgtggc tcatggtgga tgaacggaag
    91261 acaatggcta cgccgccact gagtgaattt tataccaagg aaaagttcag cacgtcatgt
    91321 ttgacgcacg acgtctgaga caccaccgtg gccaccactg cggtctggct gcggttgcgg
    91381 accaccaaag gcgacaaccg caacgatccc agcaattcgt gagaaaagct aaccgttacg
    91441 gtcgggcagc ctctcgcagc cagaccgcta gccgacgcac ccgcccgcga aaatagcgtg
    91501 atgttcggga cagctttgcg tcaccgcaaa ctaacgtcgg tagctgcaca cgtcgtttat
    91561 cctcagcaca ccgtccggtc acaacccgtt ttcccactca gtcgcacaag cagcacataa
    91621 aaaccccaca cagggcacgt gaaaacaccg tccctagaaa acggtgtttt ctgtcctacc
    91681 gtcaccgggc cacacaggca aatcccgagc ccgatccccg aaaacaccgt acggtgtttg
    91741 tggcctccaa aatcacatca gctaacaaac cgtgaaaagt cacgtttcac gaacacggtg
    91801 tttttaaatc acaaagaacc acctgacggt ttacaagcag aaacaccgca ccacggtggt
    91861 acaagcgcgg tggatctgat ctcgcaacct caatcaccgc tatcaccacc aattttcgct
    91921 gcgctccgcc gacaaaacgc cgtacaagct acacacccca aaaacccgcg cgcctatggg
    91981 cgccaaacgt gtattatctc aacgtcacaa cacgacacaa accacgttac gtggtttccc
    92041 gaacacgtac gcggcacaga cccccgacac gtactcgaag accttacagt ttacgagtca
    92101 ataaaacagg aaaagatccg aactttaaaa ttgtgtattt ttatttcccc atcccccctc
    92161 ttttttacca aaaaacacat ttttcgtctt gtaaaaagta actctcgccc attgccatga
    92221 aacaccgtga tggggaacgg tgttgtgtgt caactgacgt cactacggcg atcagtatcg
    92281 acgtcgtgta tacataacgg tgcccggtgt ttttgttcgg ggcgttgtcg cggcttgatg
    92341 taatgtaacc tgaaaccgcc gtgtccaaga atgcggaagc cagcgtgtaa tcataacggg
    92401 gttttgggta caacctgacg acatctggcg gcgagcgtac accatcgaat gtggcgatcg
    92461 tcggctctac gtcacaatga cgcaaaaata cactgtaaaa cccgcgtaga cagctttccc
    92521 gatcaacgag cgccatctgg tgtctgcata agaacaggca taaaccccgt ggccggcgag
    92581 gcggtgagca cttttgttgg tcacgtgacc atcggcgcag gaagcgagac ccgtagaacc
    92641 gcccaagagg cggtgccaga tgccaacgtc ataatcacaa ggtgatttgt tacgtcacgc
    92701 gcgcgcacgc acgcgcgcgc ggtagaatac agcgatccct agtgaagcca cacccattac
    92761 gtgtagctat atccgcttac gtatacagcc acacccctag gtacgccacc ttatctacca
    92821 atcacagaaa cggatataca atgagccctc cctagactcc accccttgta cggaaatttc
    92881 agataggtgg aacccgttag ggttccaccg tcctcggtgt acgtacaggc ttctccgtct
    92941 accggaaata tacacctgct gacgtagacg ctactcccgg atacgcgtca taagctactg
    93001 gaccctaggg gggagtgtct acagggctac gtgcacgccc ccttacctag ggtatccgcc
    93061 cccttcctct gttttggcct agtaaactta acgccgccgc ttctcacgtg acccctggca
    93121 agctcacgtc acactcgcgt gaccacaccc actccggata tacgtcatcc tgtggaattc
    93181 cggacatacg gtgacgtagc gagcgtagcg agctacgtca cgtatgcgta cgtcatctcc
    93241 ggcggaaatc atctctgatg acgtagcgag cgaagcgagc tacgtcatca gtccgtttta
    93301 cgtataccgg atgctaggcg acgccccgta ggggcggagc ctagcttcca cccctaggat
    93361 gcatacccta tatagcataa ttcttctaac gaaacgttct acgaaaacgg actggcggaa
    93421 cgggaaccac cgtaaccccc ccccctcacc cccccccttc tcctccggaa ccgggggggg
    93481 caaattttta ccaaatttgg gcaaccatga tttccaatgg gacggcgttt ccgtgcacat
    93541 gcgcagtcgg ggcgaatttt cggttgttag ggcgttgcca cgcggattat gggatgtggc
    93601 ctcgagtgcg catgcgccgg ggatgtcgta tggaaagcct atatataaag agggttaaac
    93661 caggggaccc ggtgcgcatg cgcgggccag gacccgcggg aggcgcgccc tgcgcatgcg
    93721 ccggtaaaat tccactgggc atgcatcgtg cgcatgcgcc ggtatttttc cactggaggc
    93781 ggtcagtgcg catgcgtcgg taaatttcca ttggatgcgc ttcgtgcgca tgcgccggta
    93841 tttttccact gggcggccgc acctagggag cgcgagcccc gtgccgggca tgggccgcgg
    93901 cggtggaaaa ttaccgctcc gcccacctag gcggggcctc tgagaaccta taaaacccgg
    93961 cgtgcccgcc gccccccggc gcagtccgcg gcagggttcc ggccgtgctg cggtccgcac
    94021 gctgcgcccg ctctcgcctg cctcccgccc taccccccac cctccccggc cgaggcccgg
    94081 cgccggtccg tccgcgggcc cgtcccaccg ccctggagca ccatccgggg ccgtgggccg
    94141 ggcaccgggc gcggcccgct ccggacctcg gccgggggtc cctcccctcc ccccgctcga
    94201 ccccccatcc gacggcccgg ccgggctggg acccccgcac cggggtcccg gttcccgtcc
    94261 gcggcccggg gggacccgag cgggggcttc ccagccccac cccgctcctc cccgggctcc
    94321 ggtccgggat ccctcgctgc tcccggcgac ctccgccggc ttcccggtcc acccgccgcg
    94381 gaacggacgg gacccggggt ccgcgccctt cccctccccc cacggggggc tgggtcgcgg
    94441 accccggttc ctaggctcgt tccgcggtgg gcgaccgggg atcccccacc cagctcccct
    94501 tcccggctcg ccccgctggc ttttgggtcc ctccgggctc tttttccggc tgggggtcgc
    94561 ggcggccggc cgacgacgac ggtaggtggg ccgggcggac ggtggtgggg acgggcgacg
    94621 ccccggctcg acggcagtcg gccccggagg gttgggggct gggggcccag tcaggagctc
    94681 cgggagcggg gtcgaccgcg acggcttccg ggtctcgcgg cggctccctc tcggtggctc
    94741 cggttgggct cccctccccc ctctcgaggg tccggtcgcc ggtcgtggcc gggggtccct
    94801 cggcctagcc gtcggctctc ggtccgcctt accctgggcg ttggccggtc ccgtgacgct
    94861 cccctccccc actgctcccc aaaaactccg cccgaaccgt cgcggcttgc tggccctggg
    94921 cgtggtcccc ccactcccct ccccccatcg gccgcccagc cggggtcggc gcctcggacc
    94981 ccactaggct gtggcgtgtg tgctggccga tgcggcggtg aggttgggtg tggccggaag
    95041 cgctcggggt cgacggtggg ccgccatgac acctcaattg ccgttagtac gcccctccat
    95101 aatcactgtc cccacacgat gggcccggca ggtcgcccaa cgttggttca ggcccagtcg
    95161 ggtttttccc cggtacgaac gcacgtcccc gtgggctcca cgcgttttcc accctttcct
    95221 ggaggggtcc ggaacaccgt gaatccacag ggagggtccc ggcacgagcc gaggagacca
    95281 cgaccgtccc acccggcgtg tcgactcgtc cgagacccgg gaagggaaca ggccccacct
    95341 tttttttccc ttctccgatt tgccgtggaa aacccgtgaa ccgatacggg tgcagacggc
    95401 cgaaaaaatt cgtgacggca atacgacgac agggcgtgat tttatccccc atccgacaaa
    95461 accgtgtccc tcaaaattcc ccacctttct ctgttcaaat ggccccgaaa ctgtaaaaca
    95521 ccgtttgacc gcaccccaac cggcgccatc ttggtgacct tctcgacggt tctctcgctc
    95581 gtcatgccgt tctgagctcc gacatggcgg acgagagaaa atggcgtcga gagccgagga
    95641 gcgttttcgc tccaggcggg taaaaaaata gcacgataac ttttctgtgc ttttttgaga
    95701 cgtttttgaa gagctttttt tctgctcaga gcgaaaaaat gatagccctg aaaatctcga
    95761 cgagtctggc cgagcggcgc catcttggag gaggggcgag tcgcgggcac cccctcggta
    95821 ccccctggcc gaggcgagtc cgcgatcgcc gcctgttccg tgatgctacc tagagggcgc
    95881 cgtcgaggcg actcttcctg ttttcgccct gagggctaac tgtcgctgac gtcaaaccat
    95941 ctcgtgctcg ctgagtcaca tccggttgtt gacaagcgat ggaggaccgc acccaaagtg
    96001 cgccctctag tcatcgcgcc tgaccccttt tataaactgc tcgaagaaaa gaacacctta
    96061 tgtgaaaaaa tacagaatga tgacaagttc atccaacaca accgctcaac aacgccatat
    96121 ctatcagtgt ccaaaaacta tcttctatcc tttgaaacta taaatgctgc ctatatacat
    96181 atttagtatc caagactctt accacgtaga cgaaaagaag tgatacaatg atcttgacgt
    96241 gtatcgtcta tatcgtgcta gatatattca gataagacgc gcaaaccata gatttctcat
    96301 cagtatcatg aaagacctat agctctatat acgaacctag tcattttagg acagccgccg
    96361 gagaagccga cgagggatcg ggcgggtgca gccagaacct cacgcccgat cccgcctccg
    96421 gtaggcgatt tgcatctgtt tggtaaaaag ctcataagtc tgtatgtgac ctatatatat
    96481 tatacgctat gtacaccgaa ctgtcgctgt tgtataagaa gaaaaaactc tccatattta
    96541 tatcgtctga atttttgctt gatagacacg tgtttggaac tctgtccccc cacgttttca
    96601 ctgtgtataa caaaaatatg tgtttctcaa aagatcttga ggtgtttgaa aacgggggaa
    96661 acctgcgttt gggtgcgcta agccccggac tgggacgtag ccggcgtccg gcacctatat
    96721 ttttctattt tttttttttt ttttttttac aaaatatatg atgaaccaag aataaaactc
    96781 tagctctcgt ctatttttaa tatgctctac ttaaaacctt tttaatgaca gaatgaactc
    96841 catgttatac gctctttata tagtttctct gcactaacct ttaaaaccgt atccttccct
    96901 gttgtacaaa tcatcttttg atacacaatg atgacctgat atccctccat atatatgatc
    96961 ggatattatt ccgttagact tgtcctcctt tttttttcct catctcctgt atctggagat
    97021 atatgttgac caccaccgcc atgaccacca aaaagctagc cgtcacgact agaaatgtgt
    97081 aggattcgga ctttccgttc gagaagaaag agaccgcgtc tctggacgct ctttttgtcg
    97141 gtctgaatcg acccgggata cgtaagagag cggccctaca tcggggggcg ctcgagaccg
    97201 acgacgttcc atctgaccag aaaaaaaaaa ggcacccctc ggtggcgacc tctcaccatc
    97261 gtttgcccgt ccgcccgtcc ttcgtagcca tcatcatctc aggctctatc ggtaccatcg
    97321 ttgtcatctg aaaaaaaaaa ctgcctcacc cacctgcgta aaaacaccat ctttccggag
    97381 gtgcggtaag acgggcaaat acggtcgtgc cgaggcaaaa aaaaacgcac catcgacacc
    97441 acaccctcat gagcaccacc tgtcggtgtt ggtcgtcctc catcgttctc tacgaacatc
    97501 tcgacgcccg ggtgacggac gacggcaaga cgtcccggag aagacggtgt tctctcgggc
    97561 ggtacgctct ctggatctat aatatctata gtagctaaac gagactgtga gtacgacgaa
    97621 ccacatcatc ttttttttat gttgcttctt tagaaaatga cttatgtcga cgacactcgg
    97681 catcagccat ctcgtgaaac acgctcgctt ttcgtctctc caaggaacac tgggtccgct
    97741 gaaagggacc gtgtaccgac caaagcaaaa aacacacacg tagtaacatg atcaaccacg
    97801 tctgaatgac acgaaaacac aatcgtataa cgctctattc atggaacgaa cttggaataa
    97861 aaaaaccatc gcaggccaga ggctaagccg aaaccgtccg gggaagcggg cgcgagtttt
    97921 ccgacttagt ctctggtgct cgttgagcct cttttttttt tcctgattct ctgaagaatc
    97981 accgtcacag ccctatgacg cgaaatcaat tgctagaaca taaacgttct caacaggtat
    98041 gaaatgaaca aactagatga tgctataacc ttatattgtg tgtatataga taggtgtgaa
    98101 atttgtagga taaaaagtgt cgttgtatga tgcacaacga tcgtgaaact ggagactgta
    98161 gctctctacc gaatgcaaat acacaaatga catcgattcc cgtccccaca taaagaaatg
    98221 tgctttactg tgaaagaatg aagaagattc ttgttcctcg tacgacgggg ccctcgctcg
    98281 tcgtgcctct tcccccctcc gggagagggg acgtcggggc cctccgtcgc atcgggccaa
    98341 agccagtgaa atgtttacta cactgtcatc agaatatatg atgtatatta tttcctccaa
    98401 actcctcacc atagccacca attcgcatca cttaagaaag tagtagcaac cgcggcggcg
    98461 gcgaccggcc ggtcgtcgtc tcctcgtcct caaatgttgt acatgtgcag aaaaatgtgt
    98521 aaatacgtgt tatttatccc atgcgtcttg tacatagata tatgttttta tatacgctat
    98581 ttatacttta tatatccttt tgcataacca tagacagtca aggattttaa tgatttgctc
    98641 atccgccttt gagccatcgc ttaggagtta gttcctctat gttctcggcc caccttttcg
    98701 actacagtag caaacccttg tactaccacc ccgataaaaa ccacatcatc atcgtcacca
    98761 cgacctggaa acgacacacg ttccccccca atcttgggca tgtgtatata taagaatggg
    98821 agggagagga cgtggggctc gagaagaaat aaacgccaag ctcgattcga accaaaaaac
    98881 cacatgtgta ttgtgctttt tttttacggt gggggaaaag gagggggccg tcattaacga
    98941 aaaccgtgta tggggtccgg acacgaacag tacacagctt atggggaaaa aagctcacag
    99001 agagaaaaaa acaccaagct caggcacgcg tacatcatta tcatcatcgg atatctcacc
    99061 acgggtcata gtagtaccaa ggagtgtgta acaccatttt ttctttgtaa cgggataagg
    99121 gacagcaatc atcacgcaca acacccttca ctctcttttt agtcatccat atcatcgctg
    99181 taacacagca tgtcctcgta atcgggcgtc tggcagcgca ttaccaccga gtcgtcttct
    99241 tgcggtaccg gtggtggcgg cggctgctgc tgggttgccg tcgtactgtg attaccgttg
    99301 gcggactgca ccgggatgat gggctgcttg tggggaacct ggggtggact gccgccgtga
    99361 gaaggcgacg gcgtcatcaa gttaagctca ccacggtgac tccggacacc ggcgaggggc
    99421 gccgggggac tgggagggac cgcggtcgtc ttgtagacga cggtgtcccc gtgtcgatcc
    99481 gtggctcgta ccagatcttg actgctagcg tcgtcactgt cttcgtcctc ttccagctcg
    99541 ccctcagagt agtgctgctg tggttgcgac ggtggctggg cgggaggagc ggcggcgatc
    99601 attggagagg gatgtcgatg actcccttct ctgtcctttt tatcgtaagc tgtcagcgtt
    99661 gctgggtccg tcctgctttc catatttgcg cattgctcat cggtgggatg aatttggtct
    99721 cctccccgct gttgtccgcc ggcagtggca tggttgctgg cggttgtcgt tgtcgtaccg
    99781 gcaaagacgg tgagatccaa tagcgactgc tcgtcgaagg gacagtacgc tatcatgaaa
    99841 cgatagggtg ccaacgcgcg ttggatgcgc agttcgcaca tctcgttctg acactcgtgg
    99901 cactgcaggg cgcctaggat caggtccgag acagctccgc agcggtaggt acccatggcg
    99961 ttgttagtat cgaactggtc aaaaaattgg ggcgtaccgg tgacttgcaa cgcgcgacgg
   100021 cgtagcgaga cggctacgcg cgagaaagag cacacgtagg ccatggcgcg gtgcatgggt
   100081 tgcgagaagg tctcgggcgg acgcttctgc agatcgcaga cgtcgtcgcg tagccaggcg
   100141 ctcatttgac cgggcttctt gactaaccgt ttgagcgtgc tgcaatggtc gccccagccg
   100201 tcctggtggt ccaggatgca gcccaggtcc aggttgttga gtttgttgaa gagcagctga
   100261 cgcatgccgc ccaccgtctc cagataggga tcgtgcgggt tgacgggtag cccgtgcagg
   100321 tggtggtact tcatgtagct gagcgtttcg tcgatgatgg ccagcaacgt gtgcaagttg
   100381 ggagcgttgt acacggcgaa gatcttttcc accaccagct tgcgcagcaa cggttcctcc
   100441 agccaatcga actgttgacg gatgtgcaac aggtagtcgg tgtgcatgag ctcgtcgtgt
   100501 gacagcagga tgcgaccgcg cggctgatga tcttgcggga aggcggtggg gaccttgaga
   100561 tcggcggggt agggtgccag acgtagactc tcggccgtgt agcgctgaag gtcgtagacg
   100621 ggcgaggtag aactcggtga ggtacccgac gaggcggcgc cgcgctgcag acgcgctctt
   100681 tttttctttt cgatcaaacg gctgagttgc tgtagttcgt cctcgtccat ggcgtccagt
   100741 tcgtcgtcaa taagcgccag catctgttgt tgttgcggtc cggcggacga tccgtgatga
   100801 ttattggctg aggaggggtg agaagaaccg aaagtcgtag gacaactggg aactcggcga
   100861 cgaagatgcg tcgaatcgcc gccgtgatgg tgcggttcgc cgtcatcgtt gtcgtaagac
   100921 ttaccgtagt gggggttaag gggcaccgag gcggacgcgg ccacgcgtcg cttgaaagag
   100981 gaggacgccc tatgtccgcc acggaagccc gcggtgccca tgatgatgtg tccgccggtg
   101041 cccccgagtg cgtggcggga ggagggtgga aggggaggag gatagtggtc cggatcgcct
   101101 tcggtatcat cgtctttgct gtagcggggt cgtcgtgcgg ggacgcaggg tcggtgatga
   101161 tgcgaggcgg cgccgacggt atcttccgcg agatggtatt cgctggcggc tgctccgttc
   101221 cgtgtcgacg gcgaggttgg acttcgctcg cgtcggaact tccgtggcac gggttcgtaa
   101281 tccagacaga agcgccgtgc gcgacgggcg cggcgttcgc gctcgctcag ggaagataac
   101341 gacggagcgt cgtgacggcc gcgtgagtgc agctccatgg ccgccgtcgc taggaaggtc
   101401 acgttcgggc acgctgatgt atatatagat gagaccgctg ccggggggcg ggtcaccggc
   101461 gccgtggaaa gtgaggctca gacggcggtc gccggcggca tgggcgcgtc gggcggtctg
   101521 attttgatgg agatgtggac gtttttggcg ttggagtgac actttttggt gaaacagcgg
   101581 ctccagaggc tggcccagag cgcgtagctg tgctcggtgc gcaggtcgat gaacacctgc
   101641 acggtctctt gcgggttgcg gtgcgtgtag ttgagacagc gaaaatcccg cgtgcgcgcg
   101701 ccgtcgcgcc gcttgacggc cacgcagcag gcgccgtggg gctgaaagag gaggacgtgg
   101761 ggcgcggtaa actgctcgct gacgtgcggc tcgtagtgtt gcgtgaggtg ctcgagcagc
   101821 ggcggccaca cgcgggtgac gacgagccgc tgcaagtccg tgtcggaaat cgcagcggca
   101881 gtggcgccgt cgccaccgta caggtgatag gcgagcacct cggtgagacc gcggcgtcga
   101941 taacgcgtca cgttaagcga gcgcgtctcg ataaagttgg cttcggtcga ggggcagatt
   102001 ttgtcgcgta cactgagaat gacgcgtggc ggcggcgaca ggggcaacgc gggcaggtcg
   102061 tgcggcgggt ggtggtgaag caggttacgc agatccagtt gggcgcgcac aaagcctagc
   102121 gggtgttcgc ggtaggcgtc gggcacgatg aacagcggca acagacggcg atgcatgaaa
   102181 tagccgtcgt cttggtccat tttatacatg tagggcagac gtacagagcg tccatggtgg
   102241 tagatgcctg tgtctaggct gctctcggga tgcgagatgg ggtccagcag cgtgtgcagt
   102301 tcggcgtcga gacagacggc gtgattgagc acctgcgcca cggcgcgtaa aacgctgggg
   102361 tgtacggcta cggtgcaggc ggggaacggc gtgatgatgc gcagccccag tttgcccttg
   102421 cagcggcagt aagggggtga cgtgtcaaca gaggacgttg ttttttgaaa aacgccgtta
   102481 tccgggacgt tatttttatt ctctttcccg tcttcgtctt cctctgtgtc gcgctcgtcc
   102541 cggtaatcga gatagtcgtc gtcatcgaaa ggcgcgccgg ccgcgtccac gggcacgctg
   102601 ttgggtgggc acgcgctttt gaagaaatag accgggtgcc ggtcggggtg cgtgtagcca
   102661 aagaggctcg cccatacggt catccagacg cgtcgtagtc cgcgacataa ctcaaagacg
   102721 gtgtgtcgcg ccagaccgga gacgccgtcg cgtagccgta aatcaaagtc ggccacaaaa
   102781 ttgaagacgg gcagacgttc gttgaagact tcgtgtcgcg tgtagtagaa ctgtgtctcg
   102841 gggctggtgc tggccacgtc gtcgtcgtgt agccacacgg tctcggtcag ggcctcgtcc
   102901 gagaaacggc tgtcgggtac gtgacggagc aggtcgcgcg gaaagaggct gcgatgccag
   102961 gtttcggagg ccacggcgca gaagacgtgc tggtcattgg gcaggtgtac gcggtagacg
   103021 ggcagcggtc gctccagcag cggtgccagc gcgggctcgg gtagcaggta gcgacgttgc
   103081 gagtaacgcg ttagcgtgcc ggtggtgtag gtctgggctg tgcgcagcga ggcgcataga
   103141 cgtaacaagc cggacaggga gcgttccagc ggcgagaaga cagactcgga aagcgtgttg
   103201 atgcgttcga gctggcgcgc cagctgcgtg gaggtgccga agaagcccgc caggtgcgtg
   103261 ccgtcgatgc ggccgccgta gccggccagt cccagaccgt gcgggctggt cgccgagtgg
   103321 ggggattcgt cgagacgcag taggtgcgtc tccacgtagt cgtgtagaaa gttgtcgagc
   103381 gagaagtatt tttgcatgac gtccagcagc tcggtggaaa gccggcgccc cagaaaaccc
   103441 ggttcgcgcg tgcactgcgc ttcgggcgcc gcgtcagcgt cgtaagccac cacgcgccgg
   103501 tactcgagca accgcgcgcg tgccagcgcc gtgcggtagg ccaggtagac gtagtgcacg
   103561 cagaccgtgt cgggcagacg cgcacgttcg cggaacgcgt tgatctgcgt gtccacctgc
   103621 tctagctcgg tgtagtcgcg gcggttgcgc gccacggcgt acgccacgaa agcagacacg
   103681 cgctgacgga agggcgagcc cagtagcaga cgcgcgaact cgcccatgga ggcgtgcgtg
   103741 gggatgatgg tgcccaggtc gcgcgtgcag aagctgcgca cgtactcctc cacggtggag
   103801 atggtgctgt actggccctc gaataggtag taggccatgg tcagcagcac ctggccctcg
   103861 gtgtgcccga agacgctgat gaaccacgag ggcgaggtgg ggcagaggaa gacctggttg
   103921 agatgacgta gcacggccgc gtggtgaaag tacaccaggt gcttgaattc gcgcacctcg
   103981 ccgccgtgtt cgggcgagag cacgggcgtg cggaagagat gccggtagag cggctgcgtc
   104041 tcggcctcgt ccagactggc gataagcgcc gagaggggga tgggctggcg cgcggccagg
   104101 tagcgcgaga gctgcagcgt ttcgttgttc acggcgaaga cgggcgccac ccgccgcgag
   104161 tccgagcact tttgcgtctg taggcagaaa taaacacgtc gcgagacctg gtgtttgacc
   104221 agcaggggga agacgcagtg gtccgtcggt gtctgcgaga gtacgttggc gactatatga
   104281 gcagaatcat actctgttgc gaacagaacg agcgtcatcg tcgcgccggc acgatgcagc
   104341 tagcccagcg cctgtgcgag ctgctgatgt gccgtcgcaa agccgcgcct gtggccgatt
   104401 acgtgctgct gcagcctagc gaggacgtgg agctgcgcga gctgcaggcg tttctggacg
   104461 agaactttaa gcagctggag atcaccccgg ccgacctgcg aaccttttct cgcgacacgg
   104521 acgtggtgaa ccacctgctg aagctgctgc cgctctatag gcaatgccag agcaagtgcg
   104581 cgtttctcaa gggctatctc tcggagggct gtttgcctca cacgcggccg gcggccgagg
   104641 tggagtgcaa gaaatcgcag cgtatcctgg aggccctgga cattcttatc ctcaaactgg
   104701 tggtgggcga gtttgccatg tccgaggccg acagcttgga gatgttgctg gacaagttct
   104761 ccacggatca ggcctcgctg gtggaggtgc agcgcgttat gggcctggtg gacatggact
   104821 gcgagaaaag cgcgtacatg ctcgaggccg gcgcggctgc gacggttgcg ccaccgacgc
   104881 caccggcggt cgttcagggg gaaagcggtg tccgcgagga cggggaaacg gttgccgccg
   104941 tgtcggcctt tgcctgtccc tcggtttcgg actcgctgat ccccgaggaa acgggggtca
   105001 cgcgtcctat gatgagtttg gctcacatta acaccgtctc ctgtcctacc gttatgaggt
   105061 tcgaccagcg gctgctggaa gagggcgacg aggaggatga agtgaccgtg atgtcgccgt
   105121 cacccgagcc cgtgcaacag cagccgccgg tcgagcccgt gcagcagcag ccccagggac
   105181 gcgggtctca ccgtcggcgc tacaaggagt cggcgccgca ggagacgctg cctacgaatc
   105241 acgaacgcga gattttggat ctcatgcgac acagccccga cgtgcctcgg gaggcggtga
   105301 tgtcaccgac catggtcacc atacctcctc cccagatacc ctttgtgggt tccgcgcgtg
   105361 aactcagggg cgtgaagaaa aagaaaccca cggcggcggc cttgctgtcc tccgcgtgaa
   105421 cagcctggca cgttttggaa aacgtacgtg atcacggaca cgacgagtac ggggtttctc
   105481 atagacgtac tttattaggt cagggatgac ggggaggttt cgggccgacg tcaaaaataa
   105541 cgtcattcgt gttgacaggg ctttctgcgt cggagctctt ttcatcttct tctgtctcgt
   105601 cgacgtcatc gtctaccggc gagggtgtcc gttgcagcaa cgcgtgctcg ggcgtgtggg
   105661 tgaaaccgat gtcgggggtg ggcggcacga tcatctgtcc tagggggtga ctgcccaccg
   105721 gcagataggt aaagcggtgg gtggtaaaaa ccgctttggc tacggtggtg tgtggggaga
   105781 tgcagacggt ggtgtgcgaa gtgttgacca ccgtcacgcc ggccgcggta cccgggagcc
   105841 agatggtggg tcggatgatg agatccgact gactaaactg gcgcacgccc actatgaggg
   105901 cgcagatacc gggcgcgtgc acgtaggccg cgtcaaaata gacggtttgc gtgtgacccg
   105961 gaccgatcac cagcgtctga cgggtacgta atgaaaagaa acggtgttcg ttgggcggcg
   106021 gcaagttcat gagctgccag ggttctggca caaaacaggg gaaaacgccg atatcgcctt
   106081 cgatggtgcc cggaaagatg gactgaaaag tgtcgttgag gttgacgaca tccaactgcg
   106141 ggacttgcag cccggattcc agcagctcgg gcatgcaaac gaattgcgcg tccaggcatt
   106201 tgtaaaaggt aatgccgaaa aaaccttcgg ggatatagag gctgacgccc agcgaggtgg
   106261 gcactttgcg ctcgcgtgat agccaaatga tgtgtttatt gtaaaaggcc agctgcgtgt
   106321 ggcattgttt gacgatgaaa ctggaaggca tccacttgta gggaactttg agcggtgacg
   106381 gtaatggcga cgacgcttca tcttctcccg gatgctgctc tttgtcgtat ttctcctcga
   106441 ccgattgggg cagcgtaaat gtggtttgaa aatcgctatc gctagcgaaa cgtacgcagt
   106501 aacgcatgtt gacggatttc tcggctagga tgatggagcc tgatgacggt gcggactctt
   106561 ccttcattat taacgtaggg gtctcccaga atcgctgaaa acgggagcgc ggcagccgcg
   106621 acagtaccag ttgagagtcg attcggtcgg tcaacatcgt aagcatcgtg gcggtggtgc
   106681 gatggagtgg aacacactag tactaggtct tttggtttta tcggtagcgg caagttccaa
   106741 caatacgtcg actgctagca caccgagtcc ttctagctct actcgcacct caacaaccgt
   106801 gaagtcaacg gctgttgcga caactagtac aactacggcg acaagtactt catcgacgac
   106861 tagtgccaaa cccggttcca ccactcacga ccccaacgtg atgagaccac atgctcacaa
   106921 tgatttttac aatgcgcatt gtacatcgca tatgtatgag ctttcactat ccagctttgc
   106981 agcctggtgg actatgctta acgctctcat tctgatggga gccttttgta tcgtactacg
   107041 acattgctgc ttccagaact ttactgcgac caccaccaaa ggctattgag ggtggataga
   107101 tttacagccc ggcggtgttc cggcggggta agatttccat acgcgggtaa ttggaggcta
   107161 aagttacgga ttttatctag aaacagcagc gagtctagat agtcccataa gggatctata
   107221 aacgttttct gaaacctcgt cgatggtgac gtaggtgtag tttcgttatt atcggaagcc
   107281 gtttcgtttt ccacggacat ggtttcgttg tagtataagg agctcatgtc aagagtgccg
   107341 taaatagtgt acggtgtttc gttacgaatc aatacgtgcg tgtttttcat aaattctgac
   107401 acggcggtac ggttacggtc tggtttacaa aagggttcat tccgataccg tagagtagta
   107461 tacacccatg tcgctagatc ccttaactgc gtggccataa tggacttcat aaagctgcta
   107521 tcaggacgat aagcaatcgt agatgtggga atccgctttg cgctggtggt aaccttataa
   107581 gtcgcgttag tagtgacgtt gagagcggta gacgttgtat aggaaaaata tggcgtagta
   107641 gtactctgag attttttagt ctttttttct aattgttctt tgactggcgc ttgtttacgt
   107701 tttagttttc gcatagtgtt tttcaacttg gtgccgttaa tatacttggg gacgcggaat
   107761 agattccggc tcatggcgtt aaccaggtag aaactgtgtg tgcagttgcg ttgtgcgtaa
   107821 cgtagaagta gggcggttaa acccaaaaaa taaatcgttt gactatctac gttaacttta
   107881 gtcggaccca cgtacaattt ggtattccaa cgtggtacat tgaaaaacat ggggttgaac
   107941 gtggtaaaat taccgcagcc ttgttcgcca gtatcattac gtttggaaac gtttaacatt
   108001 tcggaaagac aagtcattga aggcactgta ccacaagatg ggggtctgaa tgttatcgtt
   108061 ttagccgtat gattgtactg tgagtagacg tatttggcgg gttttctaag ctgggtacta
   108121 taaaaatcga accacagata ggttatacta tcgtttcgaa tgggacctgc tagaatgtag
   108181 tattgtggaa actgggtcat attcatagta agatttttaa cgtgttgtct agtcatattg
   108241 aagtattttg tataaggttc cctttctaat tgttttaaaa tctctaactt gaatttatct
   108301 agtttttgct tgcctatcgt agaaagtact gtacctaacc agtaacgtcc cggtggtctg
   108361 acgaccttac agtttattat agaaaataac aggacagtca gtgatataat aaagaataat
   108421 ttagaaatgc ttctcatgtc tccttttctc cccatgacag aggaggagac tccgcaccgt
   108481 ccgtctgcct tgtggtttgg cttgcctgcg tgtactcact gctgattctg gtcgttttgc
   108541 tgctcatcta ccgttgttgc atcggcttcc aagacgacct agtctcccgc accttggctg
   108601 tgtaccgagc ttgtatccag ggcccgatat gtaaccagac ccataacagt acctcgtaaa
   108661 taaagacgca cagacctcac gcatatagta ccatcacacc gtgtggcgtg tactttatta
   108721 caacgagcaa gagtgcccct aagtattggg gcccgtaccg ttttagaaga ttttgtgtga
   108781 atgtctttaa cttttctgtc ccttttctca taaactgtca ggttctacag tcagcatgtt
   108841 ttgagcatgc ggtagagcag atagatgccg atgatggccg atagcgcgta gacggacatc
   108901 atgaggagac gactgtcggt ggcgtccacg acgacgtcag ttacttctag gaccgtaccg
   108961 tttttcaaaa gcatgaggta gtgagttcgc ggagatgaga ccaccacttc gttgtaggga
   109021 tccagggcga aaaggacgtc gtccgagtcg tgcatgtaca tgatgttgat gacgccttgc
   109081 gtgtcgtcgt attctagcag ggcgctttgg caaaaggcgc agttttctag tgaaatgttg
   109141 agcgccgctg tgatgctgtg tgtggtgtgc atgttgcgcg ttagttcgca tttagtttga
   109201 ctgtccgttt gggtgatgat gaggctctgg cctacgacgg tggtggagac agggtaggag
