LOCUS       CP001365             2735295 bp    DNA     circular BCT 01-MAR-2021
DEFINITION  Halorubrum lacusprofundi ATCC 49239 chromosome 1, complete
            