   109261 atacctttga tcaggtactg gtttgttacg acataactaa cgtgttcgga gacggttagc
   109321 gcggagaagg attcgccgag cggcagacaa aacaggtcgg ggaaggtttc cagcgtgctt
   109381 ggttgcatgg tagataggat ggagagggcg gcgggaacgg tagcaggaac ggtggcatcg
   109441 gggaagagac gcgtgaggcg ttcgagcgag tgatcgcgtc gcccgctact ggaacagggt
   109501 gtgtacaggt cgctgaggta ttcgtggtgc ggatgagcta gcaactgcgt aaagtgtgat
   109561 agctcggcca atgaacagag gcccgtttct acgatgaaga tttcgcgtct ctccgtcgta
   109621 tgtaccaaca tggagtggac gaggctgccc atgaggtaga gttcttggcg cgcgaaggct
   109681 gaaagaaaag aggccaggtg cgttttgtgt aattgtaggg caaagtcggc gatctgtcgt
   109741 agtgcccact ggggaatgag atgttgctga ttctgtttag aaagtatgta gaccaggcgt
   109801 acgaggctgg tgatgtcggt gatctggtcc ggcgtccaga gggctcgttt ggccaggtcc
   109861 acggctgtgg gatatagcag caatgtggtg cgtggtggtg tttgtgagag gcaggtgatc
   109921 ataaattctt gtatttgtaa gagtgcggcc tggcggtcta gggctcgtgg gatggagatt
   109981 tcggtgccgg tctcttcttg tcgggctgcc gcgaacagtg ctaatgcgta ggcgaaggcc
   110041 atttctaccg tgcggcggtc caacatttga catcgaccgc ttttgagtac gtctacagcg
   110101 taacggtgaa agctgttacg taacagtgcg ctgaggtcca ggtagttgaa gtcgagtgcg
   110161 gcgtcgagaa agtccgagtc tttgagatag gagtgacggt ttagttgagc tttcttaact
   110221 agtaccagga gctcgtgttt ttcagtttgt cgtagtataa agttgtcgcg ttgatagggc
   110281 gctttgaaga gtacgcgtgg aagatgaccg aagataagca gcatgggtgt gtcgtcgtct
   110341 atagataccg taactacgaa gaagtcctcg gtcagtgtga ttttaacgta acgtagttcg
   110401 tccatgaggt aaaagccctg gtgcagacag ggcgtaacgg tgctaaaaag cagatcgtgt
   110461 ccatcaaaga ggatacaggt ctggttaaag tgtggccgat gtagtcccga ggtggtgtgc
   110521 gatcccttcc agtcgtgtgg agtggtttgg ggtggcatcc aaacgtgagg tattgacaga
   110581 tcaatgggcg gtggcacggt ggtgggctgc tgacccaggc tgtcttgtgc cttcagctgc
   110641 tgcgaaaaag atcggtagct ggccaggtct ttggatacca atgcgtaggt gttaagtctc
   110701 tgttggtatc tttctagggt ttcggtcaga tctacctggt tcagaaactg ctccgccaga
   110761 ggacccgcaa aaagacatcg aggcatatgg aatacatagt attgattata gctttggaaa
   110821 aagttgaaac tgatggcgtt ttccctgacg accgtgctgt tacggaggct gctgttgtag
   110881 gtgcactggg tggtgttttc acgcaggaag cggatgggtc tcccgtaggt gttgagtagt
   110941 aggtgaaatg cgtgagggtc cagcgcttcg gatgcggcgt ccgcgccata tcgttgcgaa
   111001 ggtaggtgac tgaggaggta gacggcgaag acagtgaggt agggggggag gccgggccgc
   111061 atagcgcggc tgcgccgctg ggttcagcgg cgtgatccag gtggtggttg gcgttacacc
   111121 cgagagaagg agagaaagga tcccaggaag gggcacccgg gtgtggcgct acgggttaca
   111181 aaagtcgcgt ctctgtctat ttaatacgat gtcattggcc gctgcgaagg aagaagaggg
   111241 gacacgcggg taagccatgc cgtccgggcg tggggacgac gctgattcga cggggaacgc
   111301 tctgcggaga ttgcctcacg tgcgtaagcg gatcggtaag cgtaagcacc tggacatcta
   111361 ccgtcgcctg ttgcgggtct ttccctcgtt tgtggccctc aaccgcctgt tgggaggcct
   111421 tttcccaccc gagctgcaaa agtaccgtcg ccgtcttttc atcgaagtac gattaagtcg
   111481 gcggattccc gactgcgtgt tggtattttt accgccggac tctgggtcgc gcggcatcgt
   111541 gtattgctac gtgattgaat tcaaaaccac gtactcagac gccgacgatc agtccgtgcg
   111601 gtggcacgcc acccacagcc tgcagtacgc cgagggcctg cgccagctca agggcgccct
   111661 ggtggacttt gattttctgc gtctgccgcg cggtggcggt caggtctgga gcgtagtgcc
   111721 cagtctggtt ttttttcagc aaaaggccga tcgcccatcc ttttatcggg cttttcgttc
   111781 gggccgtttc gacttgtgta ccgattctgt cctggactat ctgggacggc gtcaggatga
   111841 gtctgttgca caccttttgg cggctacccg tcgccgtctt cttcgagccg cacgaggaaa
   111901 acgtgctgcg ctgccccgag cgcgtgcttc ggcggttgct ggaggacgcg gcggtggcaa
   111961 cgcgcggcgg gggctggcgc gaggatgtgc tcatggaccg ggtgcgcaaa cggtatctgc
   112021 gtcaggagct cagggatctg ggtcacaggg tgcagactta ctgcgaggat ctcgaagggc
   112081 gcgtgtccga ggcggaggcg ctgttgaacc agcagtgcga gctcgacgaa ggaccgtcgc
   112141 cgcggacgct gctacaacca ccgtgtcgtc cgcgttcgtc gtccccaggg accggcgtgg
   112201 caggagcttc cgccgtccca cacggtcttt atagtcggca cgatgccatc acgggacccg
   112261 ccgccgcccc gtctgacgcg gttgccccgt ctgacgcggt tgccccgtct gacgcggtcg
   112321 ccgcgtcagc ggccgccggt gcttcttcta cctggctggc gcagtgcgcc gagcggccgt
   112381 tgcccgggaa cgtacctagc tactttggaa tcacgcagaa cgatcccttt atccgctttc
   112441 acaccgattt tcgcggcgag gtggtcaaca ccatgttcga gaacgcctct acttggactt
   112501 tctcctttgg tatctggtac tatcggctca agcgggggtt gtacacgcaa ccacggtgga
   112561 aacgagtgta ccatctggcg cagatggaca acttttccat ttcgcaggag ctgctgctcg
   112621 gcgtggtcaa cgctttggaa aacgtgacgg tgtatccgac gtacgactgc gtactatccg
   112681 atttggaagc cgccgcttgt ctgctggccg cctacggaca cgcgctttgg gagggccgcg
   112741 atccgccgga ctccgtggcg acggtgttgg gtgagctccc tcagctgttg ccgcgtctgg
   112801 ccgatgacgt aagtcgtgag attgccgctt gggaaggccc tgtcgccgcg ggtaacaact
   112861 attacgcgta tcgcgactcg cccgatctac gttactacat gcccctaagt ggtggtcgcc
   112921 actatcaccc gggcactttt gatcgtcacg tgctggtgcg gcttttccac aaacgcggcg
   112981 tcctccagca tttgccgggc tacgggacga taacagagga gctggtgcag gagcgtctgt
   113041 cgggccaggt gcgagacgat gtgctttctc tctggagccg acgtctgctg gtcggcaagc
   113101 tgggtcgtga cgtgcccgtc tttgtgcacg aacagcaata tctgcgttcg ggcttgacct
   113161 gcctggctag cctgttgctg ttgtggaagg tgaccaacgc ggatagcgtc ttcgctccgc
   113221 gtacgggcaa attcacgttg gccgacctgc tgggttcgga cgctgtggcc ggcggtggat
   113281 tgcccggggg gcgcgcgggc ggcgaagagg agggctatgg gggacggcac gggcgggtac
   113341 gtaactttga gtttctggtg cagtactaca tcgggccgtg gtacgcgcgc gaccccgcgg
   113401 tcacgctgtc gcagctcttt cccggcctgg ctctgttggc cgtgaccgag agcgtgcgca
   113461 gcggctggga tccctcacgt cgcgaggaca gcgccggagg tggcgacggc ggcggcgctg
   113521 tgctcatgca gctcagcaag agcaatcccg tggccgacta catgttcgcg cagagctcca
   113581 aacagtacgg cgatttacgt cgcttggaag tacacgacgc cctgctcttt cactacgaac
   113641 acgggctagg gcggctgttg tcagtgaccc tgccgcgtca tcgtgtgtcc actctgggct
   113701 cgtccctctt taacgtcaac gatatttacg aactgttgta ctttttagtg ttgggttttc
   113761 ttccgagcgt ggcggtgttg taatttccac cacgtgtcgc ttgctgcata aagggcgagc
   113821 gtccccggag agggtatatt cgttcggaga gagcgggcgg cggtggtggg tatgtcccct
   113881 tctgcggaga agactacctc agtcaccgat tccatcatgc tcgctatcgt gaatttcaaa
   113941 tacatgggcc cgttcgaagg ctactctatg tcggccgatc gcgccgcttc ggacctgctc
   114001 atcggcatgt tcggctccgt tagcctagtc aacctgctga ccatcatcgg ttgcctctgg
   114061 gtgttgcgtg ttacgcggcc gcccgtgtcc gtgatgattt ttacttggaa cctggtactt
   114121 agtcagtttt tttccatcgt ggctaccatg ttgtccaagg gtatcatgct gcgtggcgct
   114181 ctaaatctca gcctctgtcg cttagtgctc tttgtcgacg acgtgggcct atattcgacg
   114241 gcgttgtttt tcctctttct gatactggat cgtctgtcgg ccatctctta tggccgtgat
   114301 ctctggcatc atgagacgcg cgaaaacgcc ggcgtggcgc tctacgcggt cgcctttgcc
   114361 tgggttcttt ccatcgtagc cgctgtgccc accgccgcta cgggttcact ggactaccgt
   114421 tggctaggct gtcagatccc tatacagtat gccgcggtgg acctcaccat caaaatgtgg
   114481 tttttgctgg gggcgcccat gatcgccgta ctggctaacg tggtagagtt ggcctacagc
   114541 gatcggcgcg accacgtctg gtcctacgtg ggtcgtgtct gcaccttcta cgtgacgtgt
   114601 ctcatgcttt ttgtgcctta ctactgcttc agagtcctac gcggtgtatt gcagcccgct
   114661 agcgcggccg gcaccggttt cggcattatg gattacgtgg aattggctac gcgtaccctt
   114721 ctcaccatgc gtcttggcat tctgccgctc tttatcattg cgttcttctc ccgcgagccc
   114781 accaaggatc tggatgactc ctttgattat ctggtcgaga aatgtcatca gagctgccac
   114841 ggtcatttcg tacgtcggtt ggtgcaggcg ttgaagcggg ctatgtatag cgtggagctg
   114901 gccgtgtgtt acttttctac gtccgtccga gacgtcgccg aggcggtgaa aaagtcctcc
   114961 agccgttgtt acgccgacgc gacgtcggcg gctgttgtgg taacgacgac cacgtcggag
   115021 aaagccacgt tggtggagca cgcggaaggc atggcttccg aaatgtgtcc tgggactacg
   115081 atcgatgttt cggccgaaag ttcctccgtc ctctgcaccg acggcgaaaa caccgtcgcg
   115141 tcggatgcga cggtgacggc attatgagcg gcggcgctgt acggcagcgg ggagaaaagt
   115201 ggcagataaa tcacgtcagg ttcacacgtc gttagccagc gtcggcatat gaagggcgcg
   115261 ggcggccagt acggcctctg ggctgagaca ggacgaggca gggtgagaaa gaggaggatg
   115321 ggggggaccg gggtggtggt gctgctgctg ttgtgggtgc ggacggtgcg ggtgccggga
   115381 caacgtgccg gcgaacgttc tgtaatcttc cataataaag gtaaaaatgc ccgtctcgtg
   115441 tcgactccgc tgtatctcga aggcatcggg ggtaatgcgc atcttgccgg tgccgacgag
   115501 ataaaagtac cacatttttt gacagatgat gcgaatcaag ggttcgtacg cttcggcacc
   115561 ccagtggcgc gtgaagaagg ccgccagacg aaacaagcgg tgtccgtaga gcgtgcctag
   115621 ggagaagagg atgttgccgt tgcgcgccag gtcttcgggg aaaacgaccg gcaggccggt
   115681 gtggcgctgc acaaagcgcg tcagcagtcc gccgctcaag cgcgggtgac acaggcgctg
   115741 gctgagacgg gcggcgcgcg tttcatcgaa cacggccgcc tcaaagtcca gccccgggaa
   115801 ggcctggcgc agttcgcggt acagatgagg ccagtagggt tgcggcgtct tgcggctaag
   115861 cacggcgtgg tccgagacac ccaggttgtt catggtttcg cgcagtagca gcgtttcgag
   115921 accgcggtga aagaggagga cgcagatgag gcgtacgatt ttgagttctt ccaaacgcag
   115981 cgagctcagc ggctgtccgc gcgacatctt ctcgctaatc tgtaatatta gatgattggc
   116041 gcaagtaaag gagaatttgc ccgtgcggac ccgcgggacg gcggggttct cttcgtcgcg
   116101 ggccatcatc gttcgctcgg tgagcgggta gtgacggtga cgacaatgac gatggacgag
   116161 caacagccgc aggctgtggc gccggtctac gtgggcggct ttctcgcccg ctacgaccag
   116221 tctccggacg aggccgaatt gctgttgccg cgggacgtag tggagcactg gttgtatgcg
   116281 cagagccagg gacagccttc gttgtcggtc gcgctcccgc tcaacatcaa ccacgacgat
   116341 acggccgttg taggacacgt tgcggcgatg cagagcgtcc gcgacggtct tttttgcctg
   116401 ggctgcgtca cttcgcccag gtttctggag attgtacgcc gcgcttcgga aaagtccgag
   116461 ctggtttcgc gcgggcccgt cagtccgctg cagccagaca aggtggtgga gtttctcagc
   116521 ggcagctacg ccggcctctc gctctccagc cggcgctgcg acgacgtgga ggccgcgacg
   116581 tcgctttcgg gctcggaaac cacgccgttc aaacacgtgg ctttgtgcag cgtgggtcgg
   116641 cgtcgcggta cgttggccgt gtacgggcgc gatcccgagt gggtcaccca gcggtttcca
   116701 gacctcacgg cggccgaccg cgacgggcta cgtgcacagt ggcagcgctg cggcagcact
   116761 gctgtcgacg cgtcgggcga tccctttcgc tcagacagct acggcctgtt gggcaacagc
   116821 gtggacgcgc tctacatccg tgagcgactg cccaagctgc gctacgacaa gcaactagtc
   116881 ggcgtgacgg agcgcgagtc gtacgtcaag gcgagcgttt cgcctgaggc ggcgtgcgat
   116941 attaaagcgg cgtccgccga gcgttcgggc gacagccgca gtcaggccgc cacgccggcg
   117001 actggggcgc gcgttccctc ttcgtccccg tcgcctccag tcgaaccgcc atctcctgtc
   117061 cagccgcctg cgcttccagc gtcgccgtcc gttcttcccg cggaatcacc gccgtcgctt
   117121 tctccctcgg agccggcaga ggcggcgtcc atgtcgcacc ctctgagtgc tgcggttacc
   117181 gccgctacgg ctcctccagg tgctaccgtg gcaggtgcgt cgccggctgt gccgtctcta
   117241 gcgtggcctc acgacggagt ttatttaccc aaggacgctt ttttctcgtt acttggggcc
   117301 agtcgctcgg cagcgcccgt aatgtatccc ggcgccgtag cggcccctcc ttctgcttcg
   117361 ccagcaccgc tgcctttgcc atcttatccc gcgtcctacg gcgcccccgt cgtgggttac
   117421 gaccagttgg cggtacgtca ctttgcggat tacgtggatc cccattatcc cgggtggggt
   117481 cggcgttacg agcccgcgcc gtctttgcat ccgtcttatc ccgtgccacc gccaccatca
   117541 ccggcctatt accgtcggcg cgactctccg ggcggtatgg atgaaccacc gtccggatgg
   117601 gagcgttacg acggtggtca ccgtggtcag tcgcagaagc agcaccgtca cgggggcagc
   117661 ggtggacaca acaaacgccg taaggaagcc gcggcggcgt cgtcgtcgtc gtcctcggac
   117721 gaagacttga gtttccccgg cgaggccgag cacggccggg cgcgaaagcg tctaaaaagt
   117781 cacgtcaata gcgacggtgg aagtggcggg cacgcgggtt ccaatcagca gcagcaacaa
   117841 cgttacgatg aactgcggga tgccattcac gagctgaaac gcgatctgtt tgccgcgcgg
   117901 cagagttcta cgttactttc ggcggctctc cccgctgcgg cctcttcctc cccgactact
   117961 actaccgtgt gtactcccac cggcgagctg acgagcggcg gaggagaaac accgacggca
   118021 cttctatcag gaggtgccaa ggtagctgag cgcgctcagg ccggcgtggt gaacgccagt
   118081 tgccgcctcg ctaccgcgtc gggttctgag gcggcaacgg cagggccttc gacggcgggt
   118141 tcttcttcct gtccggctag tgtcgtgtta gccgccgctg ctgcccaagc cgccgcagct
   118201 tcccagagcc cgcccaaaga catggtggat ctgaatcggc ggatttttgt ggctgcgctc
   118261 aataagctcg aataagagag acgctatatt tagggcttcc ctctcttttt tttctacacc
   118321 atgataccct aataaagcac accgcggtta ttatcaacgt ctctgtattt ttattattta
   118381 gaaataaata cagggaatgg gaaaaacacg cgggggaaca acaaagaagt ctctctctag
   118441 atgcggggtc gactgcgtgg ggtgctggaa gtggaagcgg tgctgatggg cgagggtcgt
   118501 ggcgcgggca cggaccgcaa cgtgctgctg atgtctgccg cggtacgcac gtcgccgtcc
   118561 atgtcgctgc gcagataaga ggtaggtcgt agtgcgccat gctgcacgct caccgttaat
   118621 ggtaccaggt cgtccaagct cgcaaagacg tgccacgagg ggatgacgag tgtgagagcc
   118681 ccgttgttac cgcttcggcg tctttgtccg gtcagaatca gtgcccggga cagtccggct
   118741 tgggtgtccg agtcctcgtc accgctggcc tcctcgaagc cggcaaacat ggcttcggac
   118801 aggggggttg gcgtcggtgt ggaggagagg tcatcgtcgt cgtcctcttc ctcttcttct
   118861 tcctcctctt cctcggtggg tggtaatccg ggggactgcg ggagaaactc ggagacggcg
   118921 ccgcgcatga cgttgctccg tggaaagaga ccggcgcgca gctgcacctg gggacgcttg
   118981 atcttgtccg gtttaccggg tgtgagagtc caaaacccac ggcggaaaaa atggatgcgg
   119041 cctagcggct gtcggtgttc caaatgaacg gcctgatcgc cggtcagcgt gacgcggagg
   119101 gtgattcgca cacgatcggg tagcggaccg gcttctatgg agacgcccgg gatgttttcc
   119161 gggaaaaaaa tggtgtcgtg agtctgattg gtctcaaaag cattctggat ctgcacgatg
   119221 tattcgggat gtatgcgcgt cagcgtaaaa cttttgggaa tcaacagctg gaagccgttg
   119281 tccggcaagc gtcgtaggtg cgggtacgga ttgtgtcgcg ccaccacctc ggcgcgatgc
   119341 gtgtaaaccg aaaagtgcag aaacacgctg gtcggcgggt gcggtgagtc gtgatgcaga
   119401 aacagcatga tccattggcc tcgctcgtcc gtctccgttt tgtggatgta cgtgttaggg
   119461 tccgaacagg ccagctgctc cagggcgtct accagcgtca gcgggatagc gccggcgcga
   119521 aaggcgaact ggctgacaaa gatctggccg gcctccaagc tgctgtcggt tctgcggcgc
   119581 cagttcggcg ttacggtcag tcgcacggcc cagtagtgag ccgtgcggcg gatgatggct
   119641 cgggcctcca ctcgcggccg attttcttcg ccgccgcgtc gctgactctg aaagaggtgc
   119701 agtccgctga cgggcacgcg atccagcggc agcgcaaagg ccagcaccga gaccgtgttg
   119761 ttttctgagc ctggcgtcag gcgtcgtggg ccaaagttgt tgaggtccac cagcagtcgg
   119821 tcctgttcgc ccaccacgca gcggcccttg atgtttaggt cggtcaggtc tacggtgtcg
   119881 tgcggagatt tgttctcctg aaaacagcag agaaccgagg gccggctcac ctctatgttg
   119941 gtacgcaggt ccaggagtcg cagacgaccg gcttccagcg agccgccttc cacgttggtg
   120001 atgagccgaa gcacctggca gtgcaggcga ccaaagcttc cgctggcggc ttcagcctcg
   120061 ctgatcgcgg ccgcttccga cgagggtccc tcaccgggcg aggacgatgc ctgagacatc
   120121 gcgaaggcgg gatgggggga gggtcagggg atgcacaaag gtaaacgggt tcttcgtggg
   120181 aggtcgggaa gggttccggc aactgtcgca aatatagcag cggcgacagg tgtggcgctc
   120241 aaaagtcgcg tgtctgagtg gacgtgggtt tttatagagt cgtcttaagc gcgtgcgcgg
   120301 cgggtggctc aacctcgatg ctttttgggc gtcgaggcga tgcatggccc gggcagggct
   120361 tcttgccggt ggcggcgacg tttgggttgc gcagcgggct gccatacgcc ttccaattcc
   120421 gcgaagatgc ggtagatgtc gttggcgtcc cagaagaact cctggtactt cagattctga
   120481 ccctgaaccg tagccaccat gggcaccagg ttgcgggcca ggatgccggc ctgccagggc
   120541 ggccaggtga acacggccgg attgtggatt tcgttgtcgg aatcctcgtc ggtgtcctct
   120601 tcgggcgcga cggtggactc ggccttaagg cggccgcgtg tcataacgcc cgccgtgcac
   120661 gccgtcgccg aggatgctga tttgcgtttg cggcccgcgg aagtagaggc gcccgccatg
   120721 gcgccgccgc cggtgacgcg gggcgtcttg cgctcggtgg ttacgagttc ctcgtcggag
   120781 tccgatccgc tggtccagac gtcgtcgtcg ccctgggcgg caccctcgtc gtgccggtcc
   120841 caggtgtgtc ggtactcaag cttgccctgg atgcgatact ggttggtgaa ggtggggtgc
   120901 tcgctgtact gaggcccgcg ctgcagcagc aggtcgatat cgaaaaagaa gagcgcggcc
   120961 acgggatcgt actgacgcag ttccacggtc tcgcgtatcg cttgcacctc caggaagatc
   121021 tgctgcccgt tcatcaatag gttacctgag atgctcagcc ccgggatgct cttgggacac
   121081 agcagcccaa aatgctcgtg tgaggtaaaa gccacatcca gcatgatgtg cgagatcttg
   121141 cccggtttga ttatcatatt tttgggacac aacaccgtaa agccgttgcg ctcgtggggg
   121201 cgcatgaagg gttgcgggtt gcgggtcatc gtcagatcct cttccacgtc agagcccagc
   121261 gtgacgtgca taaagagctt gccggagggc acgtcctcgc agaaggactc caggtacacc
   121321 ttgacgtact ggtcacctat cacctgcatc ttggttgcgc gcgtgttctc catggagcaa
   121381 accagctcgt gcgcgcacac cacgtgccgc agtgccacgt ccttggtggg aaacacaaac
   121441 gccgacgtgt agtagacgtc gggctctttc cactggttct gctgacgcgt ccaggccagt
   121501 ccagagaccg tgagacgcgc ctgccacatc tgcttgcccg acgcgtgaat cacagcgtca
   121561 gctacgggca ggtgtcggtg tttgcgctcg gccgccgacg ggtagtggtg cacgttgatg
   121621 ctggggatgt tcagcatctt gagcggcagc gcgtacacat agatcgacat gggctcctgg
   121681 ctgggacaga tgctccggcc cgtggggttg tgcacgttga ccgatacgtt ctccacctcg
   121741 ctgcccgtaa agtacgtgtg ctgcacctgc agctgattgt cgccgcggtg gcatggcgtc
   121801 gagtcgggcg tgtactgcga caccaggatc agcgagggct ggctcacgcg cacgtggata
   121861 cccgtctgca ggagtcgcgt ctcgtgcggc agcaccggcg tgtcgccgcg actaaacacg
   121921 gctttcagca cgtgccccga aatgggaccc agtacggata tcatttcggg acaacggcga
   121981 ccgcgcgact ccatgctgcc tgcgcgtacg ggtgtaggcg actgagcggc gcgccctctc
   122041 cggccgccgc cttacatagg caggcgacca gacgcggaac ccgaaataaa aacgttctac
   122101 acagagacaa ccgcggatta ttgagtgtct ttttttatta aaaaaagagg caaagcccca
   122161 ccgtcaccac accccatcac acaccaccac cgattttttt gttttaaccc cgtatcgcgc
   122221 ggacgcctag tgtccgtttc ccatcaccag ggtcctctgt ttagagatcg ccgcagacca
   122281 tggctaaagt gacaggactc gttttatctg tcgtattttc cgtaagctta cagttttgcg
   122341 gttccgtctc cggggacgcc agccgcatgg gcagcaggtc ctccaacgcg atggaagcgc
   122401 ccagcaccga gagctgctgt tgcgacggcg aatgggacgt ggaccgcgag tgtagcgtgg
   122461 atttgacttg gtgcgtcatt gctgacaggc aaccgcgatt cagcgtatgc tttgacgaga
   122521 taaaatagag gcgccccagg agcgcgtccc gtgggaacgt ggcgccattc tcgtcgctca
   122581 ccagtacggt taattccaac caggagcgcg gtagccagac cgtaacgggc attttgagtc
   122641 cctgacggtt gtgtggtaca aaaacaccta gataaggccc gtaaaagcgg cggtagatac
   122701 gtaacgtgtg cgagttcttc agcgtcaatt cgtaagggac gcgcacctcc agtccctcgt
   122761 ccgccgcgcc ggagcgtggc ggtacaaagt aaggcagtgg cgcgtccgaa aagaagggtc
   122821 gtcgcaccgt ttcgcgtcgc agccgcaggc gaaacgccac tgggtcggct ggcgcctcgg
   122881 tgcggtcgca ggtcacgttg aaacgtaaca tgccgtcttg gtatagcgtg agtgacgaca
   122941 gcgtcaggtc cggcggtgat tcgttcgggt ctagctccaa tcgtccaaag acggagggtc
   123001 ccaatgtctt ggcagtggtt tccgagaggc gcgccgagat acggctggtg agtccacgcg
   123061 gccccgagat gccgccttcc actcgatgcc agcacagcgc gtgtcgtacg cgcaccgtca
   123121 gcgtgggcgt cagatccgcg tccgttgatt ccgcggcatc ggcggcggaa gccgcgttct
   123181 ccgttacgtt gtttatatcc agcgtcggct cgaacgtgag ttctggcaga tgcagcgcca
   123241 gacagtcgtg taacgccgtg tgatgcgcgg ctttacgtcg tagcggtagc cgtttcagca
   123301 gcggcgtgat gatacggagc gcgaagagat tgagtgataa gcgcacgatg gccatgcgcg
   123361 tcagttgttg gtcgattacc gagcgcagga tatggcagcc tgggcgtgcg ggaaagagag
   123421 agaaggccgg gcgcacgtca gaatcctcgt tagagaccac gcatagaatg ccgcgttcac
   123481 gatcgtcgtt gcggtcatcc tcgtcctctt ctttcttctc ttctttttcc ttttttttct
   123541 cgggctcgtg ggaagccgcc gtttcttctt cttgcgacgt cgcgggggcg gtttgagact
   123601 cgccgttcgc ttcccccaat tgcagcggcg tagagagcag aatctggaag ggatcccgca
   123661 attcttcggg tcggaggtcg aggtgcaact ggatcagatg gtaggtgccg cggtgcaccc
   123721 gaggctgacg gatgtcgtgt ttatccgtca gtgtgaggat ggtctgcggc gagccgctgt
   123781 gcttgtccag ctcgtccggc gttttcagga ggagactgtc gtcgtcggta ctggcgacgc
   123841 ccatcatggt cgtggtggta gtggtggcga ggaaagtgag cggcggcgcc gacagagctc
   123901 ggcgttggcg gcggcatttg ccgctgtgtc ggctgctatt gctgccaacg ccaccgccgc
   123961 cgcctcgtct ggctcgtggc cggcgggccc gattccgaag gttggggtcg acgcgtggca
   124021 tgcttggtgt ctgcgggcgc gagagggccg gctcagcctt taaatatgca ggtcgcggat
   124081 ttgttatcgg gtgaaacgtc acacaccgtg aagacgacct gttcgcggat gaggtcatcc
   124141 agctgtcgca gcatgacgaa aagcgccgac agccgcgcga tctcgtcgtc gggcgacacg
   124201 tgctgcggcc gcgcgggcgt gcgcggctcg ccgacgctgc gctcgcggtc cagccgcatc
   124261 agcagctcct ggcacttgac gagcagcatg gagctgtcct ctagcgccaa cttgcgcacg
   124321 taggtcatgg tcagctccga ggctagattg gccaccatgg acatggagag gcaggcggtc
   124381 ttcatgtcga tcagcaggtg ctggtcgatg accggatcgg ggatggtgaa ggtggcgtcg
   124441 cgaaaagtaa tggtctgcag ctgctgcacg gcagccttta cctcctcgta cgaacggtcg
   124501 agcgagaaga ggcccatgat gagtagtcgc tggttgattt ccagcgccag tggcatgggc
   124561 acgatccagg gcagcaccag ctcccactgg cccagcgtca gcaggttctc gcgcgccagc
   124621 ggtccgtgga agagcggcgg cagcacgcat agcgcgtcgc ccttctccca agtcacgggt
   124681 cccgtgttga ggacggtgta gagcagtccg tgcgtcggta cgtgtaggag gatctggttg
   124741 ccttctacgc gccgcatcaa cgtcagcgtc atattgcgca gcaggccgcg cagtcgcacg
   124801 tagccgcggg tgtgatctac gaactggtgt aggcccagct ggtagtgctt gatgagatgt
   124861 agacgctgcg gaatgggcac gactgccgct actagcttgg tcagtttgcc tacgtcggcg
   124921 atgctgagct tgtggtcgaa agtacagaag atgttggcct ccatggccgc catagcggcg
   124981 gtgaaatcgt ggccgcgacg gaggagaagc ggagacgaac aacgtctgca ccgggcgcgg
   125041 cgtcagagcg agcgtggcgc gtccgggccc gcgtttgcgt ctaggtgact cgccgctaac
   125101 ctgcggtcgt cgccgtcctc ctcaccggac ggcctcacga gttaaataac atggattgct
   125161 gcagcgggat gatttcgcct acgacgtagt taccaaagtg cgtctcggac gtggcgaaag
   125221 ccccggcgcc acccttgagt ttggtctcca tcagcgccag cgtggtggtg ctgagaatcg
   125281 gcaacgcttc ctgcgtcagg cggcacgggt tttcgatgag ttgttccgtg ccttcgacgc
   125341 agacgtactg cgtgtccgtg tcgccgcgga tgcagtcctt ggcgcgtagt aggtactcgt
   125401 cgatggtttt gaagagcgtt ttgttggccg cgataatctc ttctgtgtta aagtactgcg
   125461 cacaggggct gtagaatttg gagttgtagc ccaaacgttc gcgatgtcgg gtgttgtaca
   125521 gtacgtcgct tagacagccg gcttgcgagg cccaggggtt gtgtgtggcc gcgaaagtct
   125581 gtgcgtcagc ttcgcgatga tcgtagatgg ccttggtggc ggcttccgtg tcgtacggat
   125641 cgacgcccag catgcaggag gcgcgtccgc gcgggttgtt ggtgattttg aagtaattaa
   125701 cgtccatcgt taccggcgtg aggatgagtt cgcacacggc cttttgtccg tgcaccgtgg
   125761 cggcggcgtt gcgctcggac atgctgccga acgtcagcat ggagatggtc tccgtatcta
   125821 acagttgcgg ccgttccacg ccggccgcgt gccggatcca gcggtccacc tcgtcgtgcc
   125881 ggtacacgtt catagggaag acgcgaaaga ggtcttgcac gcggacgccc atgtcggtcc
   125941 gcacgcggtt tacgtaggct acgcaggtat ttgacgtgta acccagaccc atgtctacgg
   126001 tgttaatgtt ctgcgtgacg tggtacgtgg tgctgatgtc gcgttcctcc ttggtcacga
   126061 tgggattgtt gatgataact gacgtgcatg atttgccgct gtagagcagc atgtccacct
   126121 cgaaggtgtc ggtgcgtacg gccgtgagtg cgaatcccgg gtggatgtgc gccttggtct
   126181 gcagcaccag tgaaactggt gagattttgt ataacatggc ggccagcgtc ataactgagt
   126241 gcaacacgtt gggacaggtg gccgagtagc gcgaaaaggg cgagcgcagc cagttgtggt
   126301 actcgtgtgc gaaggctgtg ggtagcggaa aaccaccgtc gtgacggtga tagtgcggga
   126361 actcggtcac gtagcgttta atgtcgtcgc tcaacgccgc gcagatggtg gggtttgagt
   126421 agaaacggtg gaaaggtacg ggtaggctgt actcgatcag cgtcttaggc gccgtcacga
   126481 cgcagcagcc gttgtaaagc acgtgctgac gtgagataaa gtccggcagg ccctgacgtt
   126541 gcgcgtgatc cagaggcgcg cgcacttcga gcaccttgac gtgctcgccc acgaattgca
   126601 cggccaaaaa cagctcacga cacgcctgca gcagcggcgt atgcgcgtcg gtggcgacgt
   126661 cctccaccag ctcggtcagc atctcgccta cggcttgacg ttgcgccgct accgagtctt
   126721 cgggggtgac gccgcttgtg ctctctttcg acgtcgtacc tgacgtggag accgcggtgg
   126781 cggccggcat caggagaaac gccggtcggt aaaagaggtc tactagcagc gtcttgaggt
   126841 tgagtcccag gccgcaggcc cggttgttgg tcatggcggg tatgaggcag agataaaaga
   126901 ccttttgtaa cgtccattcg tcgtcggtgg cacggtaatc gtccacaaac agcggctcgt
   126961 cggcatccat ggcgcccaaa cgcggtacgt ccgaaacgcc gtggtgtcgc gcctcgatgt
   127021 tggccgggtt caacggttgc cggtcggcca ctacctgtac gccttccatg ttgcgcggca
   127081 ggtgcgtaac gaagggcggc cacagccggt ggtcgtgcag cgcgttcacg taagccgaca
   127141 gcggttcctc ggccagttgg ccgttgttga gtcccggcag cgctgagatg cgcgttacca
   127201 gacgcagtac ggcgaccaga ttgcggtagt gaaagagcaa ctgcggtggt agggcgccat
   127261 cagccaggtg ttcggcgatc aacgtcacca gcgcgtagct gtgtgcaaaa accagcagct
   127321 gacgtgtgtg aaacatgttg acgatacaac gtgctatgaa agcgcggatt agcaaaaaag
   127381 cgtcggcgtt gccgtgtacc agcacgtcga ccaggtagca gagctcgggg taattagggc
   127441 tggtcacggt ggttttgaaa agtcgcaacg tctcttcgta gtcgggtggt ggccgcagtc
   127501 gcatgtgttc catgatctcc caggtgcgca gttcgtggaa ggggcccggt gccagtccat
   127561 ctggcaaatt accgatgacg atacgcggtg tacacagcgc caccgtttcg ctgttttcct
   127621 ggcagtgcgt aaagtcgaag aaggggtgca gctcggtgta gagcgtgatg ttgcccacct
   127681 tgtagaagtc ggtgactaca aagtcctgct ttatttcgtt caccgtgcgc gggacctcgc
   127741 gtcgtacgcg gtaaaaatgc ggtatgcggc gcgccgcacc gcccatgggc tcttgctgaa
   127801 aacgacactc gagcagtcgt tgcatggcgg gttccgaggg cggtccgcgt tccgtgaagg
   127861 cctgcagaca gggcgcgggc tcgtgcagca ctgggtggca cagcgtctta agcgcgtcca
   127921 caaagtctat cttttgcacg gcacggtccc ggtttagcag gtaggccgtg gtgggcagcg
   127981 cgttgcggac ggtgtcgttg agcttaactt tgctttccac cgtggtgtaa ccgcgatcct
   128041 cgggcagata cagccctacg gggaagaaaa acgtcaggtc cacgttacgt tctagcggat
   128101 ctttggtatc ggtgtttttg tagacgcgcc gcaagttttc cataatcacc gttttttcgc
   128161 ccagtcgaat cacgtccatg cttagcggcg ttaggctgtg cgccccggcc tgcgaaagcg
   128221 agtcgttggg cagatgcggt tgacccgaag tcagatgggc cttgtatgag ttgaaatcgg
   128281 ccaggatcga gtgataggaa atggcggtga cggcgttttc gggactgagc acaaagttgc
   128341 cgtaggtggc cggcgccgag accgtctctt tggtgatgtg gcttgagagc agcgacataa
   128401 tgatttgcat aacgttggcc gtgcttacca tcacgccgct gaccttggcc cccgagctcg
   128461 tggtgtacgt ggtggggttg tctaggatgc tatcggtggc cgcttcggcc agacgcgtga
   128521 ggaacttgag cacatagtcg cgatcgcgcg tgcgattcag caaaaagagc gtggccagca
   128581 ttttggcctt gaagctctgc aagatgttgc ttcgctggat gcggttcagt gcctgtcgcg
   128641 ccagtgtggc gttttctacc agcgtctgca ccacaaagta cggcggcgcc ttgcgtagca
   128701 gtgtctgtaa aaagctgtga atcaagccgc gctccatggc gtcggccgtg tttttaagcg
   128761 cgcgcagcac cgtgtgcatg gcttccacgt tgaggatctt gtccaagatg gtgccctcga
   128821 atgtctcgcg cagatacgtg aggcaggctg cgctgagctc gaaggggatg gtgatggggg
   128881 atttttcact gtatttggtg accataatgg tggtctgacg actggtgggc aaaccggcgc
   128941 cgctggccac acgcggcacc tgcacgtgga acagcatttt gcccgtagtc agtttattga
   129001 ggtcgtggaa cttgatggcg tgcgccgccg cggccaagcc gctggtcaaa aaataaaccc
   129061 attccaggcg attgcagaag gtgccgaaga tggcttcgaa gtgaatattg taacgctcgg
   129121 ggtcgtcgcc gtagtagata cgtaaggcct cgaacatctc ctcgccggcg ctggtcttga
   129181 cgtgcgtcag aaagtcagtg ggaatgccta ctttaggcag gagctcgagc gccgaccagt
   129241 tctccatcgc ggcggcggcg tgagcgcgag gcgtcggagc tcggggaaag cagcgcgacc
   129301 cggagaatgg ccggcgctgc gccgcgccgc ctcggctgcg acgctctaat agtcgtcggc
   129361 ggctccgcta cgccgcgccg ggttttacac gtccccgtgc acgttcgcgc ctgcaacctc
   129421 acccaagagc tatcgacggg cgaggacgcc cgcttctgtc gtccgcgacc cgttaacgtc
   129481 gaacgggtac gcgctgtttt cgcggctctc taccgtgcct gtcccgtaca cgcgaggacc
   129541 gagtccgagc gtgtcaagct ggtactgggt cgtctgttgc tgggacccgt ggccgtaccc
   129601 tgtttttgcg acggtgaagt ggagggccac ggcgagcatc tggtacccac gacgcagttt
   129661 tgtcgcgggc cgctgctcta cgtgcaccga cgttgttgtt gcggatccgt gaccgccggg
   129721 cgcgcgctgt cctgccacgt tctcgaaaac cacgtggcaa cgcatgtgtt acgcggattg
   129781 ctctcgctga cggaatggaa tcgagagttg ccgggccttt tttgcgactg tcctggcggc
   129841 ggtggcgcct tgggaaccga cgaacgctac gccatggcct gcctgccgcg cgacctcagc
   129901 ctgcacctgg acgactatcc ttacctgatg gtggaaatcg gacgcgtact cagcgtcagt
   129961 gaggtagacg actacgtaac cgccgtctcc ggctacctgg gcgaggccgc ggcgccgcgc
   130021 attcaggttc actacaagct gctctttgga ctcaacgtgc gtccgcaagc gccgtgcgcg
   130081 ttggacgcta cacgcgactt ttttctgctg gagctgcaaa agctttggct gggcgttgaa
   130141 tatcaccacg aagtcacgtc ggagtttttc ggtcgcgtac tggctcagct gcatcgcgac
   130201 cgcgcccgcg tcatgatggc acttcgcttg cccgagcaga cggtgtgcca cctgagcacc
   130261 ttcgttctca gtcgcttcaa gcgacaggta ctgtacttca agttacaggt gagctacggc
   130321 aagtgccgga ctggccacgc tgacagaagt gggggagggg gaaacggtgg aagtcaggga
   130381 caccacaacc tactgtgtta tcgacgtctt agcgtcacgt ttgccgacac ggacacggtg
   130441 tggagaaacc ttttctacgt ttattatgaa ctagctcggg atctggggtc ccatgggaca
   130501 gaggaccgat ccgtaagccg cggttacggt gtttcttgcg ctccgaggac gtcgcggcta
   130561 ccaccgtcag aaccgacggt ggtttcagcc aacggacacg cgctgtcttc caccgcgctc
   130621 ccgacgacga gcgcgggtca caagctgtcg ctgccgcgcg acccggccgc agatcgcgtt
   130681 cgacgttacg tgtgcattat ctcgcgtctc atgttcgccc ggtatgggga gagatggcgt
   130741 aaacaccgtc gacggcggtc ggagacggga gaagaggagg aagagacggt ggaatcgggg
   130801 gagactgacg ccacgccgcc atttgacttt acggggcagc agctgcgccg ggcctatcag
   130861 gaacaccgac gtcgtaaaca tctagccgtg cagcgttacg cgccgtgccg tcgtaagctc
   130921 atcggcggga tggagtttgc cgaggtgacg ggcgttagtc tggaccgcat cgccgtcaac
   130981 gctttcaaca ccaaccgcgt tatcaatatg aaggccgcac tctcgtccat cgccgcgtcg
   131041 ggtctcggcg tgcgcgcgcc gcggcttccc aagaacatga cccacagttt tgtgatgtac
   131101 aagcacacct tcaaggagcc cgcttgcacc gtcagcactt ttgtttccaa cgacgccgtc
   131161 tacatcaact cgctcaacgt caatattcgc ggttcctatc ccgagtttct gtactcgctg
   131221 ggcgtgtacc ggctgcacgt taatatcgat cacttctttc tgccggccgt ggtgtgcaac
   131281 agcaactcct cgctggacgt gcatgggctg gaagaccagg cggtgatccg ctcggagcgc
   131341 agcaaggtgt actggaccac caactttccg tgcatgatct cgcatactaa caacgtcaac
   131401 gtgggctggt tcaaagcggc tacggccatt gtgccgcgcg tctcgggcgc tgacctggaa
   131461 gccattctgc tcaaagaact ctcgtgcatc aagaacatgc gcgacgtgtg catcgattac
   131521 ggtctgcacc gcgttttcac gcaactagag ctgcgcaatt cgtaccagat ccccttcctg
   131581 gccaagcagt tagtgctgtt tctgcgtgct tgcctgctca agctgcacgg tcgagagaag
   131641 cggctgcagt tggaccgcct agtatttgag gcggcacagc ggggtctctt tgactacagc
   131701 aagaacctca cggcgcacac caagatcaag cacacttgtg cgctcatcgg cagtcgtcta
   131761 gccaacaacg tgcccaagat cctggcccgg aacaaaaaag tcaaattgga tcacctgggc
   131821 cggaacgcca acgtgctgac ggtgtgtcgg cacgtggaag cccacaagat ccctcgcacg
   131881 cgcctcaaag tgttagtcga ggcgctgggc gcgttgcaga gtatcagcgg tacgccgcac
   131941 acgcgcgaag tgatccacca gacgttgttt cgattgtgct cgacggccgc agccacatcg
   132001 ggcctgtgtt catcccctcc cccattgtgt gtgtcctcat cttcctccgt cacttctgtc
   132061 ccaacctccg tcagcgttga cggcagttct gaacccacgt cgccgcgagc gcggtttgca
   132121 tcacgatgat ggaagccgcg gccgctgccg ccgcggcgtt tcgtccggag gagcgtccga
   132181 cgccgggttg gcacgacgcg gcgttgttaa tggacgacgg tacggtgcgc gagcacgcgt
   132241 ttcgcaacgg accgctgtcg caactgattc gccgtgtgtt accgccgccg cccgacgccg
   132301 aagacgacgt ggtttttgct tccgagctgt gtttttattg cagcggtcgt tttaaccgca
   132361 ggtcgtccgt cttttccatc tattggcaga agcatagcga tctggtgtac gcgcttacgg
   132421 gcattaccca ttgcgccaag ttggtggtgg aatgcggtca gttggggagt agtaggctac
   132481 ggtggcgcga cggtgatgcg agtggtgagg agcgccgggg agacgacgac agcagggacg
   132541 agctgtacga cgtgccgggt atttatatga ttcgcgtcaa cgacggcggc agcaccggcc
   132601 ccagacacgt tatttggccg ggtaccagcg tgctttgggc gccggacgtt gtgatcacta
   132661 cggtgcagcg acgaatctcg gcggcgcgcg ccctggtgaa cacgttccgc caatattttt
   132721 ttttgctgga acggcgctcg cacgaggagc tggttctttg tccgcccgag atggaggagc
   132781 gtctagcgcc gttgttgcag agtgctacgc gcggtgattc ggacatgttt gacggtgtgg
   132841 tggccagcgc ttatcaccgt ttgcgaatga gtaatattcc gcgttcatcc gcccgtctgc
   132901 tggagcactg cgtggggctg gcgggtgcta agaagctgct cttgctcgac gtgccgcgtc
   132961 tggagaacta ttttctttgt caagtctgtc tttacgagct ggacgaggac gagatgggcg
   133021 aggagatgct gggcatgttg gccggaaagc ccgaggatgc cgccgtctcg ggcgcaagcg
   133081 gcggttttct gctacatcgc aagacgatga agctggccgc ctgtctatgt ttgctgctca
   133141 attcgctgca tttgcaccag gaggcgctgg aggccttgga tcctccgccg ccgcgcgtcg
   133201 aggagaacga ccttgtcaac gtggtgctgc gccgttacta tcgcagtcac ggcggcgtgc
   133261 aggcgcggac gctggcggcg gcccgggctt tgttagccga ctacgccgaa acgttttcgc
   133321 ccttggggag ttttacgcgc ctgggttacg atcgtctcgt ttctgccgat gccggcgtca
   133381 gtcgccggca cctggtggct ctgctgcgtg cctagctgac cctgaaacgg atggcgtgta
   133441 tatcgtcaca caggtaggtg gccatgatga cggcgatgat aagatcgtcc gagatacgat
   133501 tctggcgctt ggccgagtag cgtgccgtcg tgccttcggc cagcgtgacg cggtgcaggt
   133561 tctgaatctg ctccagaaga tactcgatgg ggtcgtggct cagcttgatg gtgtaggaga
   133621 cgagctcttg cgaggctttg atgtagcccg agttgaaacg cgagatgaac tgttctacgg
   133681 ccagcgcctt gtcgcggccc atgaggtaga agggctgttc gatgtggttc tggtcgggcg
   133741 tgtggtagaa gagcacgcgg atgagcgtgc tactctgcac gctctgtcgg atgaggcagg
   133801 cgatgcgcac ggccgccgcc tggttagtgt tgccctccac ggcgatacgc agttcgtcca
   133861 ggtaagggtg taggctcagc accgagatga tcatgtgcgc cgcgcactcg gcgatggcta
   133921 cctcagaact ctcggagagg tcgcgcaaaa agaaatgctc taggccgtaa atgagaaact
   133981 ggtgtcggta ggcgcctacg gccgccacgc ccgtgcccga ggccttgcgg ttggtggtga
   134041 aggccgggtc cagatatacg tagagcgtct tgccgaaata atcgtaggcg ttggtgttga
   134101 gtgtgctgta acgcaaaata tcgaactctt cgcggctctg gtccgtgatg agcacggtgt
   134161 tttgcgagat cttattggta ccgccgatga tctcgtccat gaaggcgccc ggcataaaca
   134221 tgttggccgt cttgcgcacc tgcgagttga ggctgatgaa ggtgggcttg tgcagtcggt
   134281 agcaaggaca ggccgtggcg tcgcccttct ccgtgaagct gtgcaggtgc tcttcgcaca
   134341 cgtaagagac cacgttgagc atgtcaaagg gcgcattgtt gaggcgcgtc aagaaacacg
   134401 tggcgtcact ggtagtgttg gtggacgata tgaagatgat cttggtggta ttctgtgcca
   134461 ggaaccccag aatggtgttg aaggcctctt tcttgatgaa gtgcgcctcg tccaccagca
   134521 gcaagtggaa gttttgtcct cggatgctct gtgtagagag gagacagaaa agggactctt
   134581 atgattacgc acgctcggct ggaagcctac agagtcgggg tggggccgga caggtgagcc
   134641 aggtgagccg ccaggtgagg cgggatcgcc gtgtgccaac cgggctgcga cctgaaaacc
   134701 ggaaccaatc cgccgacacc ggcgccgcgt gacgcgcgcc cataaaaacg aaagtgtcgt
   134761 cgtcgcgacc cgccacagcc gccatgaact cgttgctggc ggaactcaac cgactggggg
   134821 tcgcgcacgc cactacggag gatgttttta tctttgtcga ccgcctcttt caacactttt
   134881 ccttcctttt ccaggccgag gagtcaggcc cgcgccgctt ggaactggtc gcgtccgtgt
   134941 tcgagcacct gacggtggag tgcgtcaacg acatcctgga cgcctgcagt cacccggacg
   135001 tgaacgtcgc ggagacaagc aacacctgtc gtccctgccc ttctcctatt ccctccgccc
   135061 ccaaaactgt cagcggcgct cagacgtcat gtgcgacgcc tcgggcgcct gtgacatgag
   135121 gcacgtccag aacgcgttta ccgaggagat ccagttacac tcgctctacg cgtgcacgcg
   135181 ctgctttcgc acgcacctgt gtgatctggg cagcggctgc gcgctcgtct ccacgctcga
   135241 gggctccgtc tgcgtcaaga cgggcctggt atacgaggct ctctatccgg tggcgcgtag
   135301 ccacctgttg gaacccatcg aggaggccgc actggacgac gtcaacatca tcagcgccgt
   135361 gctcagcggc gtgtacagct acctcatgac gcatgccggc cgttacgccg acgtgatcca
   135421 agaggtggtc gagcgcgacc gcctcaaaaa gcaggtggag gacagtattt acttcacctt
   135481 taataaggtt ttccgttcta tgcataacgt caaccgtatt tcggtgcccg tcatcagcca
   135541 actttttatt cagcttatca tcggtatcta ctcaaagcag accaagtacg acgcgtgtgt
   135601 catcaaggtt agtcgtaaga aacgcgagga cgcgcttctg aaacagatgc gttccgaata
   135661 tggaaacgca cctgtattcg gatctggcgt ttgaagcgcg gttcgctgat gatgagcaat
   135721 tgcctctaca cctggtgctc gaccaggagg tgctgagtaa cgaggaggcc gagacgctgc
   135781 gctacgtcta ctatcgtaat gtagacagcg ctggccgatc cgcgggccgc gctccgggtg
   135841 gagatgagga cgacgcaccg gcctccgacg acgccgagga cgccgtgggc ggcgatcgcg
   135901 cttttgaccg cgagcggcgg acttggcagc gggcctgttt tcgtgtacta ccgcgcccac
   135961 tggagttgct cgattaccta cgtcaaagcg gtctcactgt gacgttagag aaagagcagc
   136021 gcgtgcgcat gttctatgcc gtcttcacta cgttgggtct gcgctgcccc gataatcggc
   136081 tctcaggcgc gcagacgcta cacctgagac tggtctggcc cgacggcagc tatcgtgact
   136141 gggaattttt agcgcgtgac ctgttacgag aagaaatgga agcgaacaag cgcgaccggc
   136201 agcaccaatt ggccacggcc acgaatcacc gtcggcgggg cggactgcgt aacaatttag
   136261 acaatgggtc ggatcgccga ttgcccgaaa cggctatggc ttctttggag acggccgtca
   136321 gtactccatt tttcgaaatt ccgaacggag caggaacctc ctccgcgaat ggcggcggca
   136381 gattcagtaa cctggagcag cgggtagcgc gtttgttgcg cggcgacgag gaattcatct
   136441 atcacgcggg tccattggag ccgccttcca agatacgcgg tcacgagttg gtgcagctgc
   136501 gcctggacgt aaatccagac ctcatgtacg ccaccgatcc gcacgaccgc gacgaggtcg
   136561 cgcgtacgga cgagtggaag ggcgccggcg tctcgcgtct ccgcgaggtt tgggatgtgc
   136621 agcatcgcgt gcgcctccgt gtgctgtggt acgtcaattc cttttggcgc aatcgcgagc
   136681 tgagctacga tgaccacgaa gtcgaactat accgggcgtt ggacgcttat cgggcgcgca
   136741 tcgccgtcga gtacgtgctg attcgcgccg tgcgcgacga gatctatgct gtactacgac
   136801 gggacggcgg cgcgttgcca cagcgtttcg cctgccacgt gccacggaac atgtcctggc
   136861 gcgttgtttg ggaactttgc cgtcatgcct tggtgctctg gatggatcgg gcggacgtgc
   136921 gtagctgtat tattaaggcg ctgacgcctc gtctgagccg gggtgccgcc gctgccgctc
   136981 agcgagctcg tcgccagcgc gagcgcccgg cgcccaaacc gcaggagctg cttttcgggc
   137041 cgcggaacga gagcggtccg cccgccgaac ggacttggta cgctgacgtg gtgcgctgcg
   137101 ttcgcgcgca agtggatttg ggcgtggaag tgcgcgcggc gcgttgtcct cgcaccgggc
   137161 tttggatcgt tcgtgatcgc cgcggacgcc tgcgacgttg gctctcgcag cccgaggtgt
   137221 gcgtgctcta cgtcacgcca gacttggact tttactgggt gctgccgggc ggctttgctg
   137281 tgttctcgcg cgtcactctt catggcttgg cgcagcgggc tttgcgagac cgattccaga
   137341 actttgaagc agttcttgca agaggaatgc atgtggaagc tggtcggcaa gagccggaaa
   137401 caccgcgagt atcgggccgt cgcttgccgt tcgacgatct ttagtccgga ggacgacagc
   137461 tcgtgtatct tatgccagtt gctgttgctc taccgcgacg gcgaatggat catctgtttt
   137521 tgctgcaacg gccgttatca aggccactat ggcgtgaatc acgtacatcg gcgtcgtcga
   137581 cgcatctgtc atctacctac cttgtaccaa ctgagcttcg gaggtccttt gggtccagcc
   137641 agcatcgatt tcttgccaag ctttagccag gtgaccagca gtatgacgtg cgatggtatt
   137701 acgcccgacg tgatttacga ggtctgcatg ttggtgcccc aggatgaagc caagcgtatc
   137761 ctggtcaagg gtcacggtgc catggacctg acctgtcaga aggcagtgac gctaggcggc
   137821 gccggcgcct ggttgctgcc gcgtcccgaa ggctacacgc ttttctttta cattctgtgt
   137881 tacgacctgt ttacctcatg cggcaatcgg tgcgatatcc cttccatgac gcgcctcatg
   137941 gcggcggcca cggcctgcgg gcaggcgggt tgcagctttt gcacggatca cgagggacac
   138001 gtagatccca ctggcaatta cgtgggttgc acccccgata tgggccgttg tctttgttac
   138061 gtgccctgtg ggcccatgac gcagtcgctc atccacaacg aggaacccgc gacttttttc
   138121 tgtgagagcg atgacgccaa gtacctatgc gccgtaggtt ctaagaccgc ggcgcaggtc
   138181 acactgggag acggcctgga ttatcacatc ggtgttaagg attctgaggg ccgatggctg
   138241 cccgtcaaga ccgatgtgtg ggacctggtc aaggtagagg aacctgtgtc acgtatgata
   138301 gtatgttcct gtccggtgct taagaaccta gtgcactaac ggggtctgac agttcacggg
   138361 gagaagaaac aagaaacaac aaagaaagga ggacatggac tcgccacggt ttgtggcaag
   138421 gcgtatgtta tcatcatgga gctactcacg ttggtgttgt agcaactggc aaaaagcgcc
   138481 gtgctcttgg cgccgcggtg gtcgatgctg atcacgttgt ccttgttctc gaccacgtag
   138541 tcgcgcgcga aggtgtggcg gcagcggaac tcgacctctt tgagcacaaa ctgcgacacg
   138601 tgcttttggt gcgccacgta gccgatgctg atgccgatca tgtgcttaag cagaaacgag
   138661 ataatgggga tgatgaacca agtcttgccg tgacgtcgcg gcaccaggaa cacggtggct
   138721 ttctgcttaa agatgtcgat ggaggtctgc gagaggaagt cgatctggaa ggcgtggatg
   138781 aggtactgca gcacgcgatt ggccagcacg gggatcttgg tcacggctat aaaaaagatg
   138841 acgtgtatca ataaattctt ttgaaacggt tcgagtcgga tggcttttgc gtcgccctcg
   138901 acggcggtac tgaagccgcc gtcgagccac tttttaaagt cggtcatgaa gttgttgatc
   138961 tgctgaaact gcggatcgcg gtagagctcg gtcaacgcgt ccagcttctg gtaggaggcg
   139021 cgctgctcct cggagcacgg gcgaaacgtc agttcatcga gcgcgctctt gaggcgctcg
   139081 tgaaacagca gctcgcgctg gctttcctcg ggcgagttgt agtcgcggtg gcggccgcag
   139141 aaggccatga gcggcaggaa ggcctcgttg cacgagtggg ccagcccgag ttcggggtgc
   139201 atcatctggt agcgcttgcg gcacagcgcc gccacattgg tgaaggccgt ggagatgcag
   139261 gaggtggggt ggctcttgcg cttctgcagc tccgcgtagc gctcctggat cttggcggcc
   139321 gaatctccgc gcaacatgat ggcggcggcg gtggtgcgag cggaggttag gcggcagcgt
   139381 cgagaggaga ggaaaaagat ggcggccgcg aggacgacgg aggatctacc cgaaaaccac
   139441 gttgtcgcgg acgtggcttg tgggacgggc gccgtcactc gttcgtcttc gtcgtcccta
   139501 gtggtgtcgt cttcctcggc gtcaggctcg gacgaatctt cctccgcctc tcctctcagt
   139561 ttccccgtct cctccccctc aactgccgtc aggtctccgg ggtccgccgg ggtttcaacg
   139621 tccctgtgct cggtggaacg gatggtcgag ctgtcggcgc agtctccggc cgccgatttc
   139681 tcggtctccg aggcttggcg cttcgaggag gccgtaaata tggcgctggt ggcctgcgag
   139741 gccgtgtcac cttacgatcg ctttcgccta attgaaacgc ccgacgagaa tttcttattg
   139801 gtcaccaacg tgattccgcg cgagtcggcc gaggtgccgg tgttggatag cagtagcggc
   139861 ggtggcgata gcgggccgga ggacaaaaag aaaaacgtcg ggaataaaac cgcgggggaa
   139921 aagaacgacg gtgggtctcg ggccaaacgc cgtcgtagac gacgcgctcc gaaaaacgac
   139981 gccgccacgc cgtcttttct acgtcgacac gacgtgctgg agcgtttcgc ggccgcggct
   140041 gagcctttgc cgtcgctttg tgtgcgtgat tatgcgttac gcaatgctga ccgtgttacc
   140101 tacgacggcg aattaatcta cggcagttac atgttgtatc gcaaggctca cgtggagctg
   140161 tcactctcca gcaacaaggt gcaacacgtg gaagccgtgc tgcgacaggt gtacacgccg
   140221 ggcttgttag atcatcacaa cgtgtgcgac gtggaggccc tgctgtggct gctgtactgt
   140281 ggaccgcgca gcttttgcgc gcgtgacacc tgtttcggtc gcgaaaagaa cggttgtcct
   140341 ttccccgcgt tgttgcccaa actcttttac gaacccgtgc gggactatat gacctacatg
   140401 aatctggctg agctgtacgt ctttgtttgg tatcgcggct acgaattccc tgcgccgacg
   140461 ccgcaggcga cgacggcggg tggtggtggt ggtagtggtg gcggcggcgg ggccggcgct
   140521 tgtgcggtcg agacgagcgc gtcagcaggc cgggtcgatg acgccggcga cgaggtgcat
   140581 ttgcctttaa agcccgtctc gctggaccgt ctcagagagg tgttgcaggc ggtgcgcggc
   140641 cgcttctcgg ggcgcgaggt gcccgcctgg ccggcctcgt cgcgcacctg tttgttgtgc
   140701 gcgctctaca gtcagaaccg tctctgttta gatctcgcgc gtgacgaggc gcggaccgtg
   140761 agttatagcc ccatcgttat ccaagactgc gccgcggctg tcaccgacgt cactttgagc
   140821 cacatcttgc ccggccagag caccgtctcg cttttccccg tctaccacgt cggcaagttg
   140881 ctggacgctc tctcgctgaa cgacgcgggt ctcatcacgt tgaatctatg acgtcggtca
   140941 acaaacagct cttaaaggac gtgatgcgcg tcgaccttga gcgacagcag catcagtttc
   141001 tgcggcgtac ctacggaccg cagcaccggc tcaccacgca gcaggctttg acggtgatgc
   141061 gtgtggccgc tcgggaacag acccgataca gtcagcgaac gacgcagtgc gtggccgcac
   141121 acctgttgga gcaacgggcg gccgtgcagc aagagttgca acgcgcccga cagctgcaat
   141181 ccggtaacgt ggacgacgcg ctggactctt taaccgagct gaaggacacg gtagacgacg
   141241 tgagagccac cttggtggac tcggtttcgg ggacgtgcga tttggacctg gaggtcgacg
   141301 acgccgtcta acaggtatag caatctccgt cacgcctctg ttcagatttt attaaaaaaa
   141361 aaacacaaca taacgacagt gtcggtgtgg tagctagtgc agccctagga acagggaaga
   141421 ctgtcgccac tatgtcctcc gcacttcggt ctcgggctcg ctcggcctcg ctcggaacga
   141481 cgactcaggg ctgggatccg ccgccattgc gtcgtcccag cagggcgcgc cggcgccagt
   141541 ggatgcgcga agctgcgcag gccgccgctc aagccgcggt gcaggccgcg caggccgccg
   141601 ccgctcaggt tgcccaggct cacgtcgatg aagacgaggt cgtggatctg atggccgacg
   141661 aggccggcgg tggcgtcacc acgttgacca ctctgagttc cgtcagcaca accaccgtgc
   141721 ttggacacgc gactttttcc gcatgcgttc gaagtgacgt gatgcgtgac ggagaaaaag
   141781 aggacgcggc ttcggacaag gagaacctgc gtcggcccgt ggtgccgtcc acgtcgtctc
   141841 gcggcagcgc cgccagcggc gacggttacc acggcttgcg ctgccgcgaa acctcggcca
   141901 tgtggtcgtt cgagtacgat cgcgacggcg acgtgaccag cgtacgccgc gctctcttca
   141961 ccggcggcag cgacccctca gacagcgtga gcggcgtccg cggtggacgc aaacgcccgt
   142021 tgcgtccgcc gttggtgtcg ctggcccgca ccccgctgtg ccgacgtcgt gtgggcggcg
   142081 tggacgcggt gctcgaagaa aacgacgtgg agctgcgcgc ggaaagtcag gacagcgccg
   142141 tggcatcggg cccgggccgc gttccgcagt cgctcagcgg tagttccggg gaggaatccg
   142201 ccacggcggt ggaggccgac tccacgtcgc acgacgacgt gcattgcacc tgttccaacg
   142261 accagatcat caccacgtcc atccgcggcc ttacatgcga cccgcgtatg ttcttgcgcc
   142321 ttacgcatcc cgagctctgc gaactctcta tctcctacct gctggtctac gtgcccaaag
   142381 aggacgattt ttgccacaag atctgttatg ccgtggacat gagcgacgag agctaccgcc
   142441 tgggccaggg ctccttcggc gaggtctggc cgctcgatcg ctatcgcgtg gtcaaggtgg
   142501 cgcgtaagca cagcgagacg gtgcttacgg tctggatgtc gggtctgatc cgcacgcgcg
   142561 ccgctggcga gcaacagcag ccgccgtcgc tggtgggcac gggcgtgcac cgcggtctgc
   142621 tcacggccac gggctgctgt ctgctgcaca acgtcacggt acatcgacgt ttccacacag
   142681 acatgtttca tcacgaccag tggaagctgg cgtgcatcga cagctaccga cgtgcctttt
   142741 gcacgttggc cgacgctatc aaatttctca atcaccagtg tcgtgtatgc cactttgaca
   142801 ttacacccat gaacgtgctc atcgacgtga acccgcacaa ccccagcgag atcgtgcgcg
   142861 ccgcgctgtg cgattacagc ctcagcgagc cctatccgga ttacaacgag cgctgtgtgg
   142921 ccgtctttca ggagacgggc acggcgcgcc gcatccccaa ctgctcgcac cgtctgcgcg
   142981 aatgttacca ccctgctttc cgacccatgc cgctgcagaa gctgctcatc tgcgacccgc
   143041 acgcgcgttt ccccgtagcc ggcctacggc gttattgcat gtcggagctg tcggcgctgg
   143101 gcaacgtgct gggcttttgc ctcatgcggc tgttggaccg gcgcggtctg gacgaggtgc
   143161 gcatgggcac ggaggcgttg ctctttaagc acgccggcgc ggcctgccgc gcgttggaga
   143221 acggcaagct cacgcactgc tccgacgcct gtctgctcat tctggcggcg caaatgagct
   143281 acggcgcctg tctcctgggc gagcatggcg ccgcgctggt gtcgcacacg ctgcgctttg
   143341 tggaggccaa gatgtcctcg tgtcgcgtac gcgcctttcg ccgcttctac cacgaatgct
   143401 cgcagaccat gctgcacgaa tacgtcagaa agaacgtgga gcgtctgttg gccacgagcg
   143461 acgggctgta tttatataac gcctttcggc gcactaccag cataatctgc gaggaggacc
   143521 ttgacggtga ctgccgccaa ctgttccccg agtaaccggg acgcggaacg tgacggttgc
   143581 tgaggggaaa ggtgacagag aaggtacaaa cccaccggcg gggaaaatac cgaggcgccg
   143641 ccatcatcat gtggggcgtc tcgagtttgg actacgacga cgatgaggag ctcacccggc
   143701 tgctggcggt ttgggacgat gagcccctca gtctctttct tatgaacacc tttttgctgc
   143761 accaggaggg cttccgtaat ctgcccttta cggtgctgcg tctgtcttac gcctaccgca
   143821 tcttcgccaa gatgttgcgg gcccacggta cgccagtagc cgaggacttt atgacgcgcg
   143881 tggccgcgct ggctcgcgac gagggtctgc gcgacatttt gggtcagcgg cacgccgccg
   143941 aagcctcgcg cgccgagatc gccgaggccc tggagcgcgt ggccgagcgg tgcgacgacc
   144001 ggcacggcgg ctcggacgac tacgtgtggc tcagccggtt gctggatttg gcgcccaact
   144061 atcgacaggt cgagctcttc cagttgctgg aaaaggaatc gcgcggacag tcgcgcaact
   144121 cggtgtggca tctgttgcgt atggacacgg tctcggccac caagttctac gaggccttcg
   144181 tcagcggctg tctgcccggc gccgcggcgg cggacggttc gggtggcggc ggctcgcact
   144241 acacgggctc gcgcgccggc gtctcgccgg gcatccagtt cggtatcaaa cacgagggct
   144301 tagtcaaaac gctggtggaa tgttacgtga tgcacgggcg cgagccggtg cgcgacggcc
   144361 tcggtctgct catcgacccc acgtcggggc tgctgggcgc ttccatggac ctgtgcttcg
   144421 gcgtgctcaa gcagggcagc ggtcgcacct tgctggtgga accgtgcgcg cgcgtctacg
   144481 agatcaagtg ccgctacaaa tatttgcgca aaaaggagga cccctttgtg cagaacgtgc
   144541 tgcggaggca cgacgcggcg gccgtggcct cgctgttgca gtcacacccg gtgccgggcg
   144601 tggagtttcg cggtgaacgc gagaccccgt cggcacgcga gtttctgctt tcgcacgacg
   144661 cggcgctctt cagggccacg ctcaagcgcg cgcgcccgct caagccgccc gaaccgctgc
   144721 gcgagtacct ggccgatctg ctgtatctca ataaggccga gtgttcggaa gtgatcgtgt
   144781 ttgacgccaa gcacctgaat gacgacaaca gcgacgggga cgccacgacc actattaacg
   144841 cgagtctcgg cctagccgcg ggcgacgccg ctggcggcgg cgctgatcac cacctgcggg
   144901 gcagcccggg cgattcgccg ccgccgatac ctttcgagga cgaaaacacg cccgagctgc
   144961 tgggccggct caacgtgtac gaggtagcgc gcttttcact gccggctttt gtcaatccgc
   145021 gtcaccagta ttactttcag atgctcattc agcagtacgt gctcagccaa tactatataa
   145081 agaagcatcc ggacccggag cggatcgatt tccgcgacct gcctaccgtc tacctggtct
   145141 cggccatctt ccgcgagcgc gaggaaagcg aactgggctg cgagttgctg gccggcggtc
   145201 gcgttttcca ctgcgaccac atcccgctcc tgctcatcgt cacgcccgtg gtctttgacc
   145261 ctcagtttac gcgccatgcc gtctctaccg tgctagaccg ttggagtcgc gacctgtccc
   145321 gcaagacgaa cctaccgata tgggtgccga actctgcaaa cgaatatgtt gtgagttcgg
   145381 taccacgccc ggtgagcccc tgaaagatgc tctgggtcgc caggtgtctc tacgctccta
   145441 cgacaacatc cctccgactt cctcctcgga cgaaggggag gacgatgacg acggggagga
   145501 tgacgataac gaggagcggc aacagaagct gcggctctgc ggtagtagct gcgggggaaa
   145561 cgacagtagt agcggcagcc accgcgaggc cgcccacgac ggctccaaga aaaacgcggt
   145621 gcgctcgacg tttcgcgagg acaaggctcc gaaaccgagc aagcagtcaa aaaagaaaaa
   145681 gaaaccctca aaacgtcacc accatcagca aagctccatt atgcaggaga cggacgacct
   145741 agacgaagag gacacctcaa tttacctgtc cccgcccccg gtcccccccg tccaggtggt
   145801 ggctaagcga ctgccgcggc ccgacacacc caggactccg cgccaaaaga agatttcaca
   145861 acgtccaccc acccccggga caaaaaagcc cgccgcctcc ttgccctttt aacccataaa
   145921 ctttcaggtc tcgcgtacga ttcgcgagtc gggaatggga cacccgtggg tgtttctccg
   145981 tgtgtatatt attttttttg tgtgtgtgtt tgcgcccccg tgtgtctaat gtgctgtttg
   146041 aaacacgtaa agtagctggt ggaagaacag ataaaccttt aataaaaaaa aaagtatgtg
   146101 ctcccgaccc acggtctgcg tgtctctttt ttatgtccat gtctccaagt ctggtgcggg
   146161 tggcggcggg gtcaagcgtc ctcgaagtct tcatcatcgt cgtcgtcgtc ctcttgttcg
   146221 cggaggcgac ggctttccaa gctgtcgtgg tgactgagcg cagcgacttc ttcgccggag
   146281 gctgtggcca gcgcctggta cttgacacta ccgctaccgc gtccgcgaaa gtagcggacg
   146341 gcgcgacacg tcgtaaacat ggcccatatg aaaaagagca tgccgaacga ccagctgatg
   146401 ccggtgcggt attcgttgct gaggaaggta tcgtactgca cgatggggta gatgaggccg
   146461 cagagtccaa agaaggcgcc caggtggtag ccgaattgca ccttgacgta ttgaaaaaag
   146521 acggcctcga tcagtaaaaa gtagatgatg gagatgatag cgtagaccac gaagacggct
   146581 aacaccatgt ggcctgtacg cacgaaaaag ttgtttccga agccgtagca tagggccatg
   146641 gctaccacgg tggtgttgaa accaagcgct acctccacca ggttgacgat gagcgtgcgg
   146701 aactgcaccg tacctttgag cttggggtgc agacgcgaga agaaaaagag cgagcgtttg
   146761 tagctgcggt actgcgtgac catgctcacg ttgaaaatgg tcaggcagaa aaagtgcacg
   146821 gcggccatga aggcgatcat gctgggcagc cgaaatgaca tggtcagtgt gaatagttgg
   146881 aatgtgtcca tgctgaggat gaaaaggaag gctgtgaggc tgtcgcccat gtacgagatg
   146941 tcgcgtgtcg actggtttag gctcatgcct ttgtccttgc gcatgctgat cttgatccag
   147001 cataccaggt agtagatggt cacggctaaa aagacgagct gcatgaacac ggcgtagcac
   147061 accagctgca ccgagtctaa gaaaagcata ggcgtgtgca ggtgcattac gttgtaggcc
   147121 gacatgttga gcctttcaaa gtccacgacg tgatagtaga cgcaggggta gcccaggtgc
   147181 ggaaaattgc tcagcaccag atgcacgctg acgttgacaa aagtcagcac catgaaaacg
   147241 atagaagcgc tccatgtccg tgtattcacc ttatccacgt gcgagggggc catggcgata
   147301 gcggcggccc gctcgctcgg gaggcgatgg gggcgcgccg atgacgacag gctcgcgggt
   147361 cgttaaatac tacgatggga gccgccgcgg ctcacgacgc ggtttgagcg cgtccgggcg
   147421 gtcggcgaaa aaagaccccg cgggccttcg cgactctctt ctgtccgagg atgaccgctc
   147481 agccgccgct gcaccaccgc caccacccgt acaccctgtt cgggaccagc tgtcatctca
   147541 gctggtacgg ccttctggag gcctcggtgc ccatcgtaca atgtctgttt ttggatctgg
   147601 gtggcggccg tgccgaaccg cggcttcaca cgttcgtggt gcgcggtgac cgtctgccgc
   147661 cggctgaggt gcgtgctgtg catcgcgcca gctacgccgc gctggcctcg gccgtgacta
   147721 cggacgccga cgagcgccgg cgcggcctag agcagcgtag cgccgtgttg gcgcgcgtgt
   147781 tgctagaagg cagcgcgtta atccgcgtgt tggcgcgcac cttcacgccg gtgcagattc
   147841 agacggacgc tagcggcgtg gagatcttgg aggccgcgcc ggcattgggc gtggaaaccg
   147901 cagcgctgtc gaacgcgctt agtcttttcc acgtagccaa gttagtggtc atcggctcgt
   147961 atcccgaagt gcacgagccg cgtgtggtca cgcatgccgc ggaacgcgtc tccgaagagt
   148021 atggcaccca cgcgcacaaa aaattgcgtc gcggttacta cgcctacgat ttggccatgt
   148081 cgtttcgcgt cggcactcac aagtatgtgc tggagcgcga cgacgaggcc gtcctggcac
   148141 gcctctttga ggtgcgcgag gtgtgttttt tgcgcacctg tctgcgtctg gtcacgcccg
   148201 tcggtttcgt ggccgtggca gtgaccgatg agcagtgttg tttattgctg cagtcggcct
   148261 ggactcacct ttacgacgtg ctttttcgtg gtttcgctgg gcagccgccg ctacgcgact
   148321 acctggggcc ggacctcttt gagacgggcg ctgcccgttc tttctttttt cccggtttcc
   148381 cgcccgtgcc cgtctacgcg gtccacggtc tgcacacgtt aatgcgcgag acggcgttgg
   148441 acgcggcggc tgaggtgctc tcgtggtgcg gcctgcccga catcgtgggc tcggccggca
   148501 agctggaggt ggaaccctgc gcgctctcgc tcggcgtgcc cgaggatgag tggcaggtct
   148561 tcggcaccga ggccggcggc ggcgccgtgc gtctcaatgc cacggctttt cgcgagcgac
   148621 cggccggcgg cgatcgtcgc tggctgttgc cgccgctgcc gcgtgacgac ggcgacggtg
   148681 aaaacaacgt cgtggaagtc agcagcagca ccggcggtgc gcacccgccg agcgacgacg
   148741 ccactttcac cgtgcacgtt cgcgacgcca cgctacatcg agtgctcatc gtggatttgg
   148801 tcgagcgcgt gctggccaag tgtgtacgcg cgcgcgactt caatccctac gtgcgttata
   148861 gtcatcgact ccacacttat gcggtttgtg aaaagtttat tgaaaatctg cgttttcgct
   148921 cgcgacgcgc cttctggcag atccagagtc tgctgggcta catctccgag cacgttacgt
   148981 cagcctgcgc ttcggccggc cttttgtggg ttctgtcgcg cggccaccgc gagttttatg
   149041 tctacgacgg ctattcgggt cacggacccg tctcggccga agtgtgcgtg cggactgtgg
   149101 tcgactgtta ttggcgcaaa ctttttggcg gcgacgatcc aggtcccacc tgtcgtgttc
   149161 aagagagcgc gcccggcgtg ctgttggtct ggggcgacga gcggttggtg ggtcccttca
   149221 acttcttcta cggcaacggc ggcgccggtg gtagtccgct ccacggggtg gtgggtggtt
   149281 tcgcggcggg acattgcggc ggcgcttgtt gcgcgggctg cgtcgtcact caccgccatt
   149341 ctagcggcgg cggtggtagt ggcgtgggcg acgcggacca cgcgagtggc ggcggtctag
   149401 atgccgctgc cgggagtggt cataacggcg gtagtgatcg ggtttctccc tccacgccgc
   149461 ccgcggcgtt gggtggctgt tgctgcgcgg ccggtggcga ctggctctcg gccgtgggtc
   149521 atgtcttggg ccggctgccg gcgctgttac gggagcgcgt gagcgtgtcc gagctggaag
   149581 ccgtgtaccg cgagatcctc tttcgcttcg tggctcgccg caacgacgtg gacttttggt
   149641 tactgcgctt ccagcccggt gaaaacgaag taaggccgca cgccggggtg attgactgcg
   149701 cgcccttcca cggcgtgtgg gccgagcagg gccagatcat cgtacagtca cgcgatacgg
   149761 cgttggcggc cgatatcggc tacggcgtct atgtggacaa ggcctttgcc atgctcacgg
   149821 cttgcgtgga ggtctgggcg cgagagttat tgtcgtcctc caccgcttcc accaccgctt
   149881 gttcttcttc ttccgttctc tcctccgcct tgccgtccgt cacttcgtcc tcttcgggca
   149941 cggcgacggt gtctcctccg tcttgttctt cttcgtcggc gacttggctc gaggagcgcg
   150001 acgagtgggt gcgctcgctg gcggttgacg cgcaacacgc cgctaagcgg gtggcttccg
   150061 agggcctgcg gtttttccgg ctcaacgctt aacgagtcac gtaggggaac tacgtgggta
   150121 agtgacgtgg atactagtaa aaaaaagtgc gtcaaagctc ttagcgtgtg acgtggatac
   150181 tagtaaaagg gacgtcaaag ctcactacgt gttgcgtgtt ttttttattc tatgatatgc
   150241 gtgtctagtt cgcttctcac tcttcctctc ctcgttccca gcgcggcggc agcttggggg
   150301 gtgagggtaa attggggtag ttggcgttga gcacgtctag caggcccagg cccacgggcc
   150361 aaccgtccac ggtcttacgc tcggtcagct tgaggctgaa cgagtgtgcc tcgtcctgac
   150421 cggtaaggcg gaaaaagaag cgtgctacca gctgcaggca ggtatgccgc gtctgctgga
   150481 agagcacgaa ggtagcgggc acgtactgca caatatgcgg ctctttttcc tcaaagagta
   150541 ggtagagcgc gctgcagatc agccgccggg cgctgtggtg cagcagccgg ccgaagcttt
   150601 cgcgcacgtt caccgcgtcc agatactgga gcaggtcgtg caggcacttg cgcgttaagt
   150661 tgcaattttc cacgcacgaa ataacggtac agagcgcgaa gtgcagcagg ttgtcggctt
   150721 tgacgatgcc gcagcggtgt ttgagccgca gatccgagag cctcacctgc gtgacggcgt
   150781 cttcggtctc gagcaaaaac acggcggagt agcctagaaa ggccgaggtg cacagcaact
   150841 cgctgcggta ctcggccatg gaaaccagca gcccgtgctc cgtgtgcagc cacagcttgt
   150901 cgccgcgcac cgtaaagtcg agcacttgcg gctccatgat catcacattc tgtctagtga
   150961 aatccgtatg gacctccagc acgccgcgga tcatcagggc ctccatttcg aaatcggccg
   151021 acacgctctg ggccgcgccg ctcctcgtct gccgtgatca agcggcgcgg cgcggacctt
   151081 tcaagcgttc ctgggccgcc gctcgaggca gttccccttt ctggcactcc gcccgccgct
   151141 tcgcggctca tttggcgccg acgcgccttc tcgcggctgc aaatcagctc cacgtatcgg
   151201 caaaacttgc tgtcgtcgta ggcggcggcc acgatctcgc cgaaggagag ctgcaggtag
   151261 gcctcgggta cggggtccag cgtgcccagc gccaggatgt gacacagata gggcagggtc
   151321 acgcgctcta ccgtgtaatt ggagtagacg atggcctctt cggccccttg atgcgtgacc
   151381 agacgccgta ggcgaaaggt acggaaatac tcgttttccc acaactgcgt gaggaagcgt
   151441 tccagcgact cggtgccggg cacgaactgc gagaagaagc tgttggccac caggcggttg
   151501 tcttccaccg ccagcggacg gaagggcgcc gcgtcgcgcg ccttgcgcac ggcctccaac
   151561 acgggcaggt ggtagagttc ggcgtcgcgc gcgcccaggc tcatggagtc ctcgcggcgc
   151621 gaggcgtagc gcgtgagcag gtcgcgcagt tcgcgcacgc gattctccca ggtctggtta
   151681 agcgtgcgca ggtcctggat ctcgtccacc tgcgactgga tctgctcctc caggcacttg
   151741 ataacctgct tcttaaacag gtcgcggatg tcccgctcgg gcgccgccgg gccgggtggc
   151801 ggcggcagca gcccgacgtg gcccgcgggt cctcccacca cggcgccgcc gggtcccacc
   151861 acgccgggtc cgcccggacc acgcgcgggt agtagacggt tttggtccac cagcgagggg
   151921 gtcaggtcct gcagaaagga ctcgacgctg tcctcgatgc cgatgcgcga tttgctgtcc
   151981 gagacgttaa gcaaaaactt cataatggac tttttggcgt cgctgccccg gtcgtgctgc
   152041 tccatcatct ccaccagctt cttgcagttg agctcgtggc ggctggcggt caccactttc
   152101 acaggaaagg tattgagcaa ctggcagatc ttttggtggc ggcagagccc gtcgtagcgc
   152161 agaatctcct cgtgcaggtg tgccaccggc gtggtgaaca gcagcttgtc gcgctcataa
   152221 gccagcggtt cggccgccac gtacaagcgg atgtgcttgc cgcgcagctg cgcctccagc
   152281 cgctccgagc gcaccttctt gaagacgcgt acctcgggcg cgttggctac gcgcacggcg
   152341 cccaggcgct cggccacctg cagcagcagc gccaggttag cctgcagcag gtcctgcgcc
   152401 agcgggtgtg tctcggtggc ccgctgcacg gccgcgcgta caaattgcgc ccgctcggcc
   152461 gcctcgctcg gcttggtctt cacgtccagc agcggtacca gtcccaccgt tacgcaccaa
   152521 tccacgtaga gaccatagtc gtcgttatcg gcgtactgat ataaaatgtc gcggagcgcg
   152581 cccagcacgc ccgtttgcac gctctggcgc aacgaggcgc tccacaccaa cagatactgc
   152641 tccaggtcct cttcgtccag cgcgcggtag ggaaatagcg ccgcgtgcaa cttccactcc
   152701 tcggccacgc gccgcaccgt gatggtgtca aagagcgttt tgcacactcc gtagagcagc
   152761 tgcttgcgca gtacgcacgg gtcgcgcagc acctggtgca tgctttgccc gcgacacgtc
   152821 cccagaaagc cgtgcagcaa ccgcaggaag ctcatcgtct gccccgtggg gaaaatgtcg
   152881 atgacggcct cgtcatccac gccgcggccc acgcccaagt acgacgacgc cttgatcctc
   152941 aacctctcgt cggccgccaa gatcgaacgg atcgtcgaca aggtcaagtc cctctcgcgc
   153001 gagcgctttg cgcccgagga tttttcgttc cagtggtttc gctccatcag tcgcgttgaa
   153061 cgaacgacag ataacaaccc ctctgccgca actaccgccg cggcaacgac gaccgttcac
   153121 tcctccgcct cctcttctgc cgccgctgcc gcttcgtccg aggccggcgg cacgcgcgtg
   153181 ccctgcgtcg accgttggcc cttctttccc ttccgcgcgc tgctcgtcac cggcacggcg
   153241 ggcgccggca agacttccag catccaggtg ctggcggcca atctagattg cgtgatcacc
   153301 ggtaccacgg tgatcgccgc gcagaacctc agcgcgatcc tcaaccgcac tcgctcggcg
   153361 caggtcaaga ccatctaccg cgtcttcggc ttcgtcagca agcacgtgcc gctggctgac
   153421 agcgccgtta gccacgagac gctggaacgc taccgcgtgt gcgagccgca cgaggagacc
   153481 accatccagc gcctgcagat caacgatctg ctcgcctact ggccggtcat cgccgacatc
   153541 gtggacaaat gcttaaatat gtgggagcgc aaggccgctt cggcctccgc cgcggccgca
   153601 gccgccgcct gcgaggacct ctcggagctg tgcgagagca atatcatcgt catcgacgag
   153661 tgcggcctta tgctgcgcta catgctgcag gtggtggtgt ttttttacta cttttacaac
   153721 gccctgggcg acacgcgact ttaccgcgaa cgccgcgtgc cctgcatcat ctgcgtcggt
   153781 tcgcccacgc agaccgaggc gctggagagc cgctacgacc actacacgca aaacaagagc
   153841 gtgcgcaagg gcgttgacgt gctctcggcg ctgattcaga acgaggtgct catcaactac
   153901 tgcgacatcg ccgacaactg ggtcatgttt attcacaaca agcgttgcac cgacctggac
   153961 tttggcgacc tgctcaagta catggagttc ggtatcccgc tcaaggagga gcacgtggcc
   154021 tacgtggacc gcttcgtgcg gccgcccagc tccatccgca acccatcgta cgccgccgag
   154081 atgacgcggc tttttctctc gcacgtcgag gtgcaggctt acttcaagcg gctgcacgag
   154141 cagatccgcc tgagcgagcg ccaccgtctc tttgatctgc ccgtctactg cgtggtcaac
   154201 aaccgcgcgt accaggagct ctgcgagctg gccgacccgc tgggcgactc gccgcagccc
   154261 gtcgagctct ggttccgcca gaacttggcg cgcatcatta actactcgca gtttgtcgac
   154321 cacaacctct ccagcgagat caccaaggag gcgctgcgcc ccgcggccga cgtcgttgcc
   154381 accaacaact cctccgtcca ggctcacgga gggggaggat ctgtaatcgg gagcaccggc
   154441 ggcaacgacg agacggcgtt tttccaggac gatgatacca ccaccgcgcc cgatagccgt
   154501 gagacgctgc tcaccttgcg cattacctac atcaagggca gttcggtggg agtcaactct
   154561 aaggtgcggg cctgtgttat cggataccag ggcacggtcg aacgtttcgt ggacatcttg
   154621 caaaaggaca cgtttatcga acgcacgccc tgcgagcagg cggcctacgc ctactcgtta
   154681 gtttcgggcc tgctcttctc ggccatgtac tacttctacg tgtcgcccta cacgaccgag
   154741 gagatgttgc gtgagctggc gcgcgttgag ctgcccgacg tgagttcgct ctgcgccgct
   154801 gccgccgcca cggccgccgc tcccgcttgg agcgggggag agaatccgat aaataatcac
   154861 gtcgacgcgg attcttctca gggcggccag agcgtgccgg tatctcaacg gatggaacat
   154921 ggccaagagg agacccacga catcccctgc ctgtccaacc accatgacga ctcggacgcc
   154981 gtcacggacg ccgaactcat ggatcacacc agtctgtacg cggatccctt ttttctcaaa
   155041 tacgtcaagc cacctagcct ggcgctgctt tctttcgagg agacggtgca catgtacact
   155101 accttccgcg acatttttct caagcgctac cagctcatgc agcgtctcac gggcggtcgc
   155161 ttcgccacgt tgccgctcgt tacctacaat cgccgtaacg tggtgttcaa ggccaactgt
   155221 cagatcagct cgcagaccgg ctccttcgtg ggcatgcttt cgcatgtgtc gccggcgcag
   155281 acgtacacgc tcgagggcta caccagcgac aacgtgctca gtctgcccag tgaccgccac
   155341 cgcatccacc ccgaggtggt gcagcgcggc ctttcgcggc tggtgctacg cgatgcgctc
   155401 gggttcctct ttgtgctcga cgttaacgtt tcgcgcttcg tcgagtcggc gcagggcaag
   155461 agtctgcacg tgtgcaccac cgtggactac ggcctcactt cgcgcacggc catgaccatc
   155521 gccaagagtc agggcctgtc gctcgagaag gtggccgtgg actttgggga ccatcccaag
   155581 aacctcaaga tgagccacat ctacgtggcc atgtcgcgag tcacggaccc cgagcacctc
   155641 atgatgaacg ttaacccgtt gcgactgccc tatgagaaga acaccgccat caccccctat
   155701 atctgtcgcg cgctcaaaga caaacgcacc acgcttattt tttgacacaa caccgtgtaa
   155761 tgaaaacgtg actttattga gcagggtaaa aaccacgtac aagaaccacg ttgtctatcc
   155821 ccaaaaaaac acacaccgtc agggaacaca tcgcctatag atagcggcac tttacataaa
   155881 accgccgtac ctgcatcacg gtggctcgat acactggaaa ttcaataaaa accaccgtgt
   155941 ctccgttacg gtacttatcg ggtcagcgta tttctcttgt gatttctgtt cgtaaactta
   156001 tccgtttccc tggtccgcgg tgtctcctcg cgaggctgac agtctacgag tggtacctgc
   156061 aagagaagaa acccgggtgg gagcgacgcc gtcgctgggt atcaaccccg cggctgaccg
   156121 tcgtccggta aaggaacaac ccgtcgtcgc aagccgggtt cgaccaagag aaaaaacccg
   156181 ggtgcggggg gagacgggtc gtcctttggt tgttcgcgga cggcgtacat gccgcgtggg
   156241 tcagtcgacg gcgtcgctcc gtgtggtcgg tcatcattct gcttcacata tatgggttgt
   156301 ttgtgttttt tttataatga atacgcactg atcctatccg tgactgcgcg tgtggcagag
   156361 aggatgcctt ataacatgta ttttgaaaaa ttgccaacag ctataatttc tctcatgtag
   156421 cagaatagag accttttgtc gtctttttgt ttgtcattac ttgttttcca gggaattaga
   156481 gagagggaac cgcgcctccg gcggcggtgc ccgcggaccc cggccccttc tcgcgtgcgc
   156541 ggtgtgactg gttgagcgaa tgagcagcta ggcttggtgg tgctccgcgt gcgggggaga
   156601 agacgattaa caacaaaaaa taagtggaag tggccggtgg gtctttgtcc gcgtgcgcgc
   156661 ccatccgtcg ccgggaccga gcagaaagtg atgtggtggt acattgattt tttccttgac
   156721 aggaaagaaa aaaaaagagt tttgttttcc tatgtgagag gagaaaggta tgtgaggaga
   156781 tgttcgatga tcgtatgtta cagttatgct gtaaggaagc ttttatcgtg cgtcctgttt
   156841 ttcatttgat gtatatgaca caattgaaac ctatcgatag gcgtatatcg aggattcatc
   156901 aattcttaga atcgtcgtct ttttggctaa ttggactttg cccatgttgg ttgtcattcg
   156961 tggcctgagg tcatcgtcgt ccacgacgac gtgtctatag cgtgcggtgt gatcattgtg
   157021 tcgagccaga gaaagcgcgc ctcgcacgac gtttgcggat cggctcgcgg gtgtgtggaa
   157081 ttcctaagaa cataatcagc tggtcgtctt tctttgatgt gttgttgtcg tcgaggtctt
   157141 gcttcgtttt cttttttctt tttagtcgat ggaacttttc ttcggtacgg gttcttgtta
   157201 tggaagcttg tgttttcgaa catgaattcg aaaaaataaa aaggcctatc ttcgtttcaa
   157261 aaaaaggaca gatatcaatc ttcttaactt atatcatggt aaattcagaa tcctatggtg
   157321 tcttattatc tctaaagtag tcaacattat ggtctaactt gtatttccct gacgagatat
   157381 atatgatcct tataacctgg ctactatcat gaacaacaat atccttactt acagtcatct
   157441 tcgtgagtta atgaagtata atatcggtca tctatcaact tatctgctat gtaacgtacc
   157501 cttttaggta ttttgcgttt cttaacgagt gtacccgcct gtgtgaggcg aaactctgag
   157561 aagtctaccg agtcgagtta caagtcacta aaacacttac acgagttgtc tatactaaaa
   157621 tcactatcta tgttgtttgc ttacctaatt attatcctac atgacgaagc tacctcccaa
   157681 cgtaaggtag ggggagagga gacagaacaa taaaaagtaa ctaatgtttc ttagaactta
   157741 cccgctaagg acttaccaaa ctatattcac caaaaaacaa cagctacgtg tttcatttgt
   157801 tttaatctac cgaagtaaaa aaaaaaaaga tgattagcta tccagaacct acttacttct
   157861 taatgtttta actaaggatg cctatgggat tggaaaaaaa atcacagcaa cttgctacta
   157921 atcagttgac agcgaagaga ctcataacaa agatttctgg gtaatacggt tataataatg
   157981 cttatggact aaaggatact tggaaaaaaa gaacgggcta tgactataga gattcgtcga
   158041 gatatcaaac ttcaaatagg cggctatcat tcatggttgt ggtgactata tcgtggagaa
   158101 aaaatgtgat cgttagttag ctaggtgaga cttacagcta tccatccgtc tagtttttcg
   158161 ttgtaatgat gatagtacgt ctatggtggt gatcgatttt ggttaacaat ttgttcgttt
   158221 aaaggcttaa tgtacttatg ctacatgatg tattattctt tgattcatcg ttcctcctaa
   158281 gggggtgtat gtatgtatgt actagtcgta tagtgttcct aacatcatga ctattcagac
   158341 tatggcttca tctatcgtgt ctaaagttca cttattctac tattactata tatatgcact
   158401 actatgtaac taggatatgg tcctataagg tgtcttctat cacggtggct tgtttatcgc
   158461 ttggcggtta cgagcaagag ttcatcacgg accagccgtg aggcagggca cacgcgggtt
   158521 ggcggcgatg atgtcccccg cgaaggggac aacgaaaaca agaggccgcc ggccgcggcc
   158581 acggacgcgt agcggttaca caatgtttgg ttgagcgttt tgtttcatcg tcgtggtggt
   158641 tttgttgttc tctgtatata tcgtgtggtg gctttatcgt catcattatt atcatcattc
   158701 ttgtttccat catcacgatg agttttctcc gttttcctct cctccagtgg tagtcgtgta
   158761 tcatcatcaa tcatcgtagt gacgtcgttg ctgctgctgc tcttgccttc atggcggtat
   158821 ttctcttcct cccccctaac cccatattaa ctcgtgagtg tgatggttag agtggctgct
   158881 tgtttttttt ttcttttctc tttggaacaa caaaagagga taaagatggt cggtgaatgt
   158941 attattatta tcatcattat gatacggtcg cggtcttctt ctccgatgac gaaacctgcg
   159001 cacatcgaag aaaagacgag cgcgcgaacc gatagccgtc cgtctgggac gaaggagaag
   159061 atgatgggga gaggaggaga gccccagaag ccagagcgag aagggagacg acagacatac
   159121 gtcgtcaccg tcctctggag gaggcacggc ggcgctgttt gttgtttgga tgcttgatta
   159181 tatcctgttc tatggggtag attattatca ataggcttgg ttttcaaagg tcagcctgtg
   159241 tattgtcgtg tctttttttt cgttctcatg atcgcggaga ccacacagac gtgcgcgtct
   159301 cccaatggct aggcgttctt tttaggtagt aattttttga tctttttttt ttcttaacaa
   159361 gtctggcttg atttctttta tctatgatcg attcttcttt ttctcggggg ttgcatcttc
   159421 cgtgaaagta aagtgacact actctaaatg gtaaccatat tatctgttga ttaggagaaa
   159481 aaataatttt ttcgcacgaa atcgatccta agtgaggtga tttacttgct atcacacgaa
   159541 atgattatct tttgctgcta acgtactgaa ttttgtaaca gaattgcttc tccgtaacta
   159601 tttccgcaga ttcagacaga ttgtcaaaaa aaaatacggc acagaaatag tgggtctgtg
   159661 gcttttggtt cgtgtacatt cgcgtttgcg tgtcgagatt tctacggtat gtttattctt
   159721 cctgcgatga tgtagggtcc ttggtgtaag taggatttcg agtatctctc ttagagcgaa
   159781 caaaataatc aaaaaacaac agctaggaaa tcgagggtta ctctacgata aagtgtctct
   159841 acaaagtgaa gaatgttacg ttgtggtgga ataataagac tcgcgtgatc gatgagtgat
   159901 cgagagcggc tcgaaccttc tttaagagct ttgtttagtg caactttaaa ttacaaggag
   159961 tagaaagctg aaatgaatct atgaaggtgc tattctttga atatcttact ttgtacgctt
   160021 cacattcgtt atttggatag agagttgtct agagaaaatc tgtgattctc tatgagtgtt
   160081 atttttatta tccttttggg gactacgatt tttcttcttg ttctacatac cactactact
   160141 cgtaatcaca tacatggacg aaaaaaaaaa attcgtcagg cagtagatac cagattctcc
   160201 gacgttacgg cgtctttttt tcttttgaga gagtatctgc tgagattgtc cgtggtgtat
   160261 ctagtcgcta tttttgttgt tactagtagt tttgcacaca gtttattcag tatagttttt
   160321 cttcttgcca tgatcaattg agcccaccac cttttttttt agagaggagg aatttcgtct
   160381 tgatctccag ccggagacaa cggcggtggt ggtggtggtg gtggcgggag agacttcaag
   160441 gcaatgaaaa aaaaatttcg ttttgccatc aagtggtgac gataacccgt cagattgata
   160501 attggttcct acagaaacta ttctaaccgc ggaagaaaga aattgaaaaa aaaaaaattg
   160561 acaaaaacat cataacataa aggaccacct acctgggacg cgcagttggg cggcggactg
   160621 gggtagcatg ctgcggcgat gctgtcggtg atggtctctt cctctctggt cctaatcgtc
   160681 ttttttctag gcgcttccga ggaggcgaag ccggcgacga cgacgataaa gaatacaaag
   160741 ccgcagtgtc gtccagagga ttacgcgacc agattgcaag atctccgcgt cacctttcat
   160801 cgagtaaaac ctacgttggt aggtcacgta ggtacggttt attgtgacgg tctttctttt
   160861 ccgcgtgtcg ggtgacgtag ttttcctctt gtagcaacgt gaggacgact actccgtgtg
   160921 gctcgacggt acggtggtca aaggctgttg gggatgcagc gtcatggact ggttgttaag
   160981 gcggtatctg gagatcgtgt tccccgcagg cgaccacgtc tatcccggac tcaagacgga
   161041 attgcatagt atgcgctcga cgctagaatc catctacaaa gacatgcggc aatgcgtaag
   161101 tgtctctgtg gcggcgctgt ccgcgcagag gtaacaacgt gttcatagca cgctgtttta
   161161 cttttgtcgg gctcccagcc tctgttaggt tgcggagata agtccgtgat tagtcggctg
   161221 tctcaggagg cggaaaggaa atcggataac ggcacgcgga aaggtctcag cgagttggac
   161281 acgttgttta gccgtctcga ggagtatctg cactcgagaa agtagcgttg cgatttgcag
   161341 tccgctccgg tgtcgttcac ccagttactt taataaacgt actgtttaac cacgttgcgt
   161401 cgtgacgttg tttgtgggtg ttgctaggcg ggctggaaag atgatgtata aatagagtct
   161461 gcgacggggt tcggcgctct gccggctgcg gcggcactcg ctccacggcc tccgacgagc
   161521 gttgcgctcg cgctttgcgc cgccgcgtca tggatctccc tactaccgtc gtgcgaaaat
   161581 actggacttt tgcgaatcct aaccgcatcc tgcatcagag cgtcaatcag actttcgacg
   161641 tgcgccagtt cgtctttgat accgcgcgtc tggtcaactg cgtggacggc gatggcaagg
   161701 tgctgcacct caacaagggc tggctctgcg ctaccattat gcagcacggc gaggcttcgg
   161761 ccggcgccaa gacgcagcag ggcttcatgt ccattgacat tacgggcgac ggggaacttc
   161821 aggagcacct ctttgtacgc ggcggtatcg tctttaacaa atccgtctcc tcggtggtgg
   161881 gctccagcgg acccaatgag agcgcgctgc tcactatgat ttccgagaac ggtaatttgc
   161941 aagtgactta cgtgcggcat tacctgaaaa accacggcga atcctccagc ggaggcggtg
   162001 gttgcggcgc cgcgtctact gcctccgccg tctgcgtgtc ctcgctgggt ggcagcggcg
   162061 ggactcgcga cggcccttct gcggaggaac agcaacggcg aaggcaggaa cagcgtcacg
   162121 aagaacggcg caaaaaatcg tcctcgtctg ccggtggtgg tggaggcggc ggcgctggtg
   162181 gtggcggtgg cggcggcggg agcggcggtc agcactcctc ggactccgcc aacggactgc
   162241 tgcgggatcc ccggttgatg aaccggcaga aggagcggcg gccgcctccc tcctccgaga
   162301 acgacggtga gtcccggccc tcttcgcgtc acggtgcttt ccgagtggac tcgtgagccc
   162361 cccgtagcgc acgagcgagc aggcgagcgg tgttggtgcg ctggtggttg tgtggatgat
   162421 aaccatgtgc tttttcgtgc gctatgtgtc gtcccgtctg taggctctcc tcccctccgg
   162481 gaggcgaaga gacaaaagac caccgcacag cacgaaggcc atggcggcgg cggcaagaac
   162541 gagacggagc agcagtccgg tggtgctggc ggtggtggtg gcggcggcag cggccgcatg
   162601 tcgctgccgc tggacacgtc tgaagcggtg gcctttctca attactcgtc ctcatcctcc
   162661 gcggtctctt cttcctccaa caaccaccac caccatcatc accaccataa cgccgtgacg
   162721 gacgtggccg ccggcaccga cggtgcgtta cttctaccca ttgagcgcgg agcggtggtt
   162781 tcgtcgccgt cgtcgacgtc gccgtcgtca cttctttcgc tccctcgacc cggcagcgcc
   162841 cacagcgcgg gcgagacggt gcaggagtcc gaggcggcgg cgacggcggc ggctgcgggg
   162901 ttaatgatga tgaggaggat gaggagggct ccggctgagg cggcggaggc accaccgcag
   162961 tcggaggagg agaatgattc caccactcca gtctctaact gccgtgttcc tccgaattcg
   163021 caggaatccg cggcgcctca gcctcctcgc agtccgcgtt ttgatgacat tatacagtca
   163081 ttgaccaaaa tgctcaatga ttgtaaggag aaaagattgt gcgatctccc cctggtttcc
   163141 agcagactct tgccagagac gtcgggcggg actgtcgtcg tcaaccacag cagcgtcgcg
   163201 aggaccgccg cagctgtctc cacagccggc gttggccccc cagcagccgc atgtccgcca
   163261 ctcgtcacca ccggtgttgt accctcaggt tccgtcgccg gtgtcgcgcc cgttgccgcc
   163321 gcagtcgaaa caccagctgc tcctccccgg cccgtgtgtg aaatcaagcc ctacgtggta
   163381 aaccccgttg tcgccaccgc cgcggctgcc agtaactctt cctcgtcttc ttctgctcca
   163441 ctgccgccgc cgccaccacc gccgggcgga cgtcggggtc gggcccggaa caatacccga
   163501 ggaggcggcg gtggtggcgg tggtagaaac agccggcggc aggccgcatc gtcgtcgtcc
   163561 tcctcctctc ggagatcgcg acggagaaac aaccgccacg aggacgagga ggacaacgac
   163621 cctctgctcc ggttgtcgca agtcgccggc agcggccgcc ggcgagggcc ctcgttcctc
   163681 gaggacggac tcgagattat cgatcccagc gaggaagctg cgatcgccgc cgcctcgatc
   163741 gcggcgtttt tcgacgatta aaaaaccgag ccgagaccgg aaaaaatatg aaacaggacg
   163801 cgcttggaca tttgggtttc cacccctttc ggtgtgtgtc tatatatatt gtggttactg
   163861 attttttttt acaataaaga gatagacatc acagttcacc accttgtctc cccggtgtgt
   163921 ctattatcat caatcaccca cagagtcgcc agtccatggt ctctcggtaa tgcgtgtcca
   163981 gatacgcgtt ggccaatata aaatggtcgt tgcccacgaa ggcgcgggtg gtgttgcgcg
   164041 gcgacgggtg gcaggacttg agtaccaagt gccgccgtcg gtcgatcagg tactcgcagg
   164101 tgtgcgcgtc ggcgccccac agcatgaaca ccagatgctc ccggcgctct gacagcctcc
   164161 ggatcacatg gttactcagc gtctgccagc ctaagtgacg gtgagatcca ggctgtccgt
   164221 gcaccacggt gaacacggtg ttgagcagca acacgccgcg tcgcgcccag gcgtccaagc
   164281 aacccgaggc cgggcgctga aacccgtcca ccgtacgtgc cagttcgcga aacacgttgt
   164341 tgagggaggg cggcggtagt cggcccgcca gcgtgccgaa ggccaggcca ctggcgctgc
   164401 cgtcgcagta cgggtcctgg cccacgatca ccacgcgcac ctgctcgggc ggacacagat
   164461 agctccagcg gtgtacgtgc tcgggtgccg ggtacaccat ctcgagttgc cgcgcgccct
   164521 ccaccgccgc caccgtgtcg cgcagcagca ccgtgtcgtg gtcgggcaag ctgaggaagc
   164581 ggatccagtc ggcgctcaga caaaacacgc gagcctgctc gtcgggggtt aacagagagc
   164641 ctttattatc agcaatgtta gcgagcatcc actgcttgag ggccatagcg cgagtgagcc
   164701 ggcaggttga cgcgcgtctg cttcagctcg ggcggcagtc cggcgtagta tttatctagg
   164761 tggcgtagca gcggcgggtc cagctggtga cgcaggcaga attccttcac tgcgttgtac
   164821 aggccgtaaa agagcgtgat gccctcgggc gcggcagcgg tgctcacggg cagacgcacg
   164881 gcgcggttgg tacgcgtggc ttcgttgcgt atggccacca ccacgttaaa gagagacggt
   164941 ggcaccagct cgaagcctaa cacgtgttcc gtgaagatgc tgcgcccgta tgacagtcgc
   165001 gtaaggtcgt agccgcggca caggtcgtcc acgcacgtgt acacggccgg cgagccatcg
   165061 ccgcactcgc tgtagccgcg catcaccgtc atccagcgcg gcgctgtgtc cgagctcaac
   165121 agcgtcagca gggcccgtaa ttgatccgga ttgttgtaca gcagggccag agtgtccagg
   165181 aaagcatcgt ccaacagcac ggagttggcg gcctccggcg taacgggacg gtaacggata
   165241 agttgcgata gcgggccatc gcgcccggta acatttacca acggacgcag ccaactttca
   165301 tacttgtcac cctgaaacac ctcacccaac aggcatcggc gcgttagttc gggacactcc
   165361 gcggggactt tcttggcggc ggtaggagcg acgctgacgg cgactgagga aacaatgggc
   165421 agcagaaggc aacaccacag cagtaccacc ggtccaggtg agaaagagaa gccgcaatcc
   165481 gggcggcggc acatcaagtc tgcggcacga tgagagtgtg acggtaagga gccagttggc
   165541 gccgaaagtt ggcgctcagg tcttcgatcc ctaaaacgtt atatattgca tccagcaggt
   165601 gagccaggct aaacggattc acgtaccagg tttggttacc cacgacgatg acggccagac
   165661 cgtgggcgct acagttggag aggttcctgg gtacgaaggt aactgagtcg atgtctcgcc
   165721 acggggggaa tgagacagac gactggcgca cgctgtaatc acaactgtga ttgacgtatt
   165781 gtagcgtgta atttaggttg cattcagcct cgaagtagag ggggaaccac agttcgtcgt
   165841 actcttcgtc gtcgtcctct tccaactccg actcttcttc acccaccgca atgtccacgc
   165901 tgctctgaga ttcctcttcg tacaggatga ttgacaggtt atggctacac aggtcctggg
   165961 cgggaggacg cgtgggagcg cgggtggtgg taatgttttc caggtcaaaa gttggagtgt
   166021 agtcggatgt tacatccccg ttggaggtgg tagaagttgc ggccggtgtc acggtggtaa
   166081 gtatggatac agaaggggag ggggaagtag cgttcgtacc gacggttgtg gtattattcc
   166141 ttgtgttttt tgcctcagaa actgttgacg tcgctggagc ggtggagatt gaattcgacg
   166201 tggcgctgga cgtggttgaa gtgacgttgg gggaggtagt agtggtaccg gtggtggcga
   166261 cggtagtgtt tgtcgtggcg gcggcagcgg tggtactggt aacggtggtc gtgttggttt
   166321 ccaccgcttc acacagtaag caaaagcaca gggccaggaa aagcaaccag ccccgccatc
   166381 gccgccgccg cttcatgagg tgggcaggcg aaagctggtg aattcgttgt acagtggcaa
   166441 gtggggcgcc gcgatcgaag ggtacgtcaa taagctgacg ttgatattaa atacgtctgg
   166501 ctgcttttct acgatggaag cgcacagggt cacggcgtca aacaggtctt tcttggtggc
   166561 gcccgagacc cacatctggt acacacccgt ttcgtggtac gaagtagagc gcggcaccac
   166621 cggacggatg cagtccagaa cgcggttggg atcctggtga aagaatttga atgtggctac
   166681 ggcctgtggc gtgtgcggca tcgtctgcgt gatgagctgc tggcccgcta acacggtgac
   166741 gttgtgcaac ttgagcaggg cactcttgag ggcttggaaa gcgttgccgc acgaggcgct
   166801 gatctgcagc tgcacggccg tggagtcgtg cagccgcatg agacgtgaca cctcttcgaa
   166861 gacgtactta tacttgttgg caaagagtgg cgcgtaccga cagtcggccg gcaaaatgta
   166921 ggtggcgtta ccgccgttgg tggccacggc gggcgcagcg gccgcggagg ccggcgtaaa
   166981 cagcgtcagc ggccggtggt ggctggtaag gtcgatcatg ggcggcgtgg tgaccgtggc
   167041 ggtggcgggc atgacggggt ttgcggcgac gggcactccg gccacagcgg cggcagcggc
   167101 ggccacggcg gcgctggccg agcccacacc cgccggcagt cctccgccac ccgtgacgcc
   167161 gccgggcaga gcgtcgccca gacagacttc cacagtggcg ggcgcgctct cggcggtcag
   167221 tacggtttgc cgatcgacct cgcgacgaaa gctggtgagg aactcactat gatccatggc
   167281 cgcagggccc gagatcccgg gattctgcgg gtgctgaccg agtgcgggcc gagttatatg
   167341 gaagacgatt agcttggagc ggagttttgc gtccctagct gacctgcgga tcagcgacgt
   167401 gccataggga tagattgtga gcggcggccg caacggcggg gtcggccgcc gctcgtcgtc
   167461 acggggcggc gcgagggaag aggaggtggt ggtgggtacg atcttgacgt ggttgacgtc
   167521 ctgcccgtcc gggggaatac gcaaaaaacc ccgccgtggc gctaccacga tggtgcgatg
   167581 ggtctttctc ttgttggccg gggccaggga cttgcagatg cgtgtggagc cgtagacgat
   167641 ctggacgtgg tcctgggaga acatgaccat cgccgccaac gctcagcggg gggacgcgtt
   167701 gggaacacag aggctgaggg aaaaccccgt aaaagtcaac gaaataaaga caacacagca
   167761 gccgctcctc tcttctcagg ccctaccact gcttgaagta gggcaccggg tgtttctttt
   167821 cctcaacagg ctcctccagt ctcttatagg accagtcccg ccggcgcgcc agcatgtagg
   167881 tcacgtacaa aagaataatc accatgaaca ccaggaaagc cagcacgccg taggccagca
   167941 gccggtcttc gaacagcggg tcgctcttga taaacacgta ggtggtggta aaacttcggc
   168001 ccgcgatctg aacgtggaga cgcacgacag tatacgtgcc gttgaggtag aagacaaact
   168061 cgcgtaaccg ttgtccgtta tacgtcacgt tactaatatt ccacggcgga atgagctggt
   168121 tgccttgatg cagatgcacg gtgctgttgg ggtgatagag gctgctaccg ttgagcaagc
   168181 agtgttcgtg ttcctgaagc agcacgcgga cccgcatcgt ggtggcgttc aagcgagtcc
   168241 cgtacacggc gtagatggga taggtgaaaa ggtcccaagt ggcgttgtga tggcggcccc
   168301 agctgaagaa agagcacgtg tactcagtgg tctcctgcgg tctgagtccc gagataagca
   168361 gctcttgagc cgtggcattg taggacagat gtagttttcc tgtggataaa attcataaac
   168421 tgtttatttt gatgtcaggt tagcggggga ggaaggggaa tagacggaaa ggtaggtgct
   168481 acttaccttt atcgtcggag gggaaagcgc taagataccc cacctgagtg aaaggacctt
   168541 tgcagtttgt ccgtgcataa caggtaactg ataaaatgtc tggatttttg gtgttgttca
   168601 acaggttaac tttgcaggtg gcgttcagag acacctggtc gtagctgtag ctggcttcgc
   168661 aattcacatt atacaggtgc ccctctttct gcgtcgtggt tgccacggag gtagaggcgg
   168721 acgtggaggt agagccggac gtgaaagtag aggtttgtac cgtggtggtg acggtggaag
   168781 taacgttatt gggggtattt atcgacgtag tgaatgtgac ggtgatatta ggggaagtga
   168841 cggcacttgt agtgctactt cccattcccg ggtgcgtgtt actcaagagc gcggctgcga
   168901 gcgcaatcgc cagtgcggga cacatgttgc cgtgtgacaa gacggcgggt ggacgagcta
   168961 tatgtggcga gaggccgcgt cacctcttgt gacgcttaaa tgtccagctc cagataaaag
   169021 aggcgttaat aatgaacacc acaaaaacca cttgcgtcag tatgacaatc ataaaggctc
   169081 gatgattact gcgcctaaag tatgcaggat tctccaccaa ttcatcctgt tgaacaaagt
   169141 ggatgattga cgtgctggtg ttaccggccg tcgtattgat catggatttt actaagaaag
   169201 ttttggcacc aaaagtcccg ttagagcccc agcaggtaac gctgccgttc acataggttc
   169261 ccggtgcccc tgtcagcatg cgtttcagtt catgagtata atttttccta tcgttataca
   169321 tatcatcact gtagttgact ttgctggtga gaaactgtgt gttctgtgga atactaatca
   169381 tcatccccga ggccaaaaag ggcgaatcgc aagctgtagt gttacagaaa atagtcaggt
   169441 tagtgtcatt atgttcatac atataagcca cgctaacttg gggctcatac cacccaatcg
   169501 caaccgccac cacgtcccat ctcccgacac ttatcaccgc caccactaac aacgtcaccc
   169561 ccgcacggta catagttacc ctctcgacgt cgccggctgt caatgacgtg cctgcgtcag
   169621 tggctatgat ttatagattt tggacacaac cgcaacggat ctgtcgtaat ctaccttcca
   169681 cagggccgcc gcgacgatgc tgaacgacag gatcagacag acggcgtata ggagtcctag
   169741 gtcggcgtcg acgcggcagg tgcggatgtc tcgcagggtg ggtagatggg cgatgcacaa
   169801 ctccttctcc ccccgcccgt acattccatc ccgtatcagc agccgtagcg tggcattgat
   169861 ggtcagcggg gtaaccaaag aaatcacata gggatgtgta caggaagtgc agtgacgggt
   169921 atccgtgaga tgtaagtcat caccctcatc accctcatca tgaaagacca ggactcgggt
   169981 gagacgaccc gatgaatact ggatctccca ccacagtctt tggtccaaca ccgagagggc
   170041 gcaagagatt ctaagtctcc ctgggttggg ggagcagatg taagccccgt gtgtgcccct
   170101 tgccatcaga gctatacaca tgagggggag aaggacaagt atccgggacc acccgcaccc
   170161 ccacatcacg agaccagaga cggagatgta taaaaaaagc tacttttatt aaacagcatt
   170221 ctcaccacac gttaatactg tcacggggaa tcactatgta caagagtcca tgtctctctt
   170281 tccagttttt cacttactga gacttgttcc tcaggtcctg gatggctgcc tcgatggcca
   170341 ggcttagggt gtccaggtct tcgggagggg tctcggtggg ctgctcaaac tgccccacgg
   170401 cgtaggcctt cgcggccgtc tcgtaaatag gcagcatgaa cccaccctgg ttggtggaga
   170461 agatgcgcac catgacctgt ttgggaaact tttgcatcag gggcaggcac aggttgagag
   170521 cgcccaacag gtccacgggg gtggcagcgt ggatgatcat gttgcggtaa tcggaggaac
   170581 gggggcataa ttggtgggtg tgcaattctt tgaggctcca cgcggccttg acgccttcgt
   170641 tacaagcatc ggccgtgcgc tgcgccactt cgggtgggtg tgtcacaggc atggtgtgct
   170701 ccatgaggaa gggagtggag agggccaggt tgcacatggt gcccaggcga caccgcaccg
   170761 catccacctc actcttcacc tcatgattgc gggtgtagat gatctggatg cccttgttgt
   170821 tcacctgcat ggttttgcag gctttgatgg cctcatctaa cacctggtgc atactgggaa
   170881 tcgtgaaggg caggttcttg tactcaagag agcgattggt gttgcggaac atgcggctca
   170941 cctcgtcaat cttgacgcga ccccgccgag tctgcacgtt gggtgtgcag aagggggtgt
   171001 tcttatcttt catgatattg cgcaccttct cgttgtccaa ctcggagatg cgcttgctct
   171061 tcttcttgcg gggtccggtg cttgccccgc cgctgctctg atggccgcag ctcaacaggg
   171121 aggaggaggc cgcgccacca aaaccgccgc gcccatggtg gctcgaggtc acggatgctc
   171181 ctccgccact gctgcatttc atctcctcgg actcactctc cgagtccgaa gccgaactgc
   171241 aggaggagga agacgaagag gaactatctt catcgggccg ggccagggga tcgggaagag
   171301 gagggtggtt catctgggag agcggatgcg tgggagaggt cactcgcggc gtgccgctgc
   171361 cggtggaagg ggaagacgcg gtggcaccgc gggtttcgac ttcttcaccc tgttcttcct
   171421 cgctatcaga gatcacgata cagccggcgg tatcgataat cttgttgcgg tactggatgg
   171481 taaagtcggg ctcgggcttg atgtcttcct gtttgatgag gggcagcatg ataggcgcgg
   171541 gaggcacggg cggtttaata atcaccttga aaggacgcgt ggttttgcgc ggtttcttac
   171601 gcgggctgag ctcgggagta gcggatgccc cggggagagg agtgttagta accgcgacgc
   171661 tggtgggggt cggcttgtta agaggggcgc tgctaacgct gcaagagtgg gttgtcagcg
   171721 tggggccggt gctactggaa tcgataccgg catgattgac agcctgggcg aggatgtcac
   171781 ctgatggtga taagaagaca cgggagactt agtacggttt tacaggcgtg acacgtttat
   171841 tgagtaggat tacagagtat aacatagagt ataatataga gtatacaata gtgacgtggg
   171901 atccataaca gtaactgata tatatacaat agtttagtgg tcagccttgc ttctagtcac
   171961 catagggtgg gtgctcttgc ctccagaggt ggtgggttcc tcagcaccat cctcctcttc
   172021 ctctgaggca acttgctcta tctcagacac tggctcagac ttgacagaca cagtgtcctc
   172081 ccgctcctcc tgagcaccct cctcccgttc ctcatcactc tgctcacttt cttcctgatc
   172141 actgttctca gccacaatca ctgaggacag agggatagtc gcgggtacag gggactctgg
   172201 gggtgacacc agagaatcag aggagctagc accagcggtg gccaaagtgt aggctgcaat
   172261 agcattttcc tcatctgact cctcagcgat ggcccgtagg tcatccacac taggagagca
   172321 gactctcaga ggatcggccc ccagaatgta ctgggcaaag accttcatgc agatctcctc
   172381 aatgcggcgc ttcatgatat tgataacctc aggcttggtt atcagaggcc gcttggccag
   172441 caacacacta gtctcctcta agatataaca gcacagcact cgacagaact cagtcaagag
   172501 agagatagcc ccgtacatgc ccatcataca agcgtcactg gtgaccttgt actcactgca
   172561 catggtctcc acacatgtag tgaggatatc cataaatata tgatcaatgt gcgtgagcac
   172621 cttgtctctc tcctcatcca gaatcttaaa gatcttctgg gaataagtca taatctcatt
   172681 aggagagcat tgaggcaagt tctgtaacgc cgccatggcc tggctgcagc cattggtggt
   172741 cttagggaag gctgagttct tggtaaagaa ctctacattc ctatagcaca tatacatcat
   172801 ctttctctta agttcgtcct ttttggcacg agccttagcc tgcagtgcac cccctagctt
   172861 gttagctgca cccttggtca cattatagag ttccttaata caagccatcc acatctcccg
   172921 cttatcctcg ggtacaatgt agttctcata catgttctgc atagttagcc caatacattt
   172981 catctcctcg aaaggctcat gaaccttatc taagatatct aaggcattct gcaaacatcc
   173041 tcccatcata ttaaaggcgc cagtgaattt ctcttccgtc tgggtatatt ttttcagcat
   173101 gtgctccttg attctatgcc gcaccatgtc cactcgaacc ttaatctgtt tgactgtaga
   173161 ggaggataac aacacatata agtatccgtc ctcctgactc atttatcgct atctcgatgc
   173221 cccgctcaca tgcaagagtt aatctttact ctatctgaca tacacaagta aatccacgtc
   173281 ccatgcaggt tagtatacat cacatacatg tcaacagact taccgagttc tgccaggaca
   173341 tctttctcgg ggttctcgtt gcaatcctcg gtcacttgtt caaaagtttt gagggattct
   173401 tcggccaact ctggaaacag cgggtctccc aggctcagct gactgttaac ctccttcctc
   173461 aacatagtct gcaggaacgt cgtggccttg gtcacgggtg tctcgggcct aaacacatga
   173521 gaaatagagt cataagcaca tgggtcacat acaggagata tgtatataac attaaaaata
   173581 caactttatt aaaaaaaaaa agagaggggc acaaaccccg acacgtaccg tggcaccttg
   173641 gaggaagggc cctcgtcagg gttgtcaggg tccatctttc tcttggcaga ggactccatc
   173701 gtgtcaagga cggtgactgc agaaaggatc catggaaagg aacagtctgt tagtctgtca
   173761 gctattatgt ctggtggcgc gcgcggcagc cacgagtact gctcagacta cactgccctc
   173821 caccgttaac agcaccgcaa cgggagttac ctctgactct tatcagaaca caacaactca
   173881 gctgcctgca tcttcttctg ctgctgcctt aagtcttcca aatgcgtcag cggtgcaagc
   173941 ccgctccccg agctcatttt cagacacata ccctaccgcc acggccttgt gcggcacact
   174001 ggtggtggtg ggcatcgtgc tgtgcctaag tctggcctcc actgttagga gcaaggagct
   174061 gccgagcgac catgagccgc tggaggcatg ggagcagggc tcggatgtag aagctccgcc
   174121 gctaccggag aagagcccat gtccggaaca cgtacccgag attcgcgtgg agattccacg
   174181 ctatgtttaa taaaaactgc gggcactggg gacggtgttg ttgtatatgt gaatttgtaa
   174241 ataataaatg agacctcatc ctgtaaaaat acagagtccg tgtcagtctc tgaaggacag
   174301 attattggca tatagccaat aaagggagtt gtggcaaaga gccatgttat ggattagtaa
   174361 tggaaagtat cgtcaccaat aggggagtgg tcaataatgg tcaataaccc acacctatag
   174421 gctaagctat accatcacct atagcgtaag gaagcggggg tgtataggcc ccaagccaaa
   174481 aacagtatag catgcataag agccaaaggg gtgtgcctat agagcctata ggcggtactt
   174541 acgtcactct tggcacgggg aatccgcgtt ccaatgcacc gttcccggcc gcggaggctg
   174601 gatcggtccc ggtgtcttct atggaggtca aaacagcgtg gatggcgtct ccaggcgatc
   174661 tgacggttca ctaaacgagc tctgcttata tagacctccc accgtacacg cctaccgccc
   174721 atttgcgtca atggggcgga gttgttacga cattttggaa agtcccgttg attttggtgc
   174781 caaaacaaac tcccattgac gtcaatgggg tggagacttg gaaatccccg tgagtcaaac
   174841 cgctatccac gcccattgat gtactgccaa aaccgcatca ccatggtaat agcgatgact
   174901 aatacgtaga tgtactgcca agtaggaaag tcccataagg tcatgtactg ggcataatgc
   174961 caggcgggcc atttaccgtc attgacgtca atagggggcg tacttggcat atgatacact
   175021 tgatgtactg ccaagtgggc agtttaccgt aaatactcca cccattgacg tcaatggaaa
   175081 gtccctattg gcgttactat gggaacatac gtcattattg acgtcaatgg gcgggggtcg
   175141 ttgggcggtc agccaggcgg gccatttacc gtaagttatg taacgcggaa ctccatatat
   175201 gggctatgaa ctaatgaccc cgtaattgat tactattaat aactagtcaa taatcaatgt
   175261 caacatggcg gtaatgttgg acatgagcca atataaatgt acatattatg atatggatac
   175321 aacgcatgca atggccaata gccaatattg atttatgcta tataaccaat gactaatatg
   175381 gctaatggcc aatattgatt caatgtatag atcgatatgc attggccatg tgccagcttg
   175441 atgtcgcctc tatcggcgat atagcctcat atcgtctgtc acctatatcg aaactgcgat
   175501 atttgcgaca cacagaatcg cccaagtcac caaagtcgtc tatcgccatc ccccgtaaac
   175561 gatataagcg ctatcgccag atatcgcgta tgcccaaaaa atcacttttg gaaaaatggc
   175621 gatatcagtt acacagaaac tcacatcggc gacattttca atatgccata ttttcaaata
   175681 tcgatttttc caatatcgcc atctctatcg gcgataaaca ccactatcgc gcgacatgaa
   175741 tttagtcggc gacagaaatc tcaaaacgcg tatttcggac aaacacacat tttattattc
   175801 actgcagcat atagcccatt ttagcgcggc acacatccag ccgtttgtgt tttttaacgc
   175861 tctccaggta ctgatccagg cccacgatcc gggttatctt gtcgtattcc aggttgatcc
   175921 atcgataggg aacgctgcca gcggcgccca gcaggtactg cgccttgtcg ttcactttgc
   175981 cgcagcgtat tcgcccgtca gccgctgtag ggataaatag tgcgatggcg tttgtgggag
   176041 aacgcagtag cgatgggttg cgacgtgcac gatccttcgt ggcaatgcca atggggcgtt
   176101 cccacgatta tcgtggcctg gataacatgc gcggctttag gaatttggtg tttggcggga
   176161 tcgtcggcgg atgtctcttc gggacccggc atcgcagccg tagtcggctg ttctgttttc
   176221 atgattttcc tctgcgcgta tctcatccgt taccgggaat tcttcaaaga ctccgtaatc
   176281 gacctcctta cctgccgatg ggttcgctac tgcagctgca gctgtaagtg cagctgcaaa
   176341 tgcatctcgg gcccctgtag ccgctgctgt tcagcgtgtt acaaggagac gatgatttac
   176401 gacatggtcc aatacggtca tcgacggcgt cccggacacg gcgacgatcc cgacagggtg
   176461 atctgcgaga tagtcgagag tcccccggtt tcggcgccga cggtgtccgt ccccccgccg
   176521 tcggaggagt cccaccagcc cgtcatccca ccgcagccgc cagcaccgac atcggaaccc
   176581 aaaccgaaga aaggtagggc gaaagataaa ccgaagggta gaccgaaaga caaacctccg
   176641 tgcgaaccga cggtgagttc acaaccaccg tcgcagccga cggcaatgcc cggcggtccg
   176701 cccgacgcgc ctccccccgc catgccgcag atgccacccg gcgtggccga ggcggtacaa
   176761 gctgccgtgc aggcggccgt ggccgcggct ctacaacaac agcagcagca tcagaccgga
   176821 acgtaacccg cccccggtgc gataaggaat tttccgactt ggcgcacatc tccttcctca
   176881 atgtttggac aataaacaca ttccttgcca aaaaatgacg tttccagaaa tccaaggcat
   176941 aaatgtccgt acaccggccc ttcccaacac ggagtttgag attccaagca ggagagaaga
   177001 tcatggtgtg gatatggctc ggcatcgggc tcctcggcgg taccggactg gcttccctgg
   177061 tcctggccat ttccttattt acccagcgcc gaggccgcaa gcgatccgac gagacttcgt
   177121 cgcgaggccg gctcccgggt gctgcttctg ataagcgtgg tgcctgcgcg tgctgctatc
   177181 gaaatccgaa agaagacgtc gtcgagccgc tggatctgga actggggctc atgcgggtgg
   177241 ccacccaccc gccgacgccg caggtgccgc ggtgtacgtc gctctacata ggagaggatg
   177301 gtctgccgat agataaaccc gagtttcctc cggcgcggtt cgagatcccc gacgtatcca
   177361 cgccgggaac gccgaccagc atcggccgat ctccgtcgca ttgctcctcg tcgagctctt
   177421 tgtcgtcctc gaccagcgtc gacacggtgc tgcatcagcc gccgccatcc tggaagccac
   177481 ctccgccgcc cgggcgcaag aagcggccgc ctacgccgcc ggtccgggcc cccaccacgc
   177541 ggctgtcgtc gcacagaccc ccgacgccga tacccgcgcc gcgtaagaac ctgagcacgc
   177601 cgcccaccaa gaaaacgccg ccgcccacga aacccaagcc ggtcggctgg acaccgccgg
   177661 tgacacccag gcccttcccg aaaacgccga cgccacaaaa gccgccgcgg aatccgagac
   177721 taccgcgcac cgtcggtctg gagaatctct cgaaggtggg actctcgtgt ccctgtcccc
   177781 gaccccgcac gccgacggag ccgaccacgc tgcctatcgt gtcggtttcc gagctagccc
   177841 cgcctcctcg atggtcggac atcgaggaac tcttggaaca ggcggtgcag agcgtcatga
   177901 aggacgccga gtcgatgcag atgacctgag accgaaagag cgagcgcgtc cgttgtacag
   177961 ttgtatagca gcacacgcct tccctctttt tcaccgcagc taagagagag aaagagagta
   178021 tgtcagtcaa gggcgtggag atgccagaaa tgacgtggga cttggacgtt agaaataaat
   178081 ggcggcgtcg aaaggccctg agtcgcattc accggttctg ggaatgtcgg ctacgggtgt
   178141 ggtggctgag tgacgccggc gtaagagaaa ccgacccacc gcgtccccga cgccgcccga
   178201 cttggatgac cgcggtgttt cacgttatct gtgccgtttt gcttacgctt atgattatgg
   178261 ccatcggcgc gctcatcgcg tacttaagat attaccacca ggacagttgg cgagacatgc
   178321 tccacgatct attttgcggc tgtcattatc ccgagaagtg ccgtcggcac cacgagcggc
   178381 agagaaggag acggcaagcc atggatgtgc ccgacccgga actcggcgac ccggcccgcc
   178441 ggccgttgaa cggagctatg tactacggca gcggctgtcg cttcgacacg gtggaaatgg
   178501 tggacgagac gagacccgcg ccgccggcgc tgtcatcgcc cgaaaccggc gacgatagca
   178561 acgacgacgc ggttgccggc ggaggtgctg gcggggtaac atcacccgcg actcgtacga
   178621 cgtcgccgaa cgcactgctg ccagaatgga tggatgcggt gcatgtggcg gtccaagccg
   178681 ccgttcaagc gaccgtgcaa gtaagtggcc cgcgggagaa cgccgtatct cccgctacgt
   178741 aagagggttg agggggccgt tcccgcgcga gtgctgtaca aaagagagag actgggacgt
   178801 agatccggac agaggacggt caccatggac gatctgccgc tgaatgtcgg gttacccatc
   178861 atcggcgtga tgctcgtgct gatcgtggcc atcctctgct atctggctta ccactggcac
   178921 gacaccttca aactggtgcg catgtttctg agctaccgct ggctgatccg ctgttgcgag
   178981 ctgtacgggg agtacgagcg ccggttcgcg gacctgtcgt ctctgggcct cggcgccgta
   179041 cggcgggagt cggacagacg ataccgtttc tccgaacggc ccgacgagat cttggtccgt
   179101 tgggaggaag tgtcttccca gtgcagctac gcgtcgtcgc ggataacaga ccgccgtgtg
   179161 ggttcatcgt cttcgtcgtc ggtccacgtc gctagccaga gaaacagcgt gcctccgccg
   179221 gacatggcgg tgacggcgcc gctgaccgac gtcgatctgt tgaaacccgt gacgggatcc
   179281 gcgacgcagt tcaccaccgt agccatggta cattatcatc aagagtacac gtgaatgaga
   179341 aaaagaaaaa agaggggagc ggatcgcgat aatgtcgctt tgacattctc tgctcgatct
   179401 actcagcgtc tgcacgaaac ggcatccgca cggaggcgag cccaagcgta tctgcagcaa
   179461 gcggttcttt ccctcggtga tggtggcagc atcggtggcg ggagcttgtt cggacgatgg
   179521 acggtgagga gtccctggcg atcaggcggc tcccgggtgt ggagttcaac gggtggtaat
   179581 ggtggcggtg atcggtgtta gaaaacggtg gccctggcaa acatatatct actgtaaacc
   179641 ctctgctctg ttaataaaaa gcacactttt cacatgagtt cgtaatttta ttgtgtagtg
   179701 gaaattttta cgtcattggg aaaccccaga atgaaagagt ataatgtgca tatcaccggg
   179761 ggttccctgt cagtacgaat gtacacaacg cgggttacat tacgataaac tttccggtaa
   179821 aacgatgccg atacagcgtg tataacgctg attgttacga caaacgagtt ggtatatcca
   179881 ttatatagta acgaacatgc tgtggatatt agttttattt gcactcgccg catcggcgag
   179941 tgaaaccact acaggtacca gctctaattc cagtcaatct actagtgcta ccgccaacac
   180001 gaccgtatcg acatgtatta atgcctctaa cggcagtagc tggacagtac cacagctcgc
   180061 gctgcttgcc gctagcggct ggacattatc tggactcctt ctcttattta cctgctgctt
   180121 ttgctgcttt tggctagtac gtaaaatctg cagctgctgc ggcaactcct ccgagtcaga
   180181 gagcaaaaca acccacgcgt acaccaatgc cgcattcact tcttccgacg caacgttacc
   180241 catgggcact acagggtcgt acactccccc acaggacggc tcatttccac ctccgcctcg
   180301 gtgacgtagg ctaaaccgaa acccacgttg aacctaacgc ggtttcggaa ggcctgagac
   180361 gtcactttca caatgacgtc cgtatacacg ttcatcataa aacaccgtag aggctaaggc
   180421 ttcggtaggg agagacctca actgttcctg atgagcaccc gtgctctcat ctcttcagac
   180481 ttgtcatgac ccccgctcag actaacgcga ctaccaccgt gcacccgcac gacgcaaaaa
   180541 acggcagcgg cggtagtgcc ctgccgaccc tcgtcgtttt cggctttatc gttacgctac
   180601 ttttctttct ctttatgctc tacttttgga acaacgacgt gttccgtaag ctgctccgct
   180661 gcgcttggat ccagcgctgt tgcgaccgct tcgacgcgtg gcaagacgag gtcatctacc
   180721 gtcgtccatc acgtcgttcc cagagcgacg acgagagtcg tactaacagc gtgtcatcgt
   180781 acgttctttt atcacccgcg tccgatggcg gttttgacaa cccggcactg acagaggccg
   180841 tcgacagcgt ggacgactgg gcgaccacct cggttttcta cgccacgtcc gacgaaacgg
   180901 cggacgccga gcgccgagac tcgcagcaac tgctcatcga gcttccgccg gagccgctcc
   180961 cgcccgacgt ggtggcggcc atgcagaaag cagtgaaacg cgctgtacag aacgcactac
   181021 gacacagcca cgactcttgg cagcttcatc agaccctgtg acgcagatga acgttccttc
   181081 ttaaacatcc gaggtagcaa tgagacaggt cgcgtaccgc cggcgacgcg agagttcctg
   181141 cgcggtgctg gtccaccacg tcggccgcga cggcgacggc gagggggagg cagcaaaaaa
   181201 gacctgcaaa aaaaccggac gctcagttgc gggcatcccg ggcgagaagc tgcgtcgcac
   181261 ggtggtcacc accacgccgg cccgacgttt gagcggccga cacacggagc aggagcaggc
   181321 gggcagcgtc tctgtgaaaa agggaagaaa agaatcatca tgtgccgccg ggagtcgctc
   181381 cgaactctgc cgtggctgtt ctgggtgctg ttgagctgcc cgcgactcct cgaatattct
   181441 tcctcttcgt tccccttcgc caccgctgac attgccgaaa agatgtgggc cgagaattat
   181501 gagaccacgt cgccggcgcc ggtgttggtc gccgagggag agcaagttac catcccctgc
   181561 acggtcatga cacactcctg gcccatggtc tccattcgcg cacgtttctg tcgttcccac
   181621 gacggcagcg acgagctcat cctggacgcc gtcaaaggcc atcggctgat gaacggactc
   181681 cagtaccgcc tgccgtacgc cacttggaat ttctcgcaat tgcatctcgg ccaaatattc
   181741 tcgcttactt ttaacgtatc gatggacaca gccggcatgt acgaatgcgt gctacgcaac
   181801 tacagccacg gcctcatcat gcaacgcttc gtaattctca cgcagctgga gacgctcagc
   181861 cggcccgacg aaccttgctg cacaccggcg ttaggtcgct actcgctggg agaccagatc
   181921 tggtcgccga cgccctggcg tctacggaat cacgactgcg gaacgtaccg cggctttcaa
   181981 cgcaactact tctatatcgg ccgcgccgac gccgaggatt gctggaaacc cgcatgtccg
   182041 gacgaggaac ccgaccgctg ttggacagtg atacagcgtt accggctccc cggcgactgc
   182101 taccgttcgc agccacaccc gccgaaattt ttaccggtga cgccagcacc gccggccgac
   182161 atagacaccg ggatgtctcc ctgggccact cggggaatcg cggcgttttt ggggttttgg
   182221 agtattttta ccgtatgttt cctatgctac ctgtgttatc tgcagtgttg tggacgctgg
   182281 tgtcccacgc cgggaagggg acgacgaggc ggtgagggct atcgacgcct accgacttac
   182341 gatagttacc ccggtgttag aaagatgaag aggtgagaac acgtataaaa taaaaaaata
   182401 atatgttaaa aaatgcagtg tgtgaagtgt gaatagtgtg attaaaatat gcggattgaa
   182461 tgggtgtggt ggttattcgg atactttgtg tcatccgttg ggagcgaacg gtcattatcc
   182521 tatcgttacc acttggaatc taattcatct accaacgtgg tttgcaacgg aaacatttcc
   182581 gtgtttgtaa acggcaccct aggtgtgcgg tataacatta cggtaggaat cagttcgtct
   182641 ttattaatag gacaccttac tatacaagta ttggaatcat ggttcacacc ctgggtccaa
   182701 aataaaagtt acaacaaaca acccctaggt gacactgaaa cgctttataa tatagatagc
   182761 gaaaacattc atcgcgtatc tcaatatttt cacacaagat ggataaaatc tctgcaagag
   182821 aatcacactt gcgacctcac aaacagtaca cctacctata catatcaagt aaacgtgaac
   182881 aacacgaatt acctaacact aacatcctcg ggatggcaag accgtctaaa ttacaccgtc
   182941 ataaatagta cacactttaa cctcacagaa tcgaacataa ccagcattca aaaatatctc
   183001 aacactacct gcatagaaag actccgtaac tacaccttgg agtccgtata caccacaact
   183061 gtgcctcaaa acataacaac atctcaacac gcaacaacca ctatgcacac aatacctcca
   183121 aatacaataa caattcaaaa tacaactcaa agccatactg tacagacgcc gtcttttaac
   183181 gacacacata acgtgacgaa acacacgtta aacataagct acgttttatc acaaaaaacg
   183241 aataacacaa catcaccgtg gatatatgcc atacctatgg gcgctacagc cacaataggc
   183301 gccggtttat atatcgggaa acactttacg ccggttaagt tcgtatacga ggtatggcgc
   183361 ggtcagtaaa gacgattcgg attcaacaca tatactcccc acgatcctcg aacaccttac
   183421 agcatatgag caaaaaacaa gaaagtatag ccacaatcac atttgggcga ataacatgct
   183481 gtcatccact agcgtctatt aatctaatgt ttaacgggag ctgtactgtc accgttaaaa
   183541 tatccatggg aatcaacggg tcaaccaacg tccatcagct tgtgattgtg ctccatctgg
   183601 gtaaccgctg tcagccttgg cgacaggtgt aatcacagct gtcacataac tcacgaagcc
   183661 tccaatcaca gcagcacaca tagtcctaac gccattggcg tgtataaaag ttcggaaaac
   183721 ttgacggttg tacggcacga caaatcgatg tagtggtatg tttttccagc agagaccgtg
   183781 tgcggtctct taggttcgct atactgtggc tggaaactgg ttacctgtga agatggctaa
   183841 ctatcctgtt ctgtcctgga aaaacttttg gcgtcgtagg tggactttgc agtatgcggg
   183901 ttagtgaagt tatgtcattt atttacgttt acgatctcgt attacaaacc gcggagagga
   183961 tgataccgtt cggccccatg agttattttt attcttccgg taggaggcat gaagcctctg
   184021 ataatgctca tctgctttgc tgtgatatta ttgcagcttg gagtgactaa agtgtgtcag
   184081 cataatgaag tgcaactggg caatgagtgc tgccctccgt gtggttcggg acaaagagtt
   184141 actaaagtat gcacggatta taccagtgta acgtgtaccc cttgccccaa cggcacgtat
   184201 gtatcgggac tttacaactg taccgattgc actcaatgta acgtcactca ggtcatgatt
   184261 cgtaactgca cttccaccaa taataccgta tgcgcaccta agaaccatac gtacttttcc
   184321 actccaggcg tccaacatca caaacaacga cagcaaaatc ataccgcaca tataaccgtc
   184381 aaacaaggaa aaagcggtcg tcatactcta gcctggttgt ctctctttat ctttcttgtg
   184441 ggtatcatac ttttaattct ctatcttata gccgcctatc ggagtgagag atgccaacag
   184501 tgttgctcaa tcggcaaaat tttctaccgc accctgtaag cttcctgttg ttgtttttac
   184561 atcacggtac gatgaagtca cacagataat tacagatgag ctgttcatat tttttattat
   184621 tttttccaat tcctgcacta aaaaaagaag cactttacgg aaccgtgtct gagtatctgt
   184681 ggggaattta ggtacttttt gccgacgtca ggaaaaataa gctgtcgcct acataagagc
   184741 ccggtgctat cgtgctgtca ctctttcttg ttgccttcga tgtacggcgt cctggctcat
   184801 tactactcct tcatcagtag ccccagcgtt atggttaatt ttaagcatca taacgccgtg
   184861 cagctgttat gtgcacggac ccgagacggc actgccggat gggaacgttt aacccatcat
   184921 gcgtcgtatc acgcgaacta cggggcatac gccgtgttga tggctacatc gcaaagaaag
   184981 tccctagtgt tacatcgata cagtgccgtg acagccgtgg ccctgcagct catgcctgtt
   185041 gagatgctcc gcaagctaga tcagtcggac tgggtgcggg gtgcctggat cgtgtcagag
   185101 acttttccaa ctagcgaccc caaaggagtt tggagcgacg atgactcctc gatgggtgga
   185161 agtgatgatt gatgatgaga acctgacaag aaagacgaga gagaaattta gagctgtcat
   185221 tgtagaatta gtctagattc ctgataataa acagtatcga ttttgaaacc taattgacgt
   185281 gtgatcgatt tttaaacctc tgtgttgtgt gattgattgg tatgtggggg gatccgattt
   185341 caaagggggg tacttatcgg gaattgatgt gtcatggacg cagttttgag cgattttccg
   185401 ggaataccgg atattacgaa ttactggtag tgacgtagat aataaaatta taatgcgatt
   185461 aatttttggt gcgttgatta tttttttagc atatgtgtat cattatgagg tgaatggaac
   185521 agaattacgc tgcagatgtc ttcatagaaa atggccgcct aataaaatta tattgggtaa
   185581 ttattggctt catcgcgatc ccagagggcc cggatgcgat aaaaatgaac atttattgta
   185641 tccagacgga aggaaaccgc ctggacctgg agtatgttta tcgcccgatc acctcttctc
   185701 aaaatggtta gacaaacaca acgataatag gtggtataat gttaacataa cgaaatcacc
   185761 aggaccgaga cgaataaata taaccttgat aggtgttaga ggataatatt taatgtatgt
   185821 tttcaaacag acaagttcgt taaaacaaaa tattacagta tgtgtttaat atggtgctaa
   185881 catggttgca ccatccggtt tcaaactcgc atatcaatct gttatcggta cgacacctgt
   185941 cattaatcgc atatatgtta cttaccatat gtcccctagc cgtccatgtt ttagaactag
   186001 aagattacga caggcgctgc cgttgcaaca accaaattct gttgaatacc ctgccggtcg
   186061 gaaccgaatt gcttaagcca atcgcagcga gcgaaagctg caatcgtcag gaagtgctgg
   186121 ctattttaaa ggacaaggga accaagtgtc tcaatcctaa cgcgcaagcc gtgcgtcgtc
   186181 acatcaaccg gctatttttt cggttaatct tagacgagga acaacgcatt tacgacgtag
   186241 tgtctaccaa tattgagttc ggtgcctggc cagtccctac ggcctacaaa gcctttcttt
   186301 ggaaatacgc caagagactg aactaccacc acttcagact gcgctggtga tcatgtccct
   186361 attttaccgt gcggtagctc tgggcacgct aagcgctttg gtgtggtaca gcactagcat
   186421 cctcgcagag attaacgaaa attcctgctc ctcatcttct gcggatcacg aagactgcga
   186481 ggaaccggac gagatcgttc gcgaagagca agactatcgg gctctgctgg ccttttccct
   186541 agtgatttgc ggtacgctcc tcgtcacttg tgtgatctga gacgtcatgc tggtagcgtt
   186601 tatgagtcgg gcggtggccg acacgccgca tttcctaacc cgcgcagcat gttgcgcttg
   186661 ctgttcacgc tcgtcctgct ggccctccac gggcagtctg tcggcgctag ccgcgactat
   186721 gtgcatgttc ggctactgag ctaccgaggc gaccccctgg tcttcaagca cactttctcg
   186781 ggtgtgcgtc gacccttcac cgagctaggc tgggctgcgt gtcgcgactg ggacagtatg
   186841 cattgcacac ccttctggtc taccgatctg gagcagatga ccgactcggt gcggcgttac
   186901 agcacggtga gccccggcaa ggaagtgacg cttcagcttc acgggaacca aaccgtacag
   186961 ccgtcgtttc taagctttac gtgccgcctg cagctagaac ccgtggtgga aaatgttggc
   187021 ctctacgtgg cctacgtggt caacgacggc gaacgcccac aacagttttt tacaccgcag
   187081 gtagacgtgg tacgctttgc tctatatcta gaaacactct cccggatcgt ggaaccgtta
   187141 gaatcaggtc gcctggcagt ggaatttgat acgcctgacc tagctctggc gcccgattta
   187201 gtaagcagcc tcttcgtggc cggacacggc gagaccgact tttacatgaa ctggacgctg
   187261 cgtcgcagtc agacccacta cctggaggag atggccttac aggtggagat tctaaaaccc
   187321 cgcggcgtac gtcaccgcgc tattatccac catccgaagc tacagccggg cgttggcctg
   187381 tggatagatt tctgcgtgta ccgctacaac gcgcgcctga cccgcggcta cgtacgatac
   187441 accctgtcac cgaaagcgcg cttgcccgca aaagcagagg gttggctggt gtcactagac
   187501 agattcatcg tgcagtacct caacacattg ctgattacaa tgatggcggc gatatgggct
   187561 cgcgttttga taacctacct ggtgtcgcgg cgtcggtaga ggcttgcgga aaccacgtcc
   187621 tcgtcacacg tcgttcgcgg acatagcaag aaatccacgt cgccacatct cgagaatgcc
   187681 ggccttgcgg ggtccccttc gcgcaacatt cctggccctg gtcgcgttcg ggttgctgct
   187741 tcagatagac ctcagcgacg ctacgaatgt gaccagcagc acaaaagtcc ctactagcac
   187801 cagcaacaga aataacgtcg acaacgccac gagtagcgga cccacaaccg ggatcaacat
   187861 gaccaccacc cacgagtctt ccgttcacaa cgtgcgcaat aacgagatca tgaaagtgct
   187921 ggctatcctc ttctacatcg tgacaggcac ctccattttc agcttcatag cggtactgat
   187981 cgcggtagtt tactcctcgt gttgcaagca cccgggccgc tttcgtttcg ccgacgaaga
   188041 ggccgtcaac ctgttggacg acacggacga cagtggcggc agcagcccgt ttggcagcgg
   188101 ttcccgacga ggttctcaga tccccgccgg attttgttcc tcgagccctt atcagcggtt
   188161 ggaaactcgg gactgggacg aggaggagga ggcgtccgcg gcccgcgagc gcatgaaaca
   188221 tgatcctgag aacgtcatct atttcagaaa ggatggcaac ttggacacgt cgttcgtgaa
   188281 tcccaattat gggagaggct cgcctttgac catcgaatct cacctctcgg acaatgagga
   188341 ggaccccatc aggtactacg tttcggtgta cgatgaactg accgcctcgg aaatggaaga
   188401 accttcgaac agcaccagct ggcagattcc caaactaatg aaagttgcca tgcaacccgt
   188461 ctcgctcaga gatcccgagt acgactaggc tttttttttt gtctttcggt tccaactctt
   188521 tccccgcccc atcacctcgc ctatactatg tgtatgatgt ctcataataa agctttcttt
   188581 ctcagtctgc aacatgcagc tgtgtcgggt gtggctgtct gtttgtctgt gcgccgtggt
   188641 gctgggtcag tgccagcggg aaaccgcgga aaaaaacgat tattaccgag taccgcatta
   188701 ctgggacgcg tgctctcgcg cgctgcccga ccaaacccgt tacaagtatg tggaacagct
   188761 cgtggacctc acgttgaact accactacga tgcgagccac ggcttggaca actttgacgt
   188821 gctcaagagg tgagggtacg cgctaaaggt gcatgacaac gggaaggtaa gggcgaacgg
   188881 gtaacggcta agtaaccgca tggggtatga aatgacgttt ggaacctgtg cttgcagaat
   188941 caacgtgacc gaggtgtcgt tgctcatcag cgactttaga cgtcagaacc gtcgcggcgg
   189001 caccaacaaa aggaccacgt tcaacgccgc cggttcgctg gcgccacacg cccggagcct
   189061 cgagttcagc gtgcggctct ttgccaacta gcctgcgtca cgggaaataa tatgctgcgg
   189121 cttctgcttc gtcaccactt tcactgcctg cttctgtgcg cggtttgggc aacgccctgt
   189181 ctggcgtctc cgtggtcgac gctaacggca aaccagaatc cgtccccgcc atggtctaaa
   189241 ctgacgtatt ccaaaccgca tgacgcggcg acgttttact gtccttttct ctatccctcg
   189301 cccccacggt cccccttgca attctcgggg ttccagcagg tatcaacggg tcccgagtgt
   189361 cgcaacgaga ccctgtatct gctgtacaac cgggaaggcc agaccttggt ggagagaagc
   189421 tccacctggg tgaaaaaggt gatctggtat ctgagcggtc gcaaccagac catcctccaa
   189481 cggatgcccc aaacggcttc gaaaccgagc gacggaaacg tgcagatcag cgtggaagac
   189541 gccaagattt ttggagcgca catggtgccc aagcagacca agctgctacg cttcgtcgtc
   189601 aacgatggca cgcgttatca gatgtgtgtg atgaagctgg agagctgggc ccacgtcttc
   189661 cgggactaca gcgtgtcttt tcaggtgcga ttgacgttca ccgaggccaa taaccagact
   189721 tacaccttct gtacccatcc caatctcatc atttgagccc gtcgcgcgcg cagggaattt
   189781 tgaaaaccgc gcgtcatgag tcccaaagac ctgacgccgt tcttgacgac gttgtggctg
   189841 ctattgggtc acagccgcgt gccgcgggtg cgcgcagaag aatgttgcga attcataaac
   189901 gtcaaccacc cgccggaacg ctgttacgat ttcaaaatgt gcaatcgctt caccgtcgcg
   189961 tacgtatttt catgattgtc tgcgttctgt ggtgcgtctg gatttgtctc tcgacgtttc
   190021 tgatagccat gttccatcga cgatcctcgg gaatgccaga gtagattttc atgaatccac
   190081 aggctgcggt gtccggacgg cgaagtctgc tacagtcccg agaaaacggc tgagattcgc
   190141 gggatcgtca ccaccatgac ccattcattg acacgccagg tcgtacacaa caaactgacg
   190201 agctgcaact acaatccgta agtctcttcc tcgagggcct tacagcctat gggagagtaa
   190261 gacagagagg gacaaaacat cattaaaaaa aaaagtctaa tttcacgttt tgtacccccc
   190321 ttcccctccg tgttgtagcc catcggccgc ggcgatctcc tagtaacact cgtccgacac
   190381 ttccaccatc tccagctcgg ccggcggttc ggcatcctct accagcggcg tcgtctcatc
   190441 tttgccgcag cagcggacgc acaccttctc caggcagaac gccaccagct gccgccgaac
   190501 gtaccacagg tacacgtgca gacctgcgaa caggactacg gaggtcatga ccaccacgac
   190561 gcacacggga atccagggat cgagattgtt gctggaactc atggctatcg ccaccgacgt
   190621 gcccgcgtct gtctcaccgc cgctcgcccg atgtcgcgcg gcttgttata cgctagcccg
   190681 tcgccgcctc ggggcacggt gccctcctac ccacgtaact tcctccgtga cttaaagtcg
   190741 cgtgtggtag atctcctgct ccgtggacga accgtccggc aggatagcgg ttaaggattc
   190801 ggtgctaagg ccgtgtcgcc aacgtcgaat gctacgttgc aacagcttcg acggacggcc
   190861 atcccctctc tcatcgcaat aataaaacac cagcagcgcg cacgacgcga tcacggtgac
   190921 acccatgatt agacccacgc agatagccag ccccgctagc gtatctagcg ccatcccgtt
   190981 cgctcccgtt gtctcctgag cgaagcaact tctcggtccc cgttttcaac agtttttgtt
   191041 tccttctccg cgactagatg ttaacgcccg cggtctttcc ggccgtgctc tacctcctgg
   191101 cgcttgtcgt ctgggttgag atgttctgcc tcgtcgccgt agccgtcgtc gagcgcgaga
   191161 tcgcctgggc gctgctgctg cggatgctgg tcgttggcct gatggtggaa gtcggcgccg
   191221 ccgccgcttg gaccttcgtg cgttgtcttg cctatcagcg ctccttcccc gtgcttacgg
   191281 ccttcccctg aaacccacgt taaccgaccg tcccaaaaac gccggtgtta acacaggaaa
   191341 aaaagaaacc acgcaggaac cgcgcaggaa ccacgcggaa catgggacac tatctggaaa
   191401 tcctgttcaa cgtcatcgtc ttcactctgc tgctcggcgt catggtcagt atcgtcgctt
   191461 ggtacttcac gtgaaccacc gtcgtcccgg tttaaaaacc atcatcgacg gccgttataa
   191521 agccacccgg acacgcgccg cggcacttgc ctacggcgct gcttcaggga aactcctctt
   191581 ccttctgctc ttcctccttc accgcaggga tcgtttccct cgaccaggga ctcgccgaag
   191641 caaccgccgg agcaacctgg aggagtcgcg gcatgacggc gcccaagtgt gtcaccacca
   191701 gtacttatct ggtcaagacc aaggaacagc cctggtggcc cgacaacgcc atcaggagat
   191761 ggtggatcag tgttgctatc gtcatcttca tcggagtctg tctggtggcc ctgatgtact
   191821 ttacgcagca gcaggcacgc agcgggagca gcagcggcta gacaagtctc tggcggctac
   191881 agctccaagc gccgtagccg ggccgcctgc cgatcgcgac gtcgtggacc atcgaacaga
   191941 gactcacgcg tacgagaccc cgaggtacgc cacgcggtgc ctaacgcggt ataccacacc
   192001 cgtacggtct gcagtgcggc gtacaacgtg tggaaaacgc gttgcgtcgc agagtccgcc
   192061 acgttcctgt cttgtcgctc cccaatcgtc tcccgcacac cccccgcgac acccagaggg
   192121 cgggtgagcc aagtattctt aaggccgttc tttgttccat agcccataaa ttgttgattc
   192181 cggagctcgt tggcgcggaa atagccggat aaggggagca acaaccgttg gcgaaagccg
   192241 tcccgctcat tcagtccggg tttcgcgtcc agtcggacgt gtgaccgttg ggcaacggaa
   192301 cggcgtttca ctgccaaaat cgtatcgggt agtgtacgag acgtcggcgg tgcagaatgc
   192361 gactcgcggc gtagctcgcc gtcgctatgc ggctcgtcgc cgtgtggcgc ggcctggccg
   192421 gctgtctgcg tccagatctg ttggcctttt ggttcctctg gctgctgctg cgtgtgtgct
   192481 ttggtagacg cggtggcagt ttgcggtctg cggtaagtga ggatgtcgcc gagcaaacgc
   192541 acttgcggcg cgtgggcggc acgcgtgtca ttgtaggttc gttgccagat ggcaagtgct
   192601 gtcaacagca ggcgttgtgg gcggtcggtg tatttttgtg ggttgcggtg agagtcggca
   192661 ctcggtgttt tgtgagtcat ctcaactatc tgtgttgctt tgagcagcgt ccagaacagc
   192721 gacgcgactt tggggatggc ctcgtgctca cctccgcgga gagcgccgcc ggacctgctc
   192781 gtcagcagcg agctacgcag acggaatatc tggaggagag ttacgtgtgt cacaggagag
   192841 cgcgggtctc cggcggtaac gacggcggtg tcgtcgacac gtgtgcggcc tgttgtgctc
   192901 tgcggaaaag tgccggtctc ggagaccgtg gacgaaaaag agaacgcagc agctaccgct
   192961 ggcggcggcg gcgttaatgc agccgttgat gttcgacgtt gtgagcactc ggaaacagcg
   193021 gtgaggcaga aggtcgattc tccagggaac gacagtcgat gcgtggtagc cgcagcaggt
   193081 gaggttgggg cggacaacgt gttgcggatt gtggcgagaa cgtcgtcctc cccttcttca
   193141 ccgccccacc caccctcggt tggtgtttct tttttcttgt gtcctgcaga tagttccacg
   193201 gacagcgacg gcaagtccat aatcagcggt gtgcaagtgg tggaacacga cgaagatatc
   193261 atcgcgccgc agagtttgtg gtgcacggcg ttcaaggaag ccctctggga tgtggctctg
   193321 ttggaagtgc cgcgttgggc gtggcagggc tggaagaggt ggcgcaacag cgaggccggg
   193381 cgtcgatgga gtgctgggtc tgcgtcggct tccagcttgt ctgacttggc gggcgaggcc
   193441 gttggagaat tggtgggatc ggtcgtcgcg tacgtgatcc ttgaacgtct gtggttggca
   193501 gccagaggtt gggtgtgcga aacaggtgtg gaagccgagg aggccatgtc gcggcggcga
   193561 cagcgcatgc tgtggcgtat gttctctcgt ggaggcgacg gcgaatgcag cagacggtgt
   193621 tcgatggaga tggcgtgcgg ggaagaaagc gccgtgttgt gagcagacga cgtaggatgc
   193681 gggacgtcgg agcacatggg ccatgtgtgg tggcagatgg cggtgtccgc tggtgtctgc
   193741 tgcggcagtg catagacgaa gcaacatgtc gctgtgaaga gatagagtgt gagcatagct
   193801 gcatgcagcg ttgcgtgtat aagcgggggg gattaagacg ttaataaaga atagcggcgg
   193861 ttctgatagg gcgaccgctg aagtgagctg cgtgtgcgtg tggtttgtgg agtccccgcc
   193921 gcccccggtc ccgtgtccgc cggcaaagcc ccccggctcc gcacactcct ggccgcgcaa
   193981 ccctcgtcgc tgcaaaagcc ccccgtcccc gcacaccccc gcgaccgccg gtcccgcgag
   194041 tccccgtccc cgccgcaaaa ggcccccgtc ctcgccgcaa acacccccgc cacccccgtc
   194101 cctcagcccg ggtccgcgag tccccgttcc cagcgtaatc cccgtacccg caacgccccg
   194161 gccccaccgc cgtcccgcac accccccgtc ccccagcccg gtgcccagcg tgcgaaaaaa
   194221 gctccgtccc tcacacccgc agaaagatcc ctcagcgcgg tgaaaccccg tccccagcgc
   194281 cgtgccgctg acaaagacca tgggacgaca cgcacaggca gcgcgcacaa agcgctggtc
   194341 gaaacacgcc gcaaacgccg ccccgcgctg acgcaccgca aacctccctt agtccggtct
   194401 cgcgaacaaa tagcgtggga cgccacgcac cggtagtgtg tacaaaggga ggcgtgctca
   194461 cggcccgcaa acctccgtga gccctgtccc gcaccggcgc cgttcggggt gtgtcggggg
   194521 cgcggctggg tgggtgggtg tgtgccgggt gtgtcgcggg cgtgtgtcgg gtgtgtcggg
   194581 ggtgtgttgg cggggcgggt gcggctgggt gtgttggcgg ggtgtgtcag ggtgtgtcgg
   194641 tcgggtgtgt cgcgggcgtg tgtcgggcgt gtggcgggtg tgtcgcgggt gtgtcagggg
   194701 tgtgtcggcg gtgtgcgcgg cttcggggtg cgtgtcggcg gccggaggga acaacaagtg
   194761 tgccccgggg cccgcgagtc cccccccccc cctcccctgg gcggccgctt ctgcgtgtgt
   194821 cctcgacgcg ggttgcggcg tacttcgtct gttcctgccc ccgcggtccc ctaggcgctt
   194881 cctcttttcc gcccgtcccc ctggggactt cctcttttcc gcgtcgtttc cgcgtccctg
   194941 gccgtcgtcg tccccccctg ggactcgctc gtcgtgtgtc ccctgggact cgcttttccg
   195001 cgtgtgttcc gccgcggtca aagacacaca acacagacgc gcgtctgctt ttcgccgtgc
   195061 gcgccgcacg ccgcttttat tcgccgccgc cgtcccaacc gcaccgcagc acactcttac
   195121 caccgtcacc gtcctccaca gcacacgcgg ctccaagact ccaaatttca cccccccgct
   195181 aaaaacaccc ccccgcccct cggggaccca gcacacggcc cggaatggat gtcggccgtc
   195241 cacctaggtg ggtgcgcgct cgggaggcgg ctttgctttg cactccgggg ctgtcgcgcg
   195301 tgttccttcg ggtggctggg ctgccgggtg gttttccacg gccttttaga ctgcgcggcg
   195361 ccaaggcggc gctagcaagc gccgtgcacg ccgctgccta taaaagccag gtgcgtggcg
   195421 accgtagcac acggacaacg gagacgtccc cgtgtgtaaa cggcgtggtc gcggacgcgg
   195481 gttgtgttgc tatatagtgg acgtcggctc gacgtcggag gtgtccggcg gccatggccc
   195541 agcgcaacgg catgtcgccg cgccccccgc ccctcggtcg cggccgcggt gccggagggc
   195601 cttcgggggt tggttcctcc ccttcttctt cttgtgtgcc gatggcagcg acgtcaacag
   195661 cggggactgg tgcgagtact gcgggttcgg cgacgccggc ccacggcgtc caccgcgtag
   195721 aaccccgcgg gccgccgggc gcccctccgg gtagcggcaa caacagcaac ttttggcacg
   195781 gcccggagcg cctgttgctg tctcagattc ctgtggagcg ccaggcgctg acggagctgg
   195841 aataccaggc catgggcgcc gtgtggcgcg cggcgtttct ggccaacagc acgggccgcg
   195901 ccatgcgcaa gtggtcgcag cgcgacgcgg gcacactgct gccgctcgga cggccgtacg
   195961 gattctacgc gcgggtgacg ccgcgcagcc agatgaacgg cgtgggcgcg acggacctgc
   196021 gtcaattgtc gccgcgtgac gcgtggatcg tgttggtggc gaccgtggtg cacgaggtgg
   196081 accccgcggc cgacccgacg gtgggcgaca aggccggcca tcccgagggt ctgtgcgcgc
   196141 aggacggact gtacctggcg ctgggcgccg ggttccgcgt gttcgtgtac gacctggcga
   196201 acaacacgct gatcctggcg gcgcgcgacg cggacgagtg gtttcggcac ggcgcgggcg
   196261 aggtggtgcg gctgtaccgc tgcaaccggc tgggcgtggg gacaccgcgc gcgacgctgc
   196321 tgcctcagcc ggcgctccga cagacgttgc tgcgcgccga ggaggcgacg gcgctcggac
   196381 gggagctgcg ccggcggtgg gcaggcacga cggtggcact acagacgccg ggaaggcgac
   196441 tgcagccgat ggtgctgctg ggcgcgtggc aggagctggc gcagtacgaa ccgttcgcgt
   196501 cggccccgca ccccgcgtcg ctgctgacgg ccgtgcgtcg gcacctgaac caacggttgt
   196561 gctgcggctg gctggcgctg ggcgcggtgc tgcccgcgcg gtggctgggc tgcgcggcgg
   196621 ggccggcggg gccggcgaca gggacggcgg cggggacgac gacgatgacg gcggggacga
   196681 cgttgccggc gggggcgagc ggcacggaga cggaggccgc cggcggggac gcgccgtgcg
   196741 cgatggcggg agccgtgggg tccgctgtac ctgtgcctcc gcagccatac ggcgcctccg
   196801 ccggcgggaa cgcggtgtgc gtgccaaacg cggacgcgca cgcggtggtc ggggcggatg
   196861 cggcggcagc agtggcggcg ccgacggtgt tggtgggtcc gacggcgatg gcgggtccgg
   196921 cggcgtcagg gaccgtgccg cgcgccatgc tggtggtggt gctggacgag ctgggcgccg
   196981 tgttcgggta ctgcccgctg gacgggcacg tgtacccgct ggcggcggag ctgtcgcact
   197041 ttctgcgcgc gggcgtgctg ggcgcgctgg cgctggggcg cgagtcggcg cccgccgccg
   197101 aggccgcgcg gcggctgctg cccgagctgg accgcgagca gtgggagcgg ccgcgctggg
   197161 acgcgctgca cctgcacccg cgcgccgcgc tgtgggcgcg cgagccgcac gggcagtggg
   197221 agttcatgtt tcgcgaacaa cgcggtgacc ccataaatga tcccgtcgca tttcgtgttt
   197281 cggacgctcg aactctcggt ctcgacctca ccaccgtcat gacagagcgt caaagtcaat
   197341 tgcccgaaaa gtatatcggt ttctatcaga ttaggaaacc tccttggctc atggaacaac
   197401 ctccaccccc atctcgccaa accaaaccgg acgctgcaac gatgccccca ccgctcagtg
   197461 ctcaggcaag cgtcagctat gcgctccgat acgatgacga gtcctggcgc ccgctcagca
   197521 cagttgacga ccacaaagcc tggttggatc tcgacgaatc acattgggtc ctcggggaca
   197581 gccgacccga cgatataaaa caacgcagac tgctgaaggc cactcaacga cgaggcgccg
   197641 aaatcgacag accgatgcct gtcgtgcccg aagaatgtta cgaccaacgg ttcactaccg
   197701 aaggccacca ggtcatcccg ttgtgcgcgt ccgaacccga ggatgacgac gaagatccta
   197761 cctacgacga attgccgtcg cgcccacccc agaaacataa gccgccagac aaacctccgc
   197821 gcttatgcaa aacgggcccc ggcccacctc cgctgccgcc aaagcaacgg cacggttcca
   197881 ccgacggaaa agtttctgcg ccccgacagt cggagcatca taaaagacag acccgaccgc
   197941 caaggccgcc accgcccaaa ttcggggata gaaccgcggc ccatctctca caaaatatgc
   198001 gagacatgta cctcgatatg tgtacatctt cgggccacag gccacggccg ccagcacctc
   198061 cgcggccgaa aaaatgtcaa acacacgccc ctcaccacgt tcatcattga aagtctctcc
   198121 agtccatatg ttgtcaggac gtactgtcgt tctccgcttg ctgcgaagcc cgttcttccg
   198181 agtcgtgtcg ctgcgtccag cgtcgcgccc aagatgggaa tttgggtctc ttcacgcgta
   198241 gcctcctcca ccacggctgc tgatcgccgt cactaaggac cgacacggag gatgacgagg
   198301 agcttctccc cgactccgcg gtccgcgacc ggctacgtag cgcgtgtccc tgccagtctc
   198361 cgcagttaca ccatacgtcg tgagcagcgt gcacctgctg ccgccactgg gcctcggcgt
   198421 gctcaggcca cccgccggag cccggtctga gctccgacgc aggatgcgcg tactcaacgt
   198481 gcgccttcca gtccatacag caacaccata ggtcgtgcga gtcgtcggct acccgccgcc
   198541 aggccagttc ccgcatggga aggctggaca cgccaaccga gaggtcaccg agcccggacg
   198601 ccatttcttc ttcctctccg tcgctgtcat caagcagcca ggtcacctcc tccgctccgc
   198661 ggtccgccgg tctcgacgga ccgcgccgcc gtcggcaaca cggaaaacag cacgccagcc
   198721 cgagccgcta aggccgcatg cccctgccgc ccaactgaac acgcataccc cgctcaactg
   198781 cgttttgcca cccctgccag tgctctcgct cgagcaccac cccgcatctc ccaacctttt
   198841 tccaataaac gaaaccgaca tgacacacgt aatgggtgct cgtggctaca tttattgaaa
   198901 caaaccgcga tcccgggcgt ctcagcacac gaaaaaccgc atccacatca tagacaagtt
   198961 acagtccaca gtcacataca cgataaacaa taccaacagg gtaatgttta tggagtaaaa
   199021 cactattgtc caggccacat gcgtgtatga cttccgcacc atcccgtact gcatgttcca
   199081 catgtacgcg ctagacgtgt aatccactcg cagttcgggg acgcaacgca gccagatcac
   199141 atccccttgc agtaccagac gcagggctag cgtctcgaag atcggcatca catctaagtt
   199201 ccgcacgttc cactttaacg actccccggg aacgaactcc acgtcgtccg cgtgtacgta
   199261 caggttctct cccacgccgc cataatcggc cttcggatcg aagacgaacc gactcatgtt
   199321 gcccacgatg ctcccccgag caaacaactt gccgttgtca atgtagcacc ggttgtcctc
   199381 gatctcaaac caggggtgct tggccgtgga cttccagggc cggagcgcgt cttccccggc
   199441 tttagtgatt ccatcgggca ggcggatcaa gggacccatg gaggtccaaa gacccaccca
   199501 ggctttccag agattgttca tggtgaaaca gcgtgtggac tgtacgctct ttcccaattt
   199561 atatcccaga gtagtgacgt gagcccagcc acctcccaga ttcctgacgt tttggttgtc
   199621 tttcctgcca attcctcccg taaacttatg attatcctag cccattcccg ataaaaatac
   199681 acggagacag tagatagagt tacgaataaa ccggtttatt tattcaagtg tctcaggaga
   199741 ttattgaacg agcgtggata ccacgccgtc gtcagttcat ggtggcattg agcagccata
   199801 gcaccagagt cccggcgccc ggtatcagac acgctgacct accgggcgcc ttcgagtccg
   199861 taccccgcgg cctgggtgtt agagtccgta ccttgcagcc caggtaggtt tcaggtacca
   199921 gctggttcgt acctgttaaa taaatcgcag acgggcgctc acccctacgg tcaggagcac
   199981 aagaacaacc agagagaaca gatatacgag cagggttctg aacagcagac cccaattgtc
   200041 gtctcttatg cttcgctgaa ggtaccagtt gatggtctga gagctatagt ccatcctcac
   200101 ctgaggaaca cacgcggcat atttcttggg gtctccccac ctcgtagaca acgtgatgtc
   200161 caccatatcc acggtgtgcg gcaccgggtg cccaccgatg ttccactcga aataggctcc
   200221 gcgctcatca tggtggtact gctcaccgga cacctgcagt ctgtccatgt aagattgaga
   200281 gacgataccc acgctcacaa agtgtttctc ggtgaagttg cccgacatcc tccccttgta
   200341 gtgtagcatg cccatatgga accagcattg gttctcctcc acccgaaagt gggccgatct
   200401 gatctccgat accaccacat ccaggggccg gggtaccgag tccgcgagtc tcaggaacaa
   200461 gacggccagg atcgcgagca ccaacaccgg cttcatggct ccgaaggtcc gctgctcggc
   200521 tccgctcacc gctctggtct ggctgcagca gtgcttcgct gagaagtagc gtgtggactg
   200581 cacggtgttt ttgaatatat agcgtttctt ggtgacgttg tttcccctac gtagtaggca
   200641 actacgtgcc aaaagaggcg ttacggtact ttccgtactg ggatttccaa accgggactt
   200701 tccacacggc ggtttcaaca ccgggacttt ccgcacggtg atttcgccac cgggactttc
   200761 cgcacggcgg tttcgccacc gctgacgttt tcatcgccgc ccacgtcaac ggtggcgaca
   200821 ccgtactttc ccatgcggtt tataaacgtc aagagtcacg tcagtcgccc acccccagta
   200881 cacggcgata tcctgatagg gcatgagagg acccgggtgt cgcgacatgt cgacgacagg
   200941 tgcggattag tggtcgtgtc gcgacatgga cgtgcagggg gatgtctatc gcgatagagt
   201001 tgatgtgaca gcccgctaca cctctctgtc gcgacatgcg cacacaacgg gccggtttgt
   201061 cggcgattgt cgcgacatat cgttatcagt tagcgaccgg aattgtctat cgcgacatat
   201121 cgtcgactat cgcgacagaa aaaaaaatac cgttcgtaga gaacgccgtg ttgaaggaac
   201181 gcgcttttat tgagacgatt aaacagcatc aggagccgca acgtcgaatt ccacgtccag
   201241 tcgattcgta tgttatgctg cacagcaatg ctagaataac aaccagcagg gtaatcccgc
   201301 aacatagata caaagtcaca gcgaagaatc cgtgtcgttc tatcaagcga aacgcgttcc
   201361 aaacggcccc gtcacagacg cagtcattca taagcgttaa caaccggtgg ctaggatgaa
   201421 tatccaaatc acagggtagt agccgactga ctcgttggca ggtcagccta ccctcaaggt
   201481 tcctatcgtt cggacgggat ttgtgcgttt taggcctctt tttcgccgcc tgcaagcatt
   201541 ggtgcgcaaa gtcctcactc agctgtttcc agctatcatc tgcatctgtg cagtcccctg
   201601 tatcgttgta acaaacgggt ctgtacgact ttgttctcgg aacacaagct tgttgtcgcg
   201661 gagacagaga gagaagggtt atcgggtcac gcgaagaccg ctcaccgggg gtcggcaacg
   201721 cacacatcaa cagaaaaccg agacggatca agaggtccat agtgaagaag gagcgatatc
   201781 gacgtgctta cgaaacggcg attatatatg ttctcaacaa taccgcccta cgttgtatga
   201841 tgtaacgtgt gacgtgagtc tgatccaaca ctgaacgctt tcgtcgtgtt tttcatgcag
   201901 cttttacaga ccatgacaag cctgacgaga gcgttcatcg ggtcatgaag tacgcattac
   201961 acaaactcta tatatttgtt acgatagaat acggaacgga ggaggctttc gccacaccta
   202021 tcctgaaagc gttgcattct ttatgatagg tgtgacgatg tctttaccat tcccacggct
   202081 gctttacgtg atgatgacat tcatcatgta tttccattca cacatacctt ttgtgcatac
   202141 ggtttatata tgaccatcca cgcttataac gaacctaaca gtttattagc ccttgacagg
   202201 ataggtcaaa agattatacg taggttttcc ggtaaaccga attgtgatat ttctctgcag
   202261 gaaatagaac agcctggtac ctatgaaacg gacaatgcag tactgtagca gcataaccaa
   202321 gtaggtccac atcaacacgt acaaaattat ggtaagccat cgtttttcgt accacagcct
   202381 gtagctgtcg tacatgaatg aggacggcct agggatccag ggtagttgca attgggggcg
   202441 acattcgtac tctctggaag acagtttcac gggtttcagt gagatgagca ctttagcgat
   202501 gtccgcgcgg acgctacgtt tcaccgtgac ggtgagaact tgaccgtcgt tttgtacttc
   202561 atgaggcacg ttatacaagc cactggtatc atgaaggatg acctctgatg cgatgtgagg
   202621 attaaattgt ccctcaaacc gccaaacgct ggtcatgtta ccaccgtcaa ttacgcagct
   202681 gacggtgtga gataccacga tgttggactt aggtttaggg gctaattgcc ttttcacaaa
   202741 ttccctttgg tattgcaggt cctgctgcca ctgcttttcc gtgcggaaag tcgccatgtc
   202801 ttccacacgt ttagcgacga tacacgccac cagggtggat accagaagca gctggatccg
   202861 catggtatta ccgtatgtca attagaaagt tgagcggaca cggttatcgt tcctggcgga
   202921 tataagtata taaacgcgaa ttagcctttc ccgtccgttt tgtacacccg ttccccacac
   202981 aaatgacgaa tacggccttt tttttataaa aataaaccac gtatattgta taaaaacatt
   203041 tacatagaaa agtgacacac acggatcaac ataaggactt ttcacacttt tggggtacac
   203101 aggcgtgcca ccgcagatag taagcgctgg atacacggta cacagtcctg gccagcacgt
   203161 atcccaacag cagcaccatc gccatctgta tggcgatcac gaccccgagc tctaagtgtc
   203221 tgtattcata gtgtagtcgt cgcaggttat ccactgaatt cccgtagctg aaataacgta
   203281 tatggtaccg aggctggcac cacatgggtt tgcatttgga gcacggcacc aaatgcagag
   203341 tgagatggtc caagtccgtg ggcacccact ggcgcaaacg gaatacggct tcggtggtct
   203401 ccacgaggca ctccggggct tgcagacggc cccactttcg tccgtgacgg cccgaccagc
   203461 cgacccgagc cactatccct ttctcgggat agaacgtacc ctgtacacgc cacacagcgt
   203521 ccaacacgcc gtccttgacg acgcagctgg cctgatagct ggacacgttg ttaagcggcg
   203581 gaaagcgaaa ctgacgtgcc ggcggagcca catagttcgg ttcaccgtgt tgtcgcggtt
   203641 cgtcctccct atagtaatag tagtcgttgt cctcataggg gttgccggcg tgagccagcg
   203701 ttacccaaca gcagcccagg ccgacgagga ggcgcagcca ccgcctcatg gcggcttcgc
   203761 cagtcaatcg tctttagcct cttcctcgaa cccagggacg tatccacctc aggtacacac
   203821 agcaggctac ctggacaccg aagctgaaca aggctacgtg tttcacaaac tgcaccagta
   203881 ccacatagag gaatgtcagg tagcgtctct ccgcaaacag ccgttccaag tctgagggcg
   203941 ttgcccgcag cggcaaccag ggcagcctgg acgccggccg gcaatggagc acgctccggt
   204001 tacaggcact gcaggggtaa acggttaaca tcacgtaaga gagtcgtgcg tccacctgtg
   204061 ggagctcagt ttcgtaacgt agagccccgt cattttccag ctggggtgcg ccgaccttga
   204121 aatgggtcgc gctccgctcg ttaccccagg tgccgtaggc tctcggggcc gtatcggaga
   204181 agttgccgcg cacaagccag gcggccacga gtaccccgtg ctggacgtaa cattcggaca
   204241 cggaactgga gacacggtag ccggacacgt ccccgaaccc gcgagggtac tggggcagac
   204301 ggacggactt gctatctgac aacggacaga tacgagacga cgaggacgca gacgactcgt
   204361 cgctggacca cgacaaccgg agcgactcct tggagcggct cgagagtaca cttactgcga
   204421 tcagacacca gtgccagaag aaagaacagg tggacggaga ccacaggatc atagccgccg
   204481 gcaccgcggc cggccgcagg aagccgcccg gcgcgtcgtc tgtgtgcggg agtcgaaaca
   204541 ccgtgcctct ttatatcgtc ccgacgtgac gcgagtatta cgtgtcaggg gaaaaccccg
   204601 tcatgacgaa cgtgatttgt aagtgacgcg gggtgctgac ggggttcggc ccgagaggtg
   204661 acagagcgcc tcacgtcagt gtgatgtccg atccgcgtca gccccgacgt ggttatggtc
   204721 accgaaaccc acgtttatat ggacgttgag aacagcgcct gaccacatga ttcatcatac
   204781 catttctcgg aatcgggccc atgccgggaa agcacattcc ttttcagtaa acaatgacat
   204841 cataacaaat cattttattc gcgaggtgga taataaccgc atatcaggag gagggatcgg
   204901 gtgatgacac aggccccgca aaacagtccg aaataaattt ttagtatcgc cccgtagtcg
   204961 cctagatacc agaggtacgt caagttcatc aaaacgccca tcggcgtccc ggaatcgtat
   205021 accgggcaca cgaagcgttc ataacaatcc cgggaggcga gtgttagggt aacagaatag
   205081 tttcggggtc ggtttccttc cggcgacgac agctccgtgg acagcagaat gtagagcgcc
   205141 tcggtagctg tcgcggtgcc ttccacgagg atgggctgcc ggtgcctttc gtgattttca
   205201 ccgtcgtgta gccaagccga ggcccgcaaa gtcttaggcg aggggaattg tccatatagt
   205261 ttcaccgcgc ctttcagtac atgattctga ataacacagc cgcacgtaaa gtaggtcggt
   205321 tttctcgtct cctccgtggc tgccgccacc actcccagcc accacaacag gcaggtcgcg
   205381 agagggttcc gcaggcttcc ccgccgtagc atggtttcgg gttaaagcaa aaagtctggt
   205441 gagtcgtttc cgagcgactc gagatgcact ccgcttcagt ctatatatca ccactggtcc
   205501 gaaaacatcc agggaaaatg tcggtgcagc caacctttca catacagccc ccaaaacact
   205561 tgaatcactg ccaccatcat cagcgtatac tgcgccgact taatcgtgag cgcgtagtac
   205621 gccattagac ggcgatcttc gaacaataat cgttcgatgt cctctaacga gctccacagg
   205681 ggaacccaag gcacgaggca ccggggttcg cactctacat aataagtttg gcattggtgg
   205741 cagggggaaa agtagaacaa cacgagtttt gtgcgttggg gaacacgata gtcccggagc
   205801 cagtagcgtt ttgcgacgag gctttcggag acgtcctcca ccggcgtcgg cactcgatcc
   205861 gcgtagccct ccagcgtctg gtagtacacc cggggtgtcg gcgtgggcac ggacaggttc
   205921 ccgcgcaggg tccacagagc ctccagtcga ccgcccgatc ggagcacgca gcgcgcctcg
   205981 gaagactcta ctcggtactc cgaaacatcg ggcagaggcg gtaacggctc cgtctccacc
   206041 aagggcggag gttcatcgaa aagagtcaag gataattcag gcatactacc cgcgaccggg
   206101 gcccagaggg ctagaataag cattacaaga ttcattctgt cttacaaggg aaggctgttc
   206161 ccctgtctag actcaaaagc tgtaaggctg tcttatagca tgtagtcttg cacgtcatgg
   206221 ggaacagggt ggtgatctag tgacgtcggg agaacacggt gttttagggt gcgggggaca
   206281 aaggacagta caacagatta ggtgatagaa acgttttttt tttttattta tgaaaaagcc
   206341 agtgtgccgt gcggcctagg gccccggcgt agtttggata ccagatgggg gccgtcaggg
   206401 gtactaccac gagcagaaac ataatgactt ggtccatgta tagcagcata gcggtgcgca
   206461 gcaggtcgcc gtccgtgtag caatttgacg gtgagcgata aagcaccgtt aatgtgtcgc
   206521 ggataagcac catcttgagg ccgtagatga agctcacagt cagtgctaaa atgatgcgtt
   206581 ggtatggttc ccaggactgc acggcgatga agagccagag tatgggaagc atgaagctta
   206641 gcaaacagag gatggctaac cgtcgttgca tgttccaggc catgagccag gctaggcccg
   206701 tacaccagac gcagagcatg gatgacagga cataggcctg gattaccacg gtgcgatcga
   206761 aacacagccc gatggtggac acggatatcg tagtgagggt ggtatatacc atgaccagca
   206821 tcagggtccc gggtcggcgc tgacgttcca gccagtacgc gtggcaacgc agagcacagg
   206881 gtagcagtgt gctccagaag ggcagtgtat cgcgcaggta gggggtcgtc acgcgccacg
   206941 gtatgagcat gaaaaggatg gtagtggcta tggtggcgct ggtctggaac acgacggtgc
   207001 cgtagagacg taccatccag agaaagtgtt gaacgctccg cagggtgtct tcatctttgg
   207061 tgattacggt gactcgacgg atcggcggtg gtgacggcgg cgacacgggt gggggtttct
   207121 ctttcttatg gccgagtggc tcgccttggt gaaactggat ctgtaccatg acgggtgcta
   207181 gacgaacagt cgtcggggct tcaggtacct ggcaagtttt atagagaaag ggggacgatg
   207241 ggtggtggct acgagccacc gccaccttcg caatacgagg atctgaaggc ggcaaagacg
   207301 gtcgtccagg gcaggcgcca gaggttggga ctgagcacga tcagcgtgat tttaaacatg
   207361 gtcaccagtc ctacgtagat tagcagcgag ccgcgtaacg tctgagcagc cggcagttcg
   207421 tcgcggatgt aacgcgtgcc gtagaaagtc acggtcatca taaggaagac gatggcgccg
   207481 tagccgtaga gtagaatacg ctgatgatgg aacacggtct ggtcgccgat aacccagagc
   207541 gtgatgaaaa aaacgctggt gagcacccgt gagcatatga gctcccaacg cttagcgcga
   207601 aagctgtccc caaccatgac agcgccggtg caagctatcc acagcgtgag gaccagtgtg
   207661 tagtcgatga ggatggcggg caggtcggag caccaggtgt agaaaaccgt ggtaacggag
   207721 aggaggccta cgtagcccat ggtcaatacc acgtcgtcgg ggtgcctttc gccctgtatc
   207781 aagaccaaac accagagaag ggagggggca aaaaccagca gcagagggga agattcatgt
   207841 tgacatatgt tgtgggaatc ggggataccc agccaaatca ttccgcagaa agccgtactg
   207901 atggcgatgt gaaagaccac tagggcgtag acccggacga ggacagcaaa acggcgcagc
   207961 cacataaggc cgtggtgcag ctgcaggagg gaagcccatt gcggcgaatg tagcgacggc
   208021 agcggcgggt ccatgaggcg ggtgatgcgc ccgagtgaac gggtgagcgt ctcggtggag
   208081 tcttcttata aaccagcggg tctcaagcaa ccctgctctg gaacgtcgcg gtggtgctgt
   208141 tgaggatgac gctgagcgtg ccgttgtcaa cccggtaatg atgataggtg cccagcttgg
   208201 ccaggtagct gaacatttgg tcccagcgtg ccgaccacac cacgggcgtg agcatcagga
   208261 gtgtggtgtg atagatgagt gtctcggtgg cgtaaagtac cagcgagctg cggatgatgt
   208321 ggctcacggg cattttggtg gcgatgtagc gcacgtcttg gaaaaggaca gccaggatgc
   208381 agcccacgaa cacggtgtag agacacagca gagtcttatg caaccaggtg taagtagaag
   208441 ccaggacgct gaccatcacc gtcaaaagtg tggaggtgaa aagcgcgtca cgccacacag
   208501 agctgagacg gtgttcccaa gccacgccgt tgcaggccac gaacaacgtc cacgttagga
   208561 tgaggctgga aacgccgatg ggcgctgtgg cgcacaggtt gagcccggcg gtggtgaacg
   208621 agagaagcgc cacatacagc gcaaacacca ggccgttgct ggggtgtctg tggtcggtga
   208681 gctccagcgc gcccagaacc aacaccggtg tgcagctaag caatagcggc gagggatcgt
   208741 cgctgcactc gtagcccagt gaggggtaac ccagccaaac cagcgcgcta atgagtacgc
   208801 tgaaagcggt ttccagcgtc agcaatccgt agacacgcat gacgatcgcg gtccgacgta
   208861 gccaacacac cgcatcttcg gaagctgtgg acgctgtttc cgaataccgg gaggagatcg
   208921 tgcttccctc ttccaaggat cggaaagtag cgtccgtcgt ttccgcggac gcggcttccc
   208981 tggtacgctc cgtttccgac gacgcggttt cccgctgcgt ggaaactgtc tccatgtcgg
   209041 gaccgcagcg cccggcggcg tatccgcaag gtctcgaagc tacagcttgt cagaggaaaa
   209101 gtaggtttgc aaaaaggtgc gcagggtcat gattctcagc accatcagca gagtgaaaac
   209161 caggctgaga aacaccttga cggccgccaa aagcgcgcgt tccagcggcg tctcgtagcg
   209221 tacagccagg gccgcttcgt ggaaatgcga gacggctaga caggtaatga gcacgctgaa
   209281 ggacaagacg atcttaaagc accaggacca accacgcctc aagatgacca ccacgattgc
   209341 cgtgaaggtc aacgtgatca aagcatggac gaccacgatc tgacggcgga cggtacgttc
   209401 gggagccaac aacgctacgc cggtgcagct gagaaaggcc agtaaggtga acaacgcggc
   209461 cgagacgacc aacgtaccgt ccaggcagag acatatcacg atcaacggcg gcacgtgaag
   209521 cagcgtgtaa aagagcagaa cgccgatatt gctgggatgc gatgtttcgt aacagtgaat
   209581 gaagatcacc gacgtgacgg gtatgacaaa gacgaggctg ggcgaggact ccgtgagaca
   209641 cagacgggaa tggtgaaacc acgtcgcggg cgccgcgtag cagaaggcgc tcaacaacgc
   209701 ggtcaagccg gccagctgcc aacccacggc gccataggtg tgcagcgcca cgcggcaaca
   209761 gtcgacccaa gccagactgc gggtcgccag ccgggtctct tggatcccgg ggggcacgta
   209821 gatgaccgtg ccatcggtgg gtgcttgaaa ccctttttct cttctcatgg tgcgctgcgt
   209881 tctctggaaa cggctgctct gtccgaaaac cagttccgaa cgaaaatcta gggcgagagg
   209941 gtggacaacg gcgtcgacga cgaagcatgg gacaggtcgt tcggcgttaa cgtcatcgcg
   210001 tcggacgacg gtagttctaa gagacgtaga tcgctcagca ggtcctgaca gttgcggatt
   210061 cgcaagatca gaaaaaaaag ggaaatgaac gtaataaaga gctgtagcga cgtatgcgcc
   210121 acatcgcgtg gcataagaac gtgacggacg aaaaggacct gctgcgaaaa gtggccggcg
   210181 aagataaggc ccaccgtgct gtagaagccc aaaagcagcc gcaggggcca agtccagggc
   210241 cgcgtgaaga cgatgagaac gttagccaga aagaccacga cccagacgcc gttgatgagg
   210301 gtaaattgat cggacagggt gcagttgtcg cgacagatga agactacttc cgcgcagagc
   210361 aaggtgatga ccaacgtgag cacaaacgac gtcaacacct cgcggggctc ctggcaggca
   210421 cacgtgacac ctagcgccgg gatgtgcgcc aggaggccgg cgagtaatag caccagctgt
   210481 cggaacggac gacggcagcg cgggtgccgg tttcgctgag cgagaaccgg tcgctcatag
   210541 cggaaataca cgaagagcgc ggaggccaca ggcaccagga ggagcacctc gggcgcccag
   210601 acaacgtgac aaggaaagcc cggacgcgac ttaagagtcg ctgtagggaa gaccagagag
   210661 aagctaccca agacggccac cgccgcggag atttgaaaca ggagcaagcc ggcgattcgg
   210721 acgacaacct cgaagcgatg cacccagccc agcacggcca ccacggccgc ttcatcatag
   210781 tcgtcgttgt tgccgctgtc gaacagccgc cgaaacacga tctgtcgctg ggtcgcggtg
   210841 ggaaagcgca gacccatgac agccggaggc tatatgaccg tgcgtctaag gcgcgagatc
   210901 cgtgggggga cttttagatg tttgggcggc ccgcggttct aacaggcttg attggtggag
   210961 acggccggcg cggcgggtgg gggaaacgac gagtttttcc gttacgccat ggttcgcgtg
   211021 aggtttctct gtacctcccg caaaaggtca cagcccgaaa tggaggccgc gttggtggcc
   211081 ccggtggcgc gtgacgataa ccaggtcatc caagcgatga gtttgtctaa tgagtcctcg
   211141 gtggtgaaga ggataagaat gagcaggtac aggtacacca ggttctcata gagacacaag
   211201 gtgagcaggt cggcctcgga ccacgcgatc tcaaacaggc gcgtggtgtc aaagaccgtg
   211261 acgaccagca tgaagctgag cgccatggcg taatagccca aaaaaagttt gtgccctaac
   211321 ggtacgggct gcaggtaaag tgcgatcaag aacgcgataa cgccgatcac aaacagcgtg
   211381 atgatgacct gccatcgacg gtgattatgg gcggctagac ccgtgacgca gctgcagagg
   211441 ctaaaaagca cgcaagccaa gaggcccgag aaggtcacca gcgtagagga ggagcaggcg
   211501 ctggccacga tcaccgaaag cgtcgtgagc acgctgtaaa tggtgagcag gcccgggctc
   211561 ggcggcgacg tgaacgatcc ctcgtcgcgt ttgccgtgca gcagagctag acagatggtg
   211621 ggcaccacca aactcaaagg cggcataaag ccagtgcaac agagaaagac ggtgcttttg
   211681 agatgcggaa aagccagcac caggcccaga cagagcaaga aggtgcaagt gccctgcacg
   211741 gccacggtgc tgtacacccg catacaaagc aaaaagcgac gtacgtcgtt cgtcgagacg
   211801 gaggaaatca taatgactcc gcgcgagggt cgcgggggtg ggggcgccca ggccgtcccg
   211861 gtggcctctg agttcggaga catgacggcg gtggcgatca aaaggcgcgt atgagaaacc
   211921 gtttatagag tgtaatagaa tcaccgtcat ccccacacgg cgttccccca taaagtcacg
   211981 tcacactcga gtaagcgtga aaaagcttta ttgttgaata aaaaacacaa gtacaacacc
   212041 gagttgcggt gtcctgtctg tctactgggt gggggaggtt catcgtctgt ctctggaagg
   212101 aaggtgggga acgttaaagc gagcaggagc gtgtcatctc ccccatcttt ttataacaag
   212161 ctgaggagac tcacgccgtc gatgcgtccg ccgtgtttct cggcgtactg ctgcacccag
   212221 acgtggccgc taaagatggc gacgctcatg tttaggagac tcatgacgat ggtgtacaac
   212281 acgacgctga cacagacgct gtttttagac aacgttccac gctggtagat gagatccagg
   212341 gtctcgtaaa taagcacggc cgaagcggcg gtcaccacca ggacgtagag tccgctgtag
   212401 atcttgctga cccacagcac gggcgaaaag taaagcaata ggtaaaagac gatgacggac
   212461 cagccgtagc caatcccgat gactttccag cgcgtgggat tgttgccggc caggtaggta
   212521 agaccgctgc agagaacgaa aaagaccatc accagggcaa acgacagacc gatgacgcgc
   212581 ctttctccgc aaaagcccgt gcacacggtg atgccggtgt tgatcagcaa gcacgccacc
   212641 gtgagatgag caaaattggt ggtgtgtggg cgaaactcgg cgaaaccgcg tagcatagcc
   212701 agcgtggaca cgggtacgat ggaggatagg gctggcacta tgccgttggc gcactgtccc
   212761 tgcacatcgg ggaaggcgag ccaagccagc aagcagaccg tgagggtaca agccagctgc
   212821 cacacgagcc cgtgatagac ctccatgagc agcttaaagc gtttcaacca ttggaagagc
   212881 tgctgttcgg ccaccagcgc gtggctgcga tggagcggca cgatggtgac cgtcggcgac
   212941 tcatggtgtt cggaaaccga ggcggtgtcg cccatgctgc cgcttacgac cgctgtcggt
   213001 ctaaggtagg cgtcgatgaa acagtccgtc ttatcagcac ccggttaccg cggatttgat
   213061 tgacgtcacg agtgtggtca aaccgtggcg gcaccctgta tccgacccgt cgtcatgggc
   213121 tccacaacca gagcctcaga agatggtaca tgccgatgaa taaagccaca ttttcgacat
   213181 agaggcgtag cgagggctga aaactctccg ggaaagaact ctgacaggtg atcagggaca
   213241 gatcgtgaat tagcatcagc gtcaccgtca acagcgtcgt cgcgtgtaaa ccgagaaaga
   213301 acggggccgc ggcccgcagc agccaaagtc ccagcgccgt agcgcagagc agagacagga
   213361 ccgacggtag ccacagccgc cggagagacg cgccaggatc gcaacccaaa agcgaggccc
   213421 ccaggcagcc gagatctacc gccagggcga gaagagccgc gctgagaaag gcctgcggcg
   213481 acggctggca catcagcaag gtcagaaagg ctagcgcgtg cggcaggcag taagccaaca
   213541 ggagtgggag tttgcgggga caacggtcga gcgacggacc gcgtagcagc aggaacaggc
   213601 aaccgacggg cacgacgagg ctgagatgag aaagcggcgg tgggtcgtcg tcccgtcccc
   213661 gttcgcatag ctcggccacc ggtggcggca tgagccacca gctgagcacg ctgagggcga
   213721 cggtggcggt aagctggaag gcgacgagga cggaggcgcg cagccatacc gccagcctct
   213781 ctaggtaggg gactacctcc tcgacggtcc attctagcgg gacgacatga agcatggcga
   213841 caagcgcggc tgctctgaaa acgggcacgg ttttataggc attaggacgt ccccgtcgta
   213901 ctggcggctg tcaaagtccc gttgtccaaa gacgcgccgt ccgaaagact aatccaacgg
   213961 ggacccgaga gcatgagcaa caacgtgaga aagatggcca tgctgtccag gtagagacag
   214021 acggcatgac ggatgcactg gttaggtggg cagaaaaaga tgaccatgag actatcgtag
   214081 gccagaatac ccaaaaagaa gctgatggag aaggcgcaca acgtcaccac tatcttctgc
   214141 agccagtcgg cgtcgcttag cagagcgagc gtgaggaacg aaagcagcat caccacgtag
   214201 acgcagctga tgcatttcca acgacgtcgg tcacggccac ctagaaacgc cagccccgta
   214261 aaggagataa acaacgccag ggtcatcacg taggaaccta ctagtacgcg gctttcagag
   214321 cacatttgga agatggccgc cgtcaggctg ttggccaaca gatagatgaa aagcaccgtg
   214381 gcgttactag ggtgttcgtt gcccaacgtg tacgtgatga acatgcagac gatgggcacg
   214441 agcacggtga gaaagaagct gtagttctcg acacaaaagt tgcggttttg tgggaacccc
   214501 aaccaaaaaa cgcttcccaa gccgaagctg aaagccagct gaaagatgaa gatggcgtac
   214561 acgcgcagcc atacggtgaa ctttttgaac cactcgagag cctccatgcg ggagagcagc
   214621 agcgcgttag cctcctgcgc ctgcatggtg gcgacggtct cggcacaaag ccgctgcggc
   214681 gcacctaccc ttctcttata cacaagcgag cgagtggggc acggtgacgt ggtcacgccg
   214741 cggacacgtc gattaggaga cgaactgggg cgacgccgct gctgtggcag cgaccgtcgc
   214801 agcgaccgtc gtctgagcag tgtgggtgct gccgggctcg gagggcatga agtagagcac
   214861 ggagacaaag aggtacatga ggtccatgta caagcagagc gcgcccggga tataactctc
   214921 atactcgatg tcgtgcagga tgtcctgcgt atcgcacacc accgaggtca cgatgacggc
   214981 caaaccggct atcatcacca ggatctcact taccgcctcg ggaaagagag aaaatacggc
   215041 gaacagtaag agaatcagcg tggatgcacc cgtcaatagg gaacgctgta attccacgtc
   215101 gcgggcaaaa agataggtag cgagcgtgag gaaacaaaat agcgtcactg tggccaccat
   215161 ggcgtaaatg accgaacgat gactaaaatg gaagcctgac gccgtgacag ccacgctggt
   215221 aagcaacgtg tacgtcagta agatccatac gtttttggga aagttgggct cggcccaacg
   215281 caacagacct aggcacacga tggagatcat taagcaagac agcgtcagac gcacgctgga
   215341 aaagagctgc tccagccggt gcggcaacac cagccagcaa aaggcgcaga cgctcataag
   215401 gatgaggcat tgcacccaga taaggatgta gatgcgcagc aggaagaccg accgggctat
   215461 ctggacctga ccgcggagcg acatggcggc aacgccggcg gttatcgccg agattcgtct
   215521 aaatacacaa agcgaactag aaaacgcaca cacgtgattt gcaaaaagaa agcagctgcc
   215581 ggcttattat tttattaaaa atttatctgt gcagaatcat aagtttatga tgaataaaaa
   215641 cggggaaagg gaatctgctt ttagggaccc gggtctggtc cgtcgtctcc catctggtcg
   215701 ggttcgggga tggggacctg tttcagcgtg tgtccgcggg cgtgcatggc ttttgctcgc
   215761 cggccgcgct gtaaccaggc ctctttctct gtggtcggcg agtcttccga cgggtaggga
   215821 gtctgggagt ccatcgcttc aggcccaccg ctcgttccct cgaccgtcgt gtcgtcctcg
   215881 ttttcgctat tacacggggt ttctggagta tcgcctatac ggttggcgat tctccggggg
   215941 cggccgctct cgtcctcgtc gctgctatcg ccgcccggta attcgacgcc gcattcgttg
   216001 tacggagcgc ggcacatggg cggcggaaag aacttgggca tgcgaaagca gcgttgtcca
   216061 tccacggtct gcgtggtttc atcgttatcc tcccataatc ccccctgtag cgccggcagc
   216121 gtttcgacgc tgtgagaggg gaaggcccag ttctggttgt cttgcagcgc gcccgtgggc
   216181 agtaggtccg tgcggcccca ggcgctgctg ttgttgggta ccttgtcagt gccgcgagta
   216241 ggtcgcagaa accagtccag agcgctctct agctgcgagc gtgtaatggt gcccagtgcg
   216301 ccgtgccagc gcagcacgtc tcttttcagc gtgtggtgac agacgggcag ctcctccagc
   216361 cgacactcgc cgcgcaatcc gcggtcgaag cggcagagac cacgcagttt aagcaggccg
   216421 cacttgagaa acatgtgaaa attatcggca atgcgataca ggtccgagtc ctcgatcttg
   216481 tgtaggtaga ccacgccaaa cttgtcgagc agtaccaggc cgctgggcac aaaaggcccg
   216541 taggccaggt aatagcccac gaggccgacg acgtaccact cgcagcacaa gcgttgacga
   216601 ataaagttca gaagatcgcg aaagtccgcg gccggcatgt ggtcaaaagg ccggcaggcg
   216661 cgcaggccct cgatggagcc cagcatgagc aacggctcca cctcggtgcg acccggcgtg
   216721 cggatgacca ggttgagacc gctcatttcg cgtgccgtct tggccacggc cgcagcgtca
   216781 gtggggtcgg tgcagaggaa tttttgcaca tgatagcgcg gttcggtggt ggcgaacggc
   216841 gtttgtgggt gccgatacac atattcgcac cagagtaggc cgttcttgga aaaggctttg
   216901 atatcactgg ccacctcgta gagcccgtcg gtctcccagt cgtagacgta gacggtgccg
   216961 taatgactta gcatgagcac gcagggcagt tcctgcgcct gctttgtgtt tcgtgttaga
   217021 tcgctgtcgg gtggacgcac ggctagtaca ccgacggctt ccagggtgtc atcgcagcag
   217081 agatagtcgg cggccagaga acgtgcgtaa atctgcggga tggcggcctg ttcgcgcatc
   217141 actaggaacc agttggcggg gttgcgcagt gctacggtgg ttccttggtg gcgctgcacg
   217201 taggttctca gcgccggagg atcgtactgg cgcagataga ggccttgcag catcgataac
   217261 gtcttttgaa agacggtgtt tctaaattgg aaaacgccgt agtcgcagcg gatagcatct
   217321 tcgcagcgct cgtcgcgctg tcggagatag gtgccccagg cttcggcggc ggctttggtg
   217381 agtagggaca tgccggcgga gccgtctcga cagcgagtcg gataaagcgc gctgcgcgaa
   217441 agcttaatat aggagcagcg tcagacgaat cgcggctggt ggcccggggg gtgggacgcg
   217501 ccgcctacac aaagtgttcc cgaaaatcga aactcttgac ccactccgga gacaaatccg
   217561 tattcagatt gatgcgtcgc gcttctactt cggcttccga aacctcggcc tccgtccggt
   217621 aggcgttaac gatacgctga cccaggtgcc aacgctcttt ctctgccaaa cgccgttgct
   217681 caaaccattc gtctacgtcc ttgaggtcaa agacagtgtc ttcctcaagg tcaaagccta
   217741 ggtcttccca ctcgtcgtca tcgctctcgt ggccggcggc catacgcgcg gcaactgcgt
   217801 cttcccctcc tctttcaacg ttgggtacca cgttgttttc ttcgggttcc atgggttctg
   217861 cgccactgtc gtcatcgtcc tctccctgct cctcatcgtc cgccaaggcg tcgtggatca
   217921 cctccaggtt ctgattgtcg ggtacgacgt ggttatcttc gtcgtcgtcg cgtggcatgg
   217981 gcggcggccg acggcggaca accggcatgg cgcggccgtc gtttccttcg tcttcctctt
   218041 ccccgtctcc cagggaacgc ggtcgacggc gttccgcgaa gtcgccgcgg accacgcgcg
   218101 cctgccagat ggtaaacgcg tcccaaccgt cccagttatt gagcatttcg gcgcggaaac
   218161 ggtcgcctcg acagagccag cgaaattgcc gcgcgtagtc gcggtctacg ccgctgtcga
   218221 acatggtaaa gtgcagacgc gccgcctcgc ccatgtgtac gcagcctccg ttgcgttcca
   218281 gcctggccgc gcgccgcaga ccgtgttcgt agcggcgacg cacgtacacc ttcatgaggc
   218341 cggcgcgaaa aagttcctct aggctgtcgg ccagacggta gatttcaccg gcaagacgct
   218401 gcaggggcgg cgagcggtcc aggtgcgact tgacgatcac cacgtaaaaa cgacagaaac
   218461 ggtcgaagat gatgaggaat gacgtgtcaa agaaaccacc ggcgcggtag gagcccacgg
   218521 cgcccagcag gtaccagcgg caacgcagtt gcagcgtgac gtacatttcg cactcggcca
   218581 agcgggcggc tggcgctacc tcgaagggcc agcagtccgt caagcagccg aaactggtca
   218641 ggagtttcaa cgttttggca tggcgcccag gtgtatgaaa gttcacgtcg cgtccgtggt
   218701 gttcgccaac gcaggcggcc aacgcgtcgg cgtcatgacc gtgacgcagc agcatcgcta
   218761 ccacgtcgtg cggtacccgc gtagcaaacg gcgtctgtgg ctgacggtat acggcttcgg
   218821 tgtacatcat accgtaacgc gccagctcgt ccagatgacg cgcgcacagc agcagaatct
   218881 cttgcgaggg ttcgtagatg tagaggcgcg taccgccacc catgcagagc accagctccg
   218941 tctcttcgta gtgatcttcc accatgatca cgcacttgcc tagcacgata aggcgttcgg
   219001 ggcaacaaat cacgtcgtcc agcagctggt cgcgtagctc cggcatggtg ctgccgggcc
   219061 gtacctgcag gaaccagttg tgcggaatgc cgagcgacag cacctggtcg acgtggttac
   219121 ggacccagtc gcgaagcacg tcggcgctgt actggcactc aaagatgccc tgaaagtcgc
   219181 ccatgacccg cagaaaagtt tcgtagcgcg tgtggcaata gaggaattca tcgtttcgcg
   219241 taaacgtggg agctccgtct tcccaacgtg tacgccacat gtcaaaagag gccgccagct
   219301 agacacccca gaaaagaagc agagaaagag acttctttgt gcgacacgtt ttattccgcg
   219361 ttctccgctc gacgttcaaa tctggatgta ctcgcgcaca cccgtcaggc tctttaaggg
   219421 aaaagggtcc gagtacgtca ctaaccgcga ctgatgcacc agggcggtaa tcacccgctc
   219481 cgcgccctcg cgcgtcgacg aacgcgtcgt caccaggcag tgcagccgcg ggcccgtatc
   219541 gtcctgatga ccagcggcct cgcgctcggc tgcttccaca ccgacaatgt cgggatccaa
   219601 cacgtagctc tgcgagttgg tatcgtagcg gtgtagcacc aacgtgttgg ggtccagacg
   219661 ctcccacgcg ccctcgtgcg ggtcaaaacg ctccgttaaa cagagccagt catactgctg
   219721 ctgcagaata cgccgctcgc gctcgcgtcg ctcatcgggc aacgcggcgt cttcgttgaa
   219781 gagaatgtcc cgcttgtggt ctacggcacg ctcgtggtga tgcgggcaca gatgacggtg
   219841 ttccatacgc gtctgacgtt gacgctcgcg ctcgaaacgc cggtgtcgaa agaccatttt
   219901 cagcaacccc atgcggaaaa actccgtgat ggtgttggca acgcgccgca cgtagtggtt
   219961 ggggtcgtcc atctggatgg cgtacacggc accgaaccag tccaacagta ccagcacttc
   220021 ggccacaaaa ctgcgtcccg gtcgcggacg tcccgtcacg cctagcacat accacggcgt
   220081 ggccagatta gcacggacag cccaccacca acgacggctc tccacctcgg tgagcgcaca
   220141 aaagggccaa atgcggtgta actgctgcac cgttttcatc agccgcataa tcaccgtgcc
   220201 gtaacccggt gtatgcaact tcacgtcgca acccaggatt cgttcggccg tggcgtacga
   220261 gccctcaggt gtggtgtcat tgagaaacaa aacatgcatg gtacgcgcgc ccttagggta
   220321 tcgtcgcgga acaggtaccg tcattctccg cagagtggtg tgaatcacgt cgcgatacgc
   220381 aatctccgaa cgtgacacac cgtaacgtgc cagttcgtcc aggttgtgcg ataccaacac
   220441 catgtacttt tcacgagtgt cgtaggcgta gacgcgagaa aagcgaccca taaaaaccac
   220501 gtacggggta gccaccatgc catcatggtg atcgcgacgt ggctcgggca acaaaataac
   220561 agcgtatccc aacggcgtca gcggctcgcg gcaacagatg agctttgacg ccgcctgttt
   220621 ggcggcggta atgatcccgt cctccgtacg taacatcaca tgccagccct tggggggacc
   220681 caaggacaga cagcgtccct cgttacgatg aacgtaacgc gtgatttcca ttggctccag
   220741 gcaaaagaac agttccttaa aatctcgcaa cacttgtcgg tataacgcca tgggatcctc
   220801 ggccgccaca ggcagcgcgg ggagctccgg cggcacaact gcagcgccgt cagggccaga
   220861 acccgcagcc ggatccatca ttgcgcgaca ctctcagccg gacaaccggc gtcactgaca
   220921 gaagccgagc caaatacaga gaaagcaacg ctacaccgtc accccgctcc caagcgccgc
   220981 ggaaagtgct ccgatttttc accgtcgttc gcgacgttga tttgcctcgg tctgagaacc
   221041 gacctagcgt tcggaccggt gcgcagaaac agccggcggt ccgagccact gagcggttca
   221101 cagccccggc cgccgatagt taccggagag acgttcgagc tgcaggtaca tcggcgctcc
   221161 ccgcttcgcc accccgcgcc cgccccagtt tatactctcc gacgcccctt ccaacgcgcc
   221221 tgtggagggc caatcggacc gcgggagctc tccaagtgga tgacagacac agccgggtgc
   221281 ccgaccgtga agagccctca tccacctgaa cagaccgcta accgaaggac cccgagtcgc
   221341 gtccgtcggt cccgacgtcc gtcgccatct ggctccctgc tgttggctac ctctcggatt
   221401 tcaaaaaaga gcacgtgccg atgacggtgc acaggaaaga gccaaagtgt cacagcgtct
   221461 ttttttattt gtattccttt cctgttttgt actcgtaaac tgttgacgtt gtttttacat
   221521 ccaaaagggc aagtaagaaa caggatgagg catggtaggt ttgggcgtgg ggcggccctc
   221581 cagcacggcg gcccgggccg cccggcgggt gagcacccgg cgttgcgccg tgtctatctt
   221641 gtgtttcttc tgtgtctttt tcctatcttg ttccgcgacg gcctctttca tcacgttcag
   221701 catgcgttcc tcgacgccct tcagggatcc tggggaggag ggagtcctag tgaggcttcc
   221761 aatgttgttt tgtggatttt cggtttcctc ttcttggtcg tcatcgtcgg acgtgtcgtc
   221821 ttcctcttga tcctcttctt cgtccgagta gtagacgcat agtccttggt tcatcaggct
   221881 gggattcatc aggttctgac ggggaatccg ctgctgtaga cgtttaaccg cccgttccag
   221941 gcgagagctc atgccgcacc agacgctgta acgccgcacg ggcccgtagc gggctgtttg
   222001 ttcgcgtacg tgatcgttga gctcttgcca atattgtttg gcacactcca gatcggaggt
   222061 ttgtggatag tcgggtcgga tccgtggatc ccaactcaca tcggcggtgc cggagacttc
   222121 gtccagactg ttacgcatag agcaccagtc gggtcggacg ataaacctgt ccttgcggat
   222181 taaccattta taacgtagtt cgtgatggcg tgtagaggcc cgtacacgct ccacggtccc
   222241 aaagcggtcc cagaagggaa agttttcgtg ggggcagcga cccggcactt ccagacgttc
   222301 ggcgtcgtcc acggcgtagt gaaaacgccg gccggcctgg taaattttga gcagacccac
   222361 tgttaacaac atatccacgc tgtcagccaa ccgccagatc tcgcggcgag acacgtcaaa
   222421 atagaaaaat tcgcaggctc ggtcgaccag gatcacgaaa tcggcgtgaa agacgccgga
   222481 gggtagcgat tcgcccacca cacccattat catggtttca cagcataagc ggtccacaaa
   222541 gaacttcaac aggttgttga attgctccgt ctccatacag atgaagggcc agacgccttt
   222601 gaggttctcg gcctggccgc agagcagtag cggacgtgtc atctcgcccg gagtgcgcag
   222661 aggcacgcat tcgccgcgat aacgacaggt cacacgctgt agttcgctga tgctgttgtc
   222721 gtgcaggcga aggtcgcaga taatatgatc cggttgcgtg gttagcagcg gcgtgcgcat
   222781 ttgctcgccg tagatggcct cgcagtgcaa cagcccgtgt cgcgcaaaat cgtccagact
   222841 gtgcgccagg tagtaaagca ccccgcgatc gcggtctaga caccacacgg tttcgtaacg
   222901 tcctaacagg agcaccagac gggcctggct aggtggctca atttcctcta catacacgaa
   222961 aaagtcgtca tcgtccgagt cctcgtcctc agaagaggac cgcggcccgt gtactctggg
   223021 caacacggtg gtagagaact gcaggacgcc cagagactcg agcgactctt cgcagcagat
   223081 gagctgaccc cagggcgttt cgggcccgtc ggtgacagcc gcgctgccaa agatgtcctc
   223141 aaactctaca aaatctagac gccatccggg tggcgctgaa atgggaaggc taatgttcat
   223201 atcagcatag ctacgaacta agtggcggat gtcctgccgc aagtcttggc agagaatgag
   223261 ctttcgtaaa ccctttaggg tcctccgaac aacggcccca gacgcgtagc gataggactg
   223321 gcgcatggtg ccgcggcgtg gagcggcact tggcagccta ttttatggag tttcttcagt
   223381 gacgtggctt gttcacgtcg ttcgtgggct gcggttggca gctccggtct gtaaaccacc
   223441 cgaaaagact gacatcgacg tcaaagactc acgtaatttg gaacatgtgc gaccgaaaag
   223501 tgcgtcagaa tagcacgtgg ctttaggaca taaaaagtac cgtgaggtct agacgtggtt
   223561 tttgtgattg acacttacac caggtaagcc aagggacggt gaaactgtat gtgaggaacc
   223621 tgggtgctta gacaactaac gtgtaatgct ttttacagga ccgttcaaca ggtgatacta
   223681 cctgcaaggt aatgactaca tctactacaa ctaccactaa tatcatgcta caggtgagca
   223741 acgtaacgaa tcacaccttg aatagcaccg aaatttatca gttgttcgag tacactcggt
   223801 tcggggtatg gttgatgtgc atcgtgggca cgtttctgaa cgtgctggtg attaccacca
   223861 tcctgtacta ccgtcgtaag aaaaaatctc cgagcgatac ctacatctgc aacctggctg
   223921 tagccgatct gttgattgtc gtcggcctgc cgttttttct agaatatgcc aagcatcacc
   223981 ccaaactcag ccgagaggtg gtttgttcgg gactcaacgc ttgtttctac atctgtcttt
   224041 ttgccggcgt ttgttttctc atcaacctgt cgatggatcg ctactgcgtc attgtctggg
   224101 gtgtagaatt gaaccgcgtt cgaaataaca agcgggctac ctgttgggtg gtgatttttt
   224161 ggatactggc cgcgctcatg gggatgccac actacctgat gtacagtcat accaataacg
   224221 agtgtgttgg tgaatttgct aacgagactt caggttggtt ccccgtcttt ttgaacacca
   224281 aagtcaacat ttgcggctac ctggcgccca tcgtgctgat ggcgtacacg tacaaccgta
   224341 tggtgcggtt tatcattaac tacgtgggta aatggcacat gcagacgctc cacgttcttt
   224401 tagttgtggt tgtatctttt gccagctttt ggttcccctt caacctggca ctatttttag
   224461 aatccatccg tcttttagcg agaacgcaaa acgagactct acaaaccgtt attactttct
   224521 gtctatacgt cggtcagttt ttagcctacg ttcgtgcttg tctgaatccg gggatctaca
   224581 tcctagtagg cactcaaatg aggaaggaca tgtggacaac cctaagggta ttcgcctgtt
   224641 gctgcgtgaa gcaggagata ccttaccagg acattgatat tgagctacaa aaggacatac
   224701 aaagaagggc caaacacacc aaacgtaccc attatgacag aaaaaatgca cctatggagt
   224761 ccggggagga ggaatttctg ttgtaattcg atcctctctc acgcgtccgc cgcacatcta
   224821 tttttgctaa ttgcacgttt cttcgtggtc acgtcggctc gaagaggttg gtgtgaaaac
   224881 gtcatctcgc cgacgtggtg aaccgctcat atagaccaaa ccggacgctg cctcagtctc
   224941 tcggtgcgtg gaccagacgg cgtccatgca ccgagggcag aactggtgct accatgacgc
   225001 cgacgacgac gaccgcggaa ctcacgacgg agtttgacta cgatgaagcc gcgactcctt
   225061 gtgttttcac cgacgtgctt aatcaatcaa agccggttac gttgtttctg tacggcgttg
   225121 tctttctgtt cggttccatc ggcaacttct tggtgatctt caccatcacc tggcgacgtc
   225181 ggattcaatg ctccggcgat gtttacttta tcaacctcgc ggccgccgat ttgcttttcg
   225241 tttgtacact acctctgtgg atgcaatacc tcctagatca caactcccta gccagcgtgc
   225301 cgtgtacgtt actcactgcc tgtttctacg tggctatgtt tgccagtttg tgttttatca
   225361 cggagattgc actcgatcgc tactacgcta ttgtttacat gagatatcgg cctgtaaaac
   225421 aggcctgcct tttcagtatt ttttggtgga tctttgccgt gatcatcgcc attccacact
   225481 ttatggtggt gaccaaaaaa aacaatcaat gtatgaccga ctacgactac ttagaggtca
   225541 gttacccgat catcctcaac gtagaactca tgctcggtgc tttcgtgatc ccgctcagtg
   225601 ttatcagcta ctgctactac cgcatttcca gaatcgttgc ggtgtctcag tcgcgccaca
   225661 aaggtcgcat tgtacgggta cttatagcgg tcgtgcttgt ctttatcatc ttttggctgc
   225721 cgtaccacct aacgctgttt gtggacacgt taaaactcct caaatggatc tccagcagct
   225781 gcgagttcga aagatcgctc aaacgtgcgc tcatcttgac cgagtcgctc gccttttgtc
   225841 actgttgtct caatccgctg ctgtacgtct tcgtgggcac caagtttcgg caagaactgc
   225901 actgtctgct ggccgagttt cgccagcgac tcttttcccg cgatgtatcc tggtaccaca
   225961 gcatgagctt ttcgcgtcgg agctcgccga gccgaagaga gacatcttcc gacacgctgt
   226021 ccgacgaggt gtgtcgcgtc tcacaaatta taccgtaata aaaaagcgct acctcggtct
   226081 tttcgtacaa accccgtgtc cgcccctctt ttccccgtgc ccgatataca cgatattaaa
   226141 cccacgacca tttccgtgcg attagcgaac cggaaaagtt tatggggaaa aagacgtagg
   226201 aaaggatcat gtagaaaaac atgcggtgtt tccgatggtg gctctacagt gggtggtggt
   226261 ggctcacgtt tggatgtgct cggaccgtga cggtgggttt cgtcgcgccc acggtccggg
   226321 cacaatcaac cgtggtccgc tctgagccgg ctccgccgtc gaaaacccga cgagacaaca
   226381 atgacacgtc ttacttcagc agcacctctt tccattcttc cgtgtcccct gccacctcag
   226441 tggaccgtca atttcgacgg cccacgtacg accgttggga cggtcgacgt tggctgcgca
   226501 cccgctacgg gaacgccagc gcctgcgtga cgggcaccca atggagcacc aacttttttt
   226561 tctctcagtg tgagcactac cctagtttcg tgaaactcaa cggggtgcag cgctggacac
   226621 ctgttcggag acctatgggc gaggttgcct actacggggg ttgttgtatg gtgggcgggg
   226681 gtaatcgtgc gtacgtgata ctcgtgagcg gttacgggac cgccagctac ggcaacgctt
   226741 tacgcgtgaa ttttgggcgc ggcaactgca cggcgccgaa acgcacctac cctcggcgct
   226801 tggaactgca cgatggccgc acagacccta gccgttgcga tccctaccaa gtgtatttct
   226861 acggtctgca gtgtcctgag caactggtta tcaccgccca cggcggcgtg ggtatgcgcc
   226921 gctgtcctac cggctctcgt cccaccccgt cccggcccca ccggcatgac ttggagaacg
   226981 agctacatgg tctgtgtgtg gatcttctgg tgtgcgtcct tttattagct ctgctgctgt
   227041 tggagctcgt tcccatggaa gccgtgcgtc acccgctgct tttctggcga cgcgtggcgt
   227101 tatcgccgtc cacttccaag gtggatcgcg ccgtcaagct gtgtcttcgg cgcatgctgg
   227161 gtctgccgcc gccaccgtca gtcgcaccac ctggggaaaa gaaggagcca ccggctcagg
   227221 cggccttgtc gccgccactg accacctggt cactaccgcc gtttccgtcc acgcggatac
   227281 ctgacagtcc gccgccaccg taccagcttc gtcacgccac gtcactagtg acggtaccca
   227341 cgctgctgtt atatacgtca tccgacatcg gtgacacagc ttcagaaaca acgtgtgtgg
   227401 cgcacgctac ttatggggaa cccccggagc ccgctcaatc gacggctacg gttcaggaat
   227461 gtgccgttct taccgcccca aattgcggca tcgtcaacaa cgacggcgcg gtctctgaag
   227521 gccaagacca tggagatacg gttcaccata gcctggatgt ggtttcccag tgtgctgctg
   227581 atactggggt tgttgacgcc tccgagtaac ggctgcactg tcgatgtcgg acaaaacatg
   227641 tccattcgag aacagtgccg tcttcgagac ggtgcgacgt tctccaaggg agacatcgaa
   227701 ggtaacttca gtgggcccgt cgtcgtggag ttggactacg aagacgtcga tattactggc
   227761 gaacggcagc gacttcggtt tcatctcagc ggactcgggt gtcctacaaa ggaaaatata
   227821 agaaaagaca atgaaagcga cgtcagcggt ggaattcgct gggctctata tatacaaacc
   227881 ggcgacacca agtacggtat tcgtaatcag catttgagta tacggttgat gtatcctggg
   227941 gaaaaaaata cacaacagct gttgggttct gatttcagtt gcgaacgtca ccggagaccg
   228001 tccacgccgt tgggaaataa cgccaaagtg cctttcacga cccgcacgtc ttctacatac
   228061 ggcgtcctca gcgcctttgt ggtgtggatc ggatccggcc tcaatatcat ctggtggacc
   228121 ggcatcgtgc ttctggcggc ggacgctctc gggcttggcg agcgttggct gaggttggcg
   228181 ctgtcccacc gggacaaaca tcacgcatcg cgaaccgcgg cgctccagtg tcaacgcgac
   228241 atgttacttc ggcaacgtcg acgggctcgg cggctgcacg ccgtttctga aggcaaactg
   228301 caggaagaga agaaacgaca gtctgctctg gtctggaacg ttgaggcgcg accctttccg
   228361 tccacacatc agctgattgt gctgccccct cctgtagcgt cagctcctcc tgcagttccc
   228421 tcgcagcccc ccgagtattc gtctgtgttt ccgcctgtat aaaaataaag agacgggagg
   228481 ctgatcgcgg ccttcagcgt ctcatttgtc tttactctcg agtgcggtcg gtgtctcgtc
   228541 ggtgagacga ggccgccgcc cgacaagttc gatctcatgt cgctcttgga gcgcgaagag
   228601 agttggcgtc gcgtagtcga ctactcgcac aacctgtggt gtacgtgcgg taactggcag
   228661 agccacgttg agattcagga cgaggagccc aactgcgagc agccggagcc cgcacactgg
   228721 ctggaatacg tggcggtcca gtggcaggcc cgggttcgcg attctcacga tcgctggtgt
   228781 ctctgcaacg cctggcgtga tcacgccttg cgcggccgtt ggggtacggc gtattcctcg
   228841 ggttcctcgg cctcttcctc cggtttcgtc gcggaaagca agttcacctg gtggaaacga
   228901 ctgcgccaca gtacccggcg ctggttgttt cgccgccggc gagctcgata cactccgtct
   228961 aactgtgggg aaagtagcac tagcagcggc cagagtagcg gtgacgagag taactgcagt
   229021 ctacgcaccc acggcgtgta cacacggggt gaacaacact aatcgataag tcgcgtgtag
   229081 gcgactggct acatcaaccg gatatctgcg gggatttaaa aagacgaccc gttgtcatcc
   229141 ggcttagagc aaaccgtcct tttatcatct tccgtcgcca tggctatgta cacatccgaa
   229201 tccgaacgcg actggcgtcg tgtaatccac gactcgcacg gcctgtggtg cgactgcggc
   229261 gactggcgag agcacctcta ttgtgtgtac gacagccatt ttcagcgacg acccacgacc
   229321 cgagccgaac ggagggccgc caattggcgg cgacagatgc ggcggttaca ccgtctgtgg
   229381 tgtttttgtc aggactggaa gtgtcacgcg ttatacgccg agtgggacgg caaagaatcc
   229441 gacgacgagt cgtcggcgtc ttcctcgggc gaagcgccag agcaacaggt ccccgcttgg
   229501 aagaccgtgc gagccttctc gcgggcctac catcaccgca ttaaccgggg tctgcggggc
   229561 acgcccccac cgcgcaactt gccgggatac gagcacgcct ccgagggctg gcggttttgc
   229621 agtcgacggg aacggcgaga ggacgatctt cgcacgcggg ctgagccgga ccgcgtggtg
   229681 ttccagttag ggggagtgcc gcctcgccgt caccgggaaa cttacgtgta agaacacggc
   229741 gtgacaataa acaacatagc gtaaatcccc gtgtgatgtg tgtgattgac gttcaggaaa
   229801 catgtcccca tcatcagcgt cacaactgac gtgggttggg tactgacgtg caggatatta
   229861 cgcgagtcag agaatcgcat aagaacgggg tggtgagcgg gttcccacag gagtttctgg
   229921 cacagaggca ccatgagcct caagttcccc gagagggtgg gttacgagaa attgggacac
   229981 cgcccgtata ccaaacgcgt gcgggtgcat gacccgttgg gattgacgcg gtttatcatg
   230041 aggcaactca tgatgtaccc gctggtgttg ccgttcactt ttccgtttta cgtgccgcgg
   230101 tcctagcacg tcagtggtga cgctgataat tgcaacatgg cccatgacga acccgcttgg
   230161 gacgaacgtc aataccacgt caaaccaccg tgacttggct gaacgttgaa acataaagcc
   230221 aaagcgccgt cggcacttgg cttcagagca gcgcctcggg gcgatgcgac ggcgatgaac
   230281 ttagagcaac tcatcaacgt ccttggtctg ctcgtctgga ttgccgctcg tgctgtcagc
   230341 cgcgttggtc cgcatggctc cggactcgtt tatcgtgagc ttcatgattt ctacgggtat
   230401 ttgcagctgg accttctggg accagtggtg gcggggaatc gctcagtccg gacctggaga
   230461 gagcaggcgg accgagccag agggaccttc gctcggcgtt caggccttaa tactagccac
   230521 atcttacctg tcggcagcat gtatcggggc tccgacacct tatccgccgg cctgtatcgt
   230581 tccaaagaag aggtgttcct cctcttgaac cgctgtcacg ggccactgtc aacgccgaaa
   230641 aacgcttgtc tggctgaggt tggtgtcgtt aatggaactt ttttgtctcg cttcaatgtc
   230701 ggtgattttc acggagcgtc atgggaaaac ggtaccgctc ccgatggaga gcccggggta
   230761 tgctgaaatt cttcttaaaa ttacgtaaac gacgtcgtcc agtcgttgtg ccgcgattcg
   230821 tacggttcat cgtctacgtc gttttgttca ccgtcgctgt gcaacgtgtg aaacaagagc
   230881 gcgatgcgca ccttcggcgg tatgaagaac ggttacggaa aaatcacgca cggcgtcggc
   230941 agtcttttcc gtgacttggg gcgatgggtc cgagctgcgg tatgggtcac ggcggcgtgt
   231001 gtcttactga cgaagatgcc gatgtatgac taaaaacgtc ccagccccag agcgatgtgt
   231061 ttcaataaaa aaatatgtag tatcatatta tgcgtgtcct ggtttttcat ttctggatgt
   231121 atttgttaca taaaaggcgg tgggatatgg ggatgaaaca tatgtagata cgcagtttta
   231181 ttatccgaac aaagctcgtg tgatgcgaaa aacggtactg caggatgaaa gtcccgttgg
   231241 gggggggggc agagagtagt cgcttttgcc gctgggcata cgctatgctt gtatttgtga
   231301 ctatactatg tgcagtcgtg tgtcgatgtt cctattggga agggtgtgaa tgtacgaggt
   231361 ataaagaatg gtgggacgca ggaagacatc gctagacaca gctgtattgt gctagcccca
   231421 cttagcgtca tgggtaaaac ggtgataaag cgtcaaaaca ccataggggg gggggggcag
   231481 gaggcttggt ggcggtgttc attaaatgca ttatgtgtat ttattgttac atttgcaaat
   231541 cgccgagtat accggtataa tgtagcaata atcgtattat gtgtgtacta tacagcgaac
   231601 attacaacat cagtgtagcg tgaagcaagt gtgggaacaa tgccagtgaa gaatatataa
   231661 aaggcagaaa catacataaa tgaattgcta gatacagggt tctttgtgta ctagcccaat
   231721 catgtcaata caatgtgtac agaaaaaaga cgcgacaacg acgggggggg gggcgcgtac
   231781 gattaatctt acatattaca gtacaggcta ccgcgtggtg ttgtatatgt tacgatgcgg
   231841 tgtgcctgtc agtgtaattg gatgtatgtt acttatccgt ggcgttgtga tagtgttgtg
   231901 aaaaataatt gtcgtgagca taatgacagc tgcaaaataa aaccgtttta ttgagcattg
   231961 taatggtagt gtgtggctac attagaaaac gtgacgcgtc gcatgtcgcg gcacaatctg
   232021 gcagcggggt cggggtaggg tacggtggga ggcatgtaca cagatggaac aaaagcagaa
   232081 gtaacgtgag acggagcata tagcccagta tccagcggtt cctgagtagc accacccatc
   232141 aactgaacgc cctcatgagt aaaagtctgc gggcggcagc ccttggggac cgttggcatg
   232201 ggacgatcaa tctccaaacc acagcgtaac acggttttct tccaacgtcg ttgatacacg
   232261 tcgtttttac ggttactccc cagaacccag aaagtctcgt ccaagtcgta ccaggagtct
   232321 tccccaggga gacgtggcgg tttccaatcc tcatcgtccc gtcgcaaagc acgtcccaaa
   232381 ctggcttggg gagtcaacgg tggttctgtg ggtcgggtgt agcgcgagtg ttttcccttc
   232441 atgaccgatt cgtcctcctt gcctttaggc tttttggtct ttttgtgtat catctggccg
   232501 ccggcttcca taaccaccgt ggccaagtcc agtcccagag cttgagcgtc ggcgcggcgt
   232561 cgagcgtctt gcaggtagtc ttccacattt gcacagatgg ccgggtgttt ggtggctagg
   232621 gtgaggacct cagcctcgcc gcggcccgga cgtaataaaa aagctaactg cccgtgcggc
   232681 tcgcgcgccc acagcgcggc gcgcgggtgc aggtgcagcg cgtcccagcg cggccgctcc
   232741 cactgctcgc ggtccagctc gggcagcagc cgccgcgcgg cctcggcggc gggcgccgac
   232801 tcgcgcccca gcgccagcgc gcccagcacg cccgcgcgca gaaagtgcga cagctccgcc
   232861 gccagcgggt acacgtgccc gtccagcggg cagtacccga acacggcgcc cagctcgtcc
   232921 agcaccacca ccagcatggc gcgcggcacg gtccctgacg ccgccggacc cgccatcgcc
   232981 gtcggaccca ccaacaccgt cggcgccgcc actgctgccg ccgcatccgc cccgaccacc
   233041 gcgtgcgcgt ccgcgtttgg cacgcacacc gcgttcccgc cggcggaggc gccgtatggc
   233101 tgcggaggca caggtacagc ggaccccacg gctcccgcca tcgcgcacgg cgcgtccccg
   233161 ccggcggcct ccgtctccgt gccgctcgcc cccgccggca acgtcgtccc cgccgtcatc
   233221 gtcgtcgtcc ccgccgccgt ccctgtcgcc ggccccgccg gccccgccgc gcagcccagc
   233281 caccgcgcgg gcagcaccgc gcccagcgcc agccagccgc agcacaaccg ttggttcagg
   233341 tgccgacgca cggccgtcag cagcgacgcg gggtgcgggg ccgacgcgaa cggttcgtac
   233401 tgcgccagct cctgccacgc gcccagcagc accatcggct gcagtcgcct tcccggcgtc
   233461 tgtagtgcca ccgtcgtgcc tgcccaccgc cggcgcagct cccgtccgag cgccgtcgcc
   233521 tcctcggcgc gcagcaacgt ctgtcggagc gccggctgag gcagcagcgt cgcgcgcggt
   233581 gtccccacgc ccagccggtt gcagcggtac agccgcacca cctcgcccgc gccgtgccga
   233641 aaccactcgt ccgcgtcgcg cgccgccagg atcagcgtgt tgttcgccag gtcgtacacg
   233701 aacacgcgga acccggcgcc cagcgccagg tacagtccgt cctgcgcgca cagaccctcg
   233761 ggatggccgg ccttgtcgcc caccgtcggg tcggccgcgg ggtccacctc gtgcaccacg
   233821 gtcgccacca acacgatcca cgcgtcacgc ggcgacaatt gacgcaggtc cgtcgcgccc
   233881 acgccgttca tctggctgcg cggcgtcacc cgcgcgtaga atccgtacgg ccgtccgagc
   233941 ggcagcagtg tgcccgcgtc gcgctgcgac cacttgcgca tggcgcggcc cgtgctgttg
   234001 gccagaaacg ccgcgcgcca cacggcgccc atggcctggt attccagctc cgtcagcgcc
   234061 tggcgctcca caggaatctg agacagcaac aggcgctccg ggccgtgcca aaagttgctg
   234121 ttgttgccgc tacccggagg ggcgcccggc ggcccgcggg gttctacgcg gtggacgccg
   234181 tgggccggcg tcgccgaacc cgcagtactc gcaccagtcc ccgctgttga cgtcgctgcc
   234241 atcggcacac aagaagaaga aggggaggaa ccaacccccg aaggccctcc ggcaccgcgg
   234301 ccgcgaccga ggggcggggg gcgcggcgac atgccgttgc gctgggccat ggccgccgga
   234361 cacctccgac gtcgagccga cgtccactat atagcaacac aacccgcgtc cgcgaccacg
   234421 ccgtttacac acggggacgt ctccgttgtc cgtgtgctac ggtcgccacg cacctggctt
   234481 ttataggcag cggcgtgcac ggcgcttgct agcgccgcct tggcgccgcg cagtctaaaa
   234541 ggccgtggaa aaccacccgg cagcccagcc acccgaagga acacgcgcga cagccccgga
   234601 gtgcaaagca aagccgcctc ccgagcgcgc acccacctag gtggacggcc gacatccatt
   234661 ccgggccgtg tgctgggtcc ccgaggggcg ggggggtgtt tttagcgggg gggtgaaatt
   234721 tggagtcttg gagccgcgtg tgctgtggag gacggtgacg gtggtaagag tgtgctgcgg
   234781 tgcggttggg acggcggcgg cgaataaaag cggcgtgcgg cgcgcacggc gaaaagcaga
   234841 cgcgcgtctg tgttgtgtgt ctttgaccgc ggcggaacac acgcggaaaa gcgagtccca
   234901 ggggacacac gacgagcgag tcccaggggg ggacgacgac ggccagggac gcggaaacga
   234961 cgcggaaaag aggaagtccc cagggggacg ggcggaaaag aggaagcgcc taggggaccg
   235021 cgggggcagg aacagacgaa gtacgccgca acccgcgtcg aggacacacg cagaagcggc
   235081 cgcccagggg aggggggggg ggggactcgc gggccccggg gcacacttgt tgttccctcc
   235141 ggccgccgac acgcaccccg aagccgcgca caccgccgac acacccctga cacacccgcg
   235201 acacacccgc cacacgcccg acacacgccc gcgacacacc cgaccgacac accctgacac
   235261 accccgccaa cacacccagc cgcacccgcc ccgccaacac acccccgaca cacccgacac
   235321 acgcccgcga cacacccggc acacacccac ccacccagcc gcgcccccga cacaccccga
   235381 acggcgccgg tgcgggacag ggct
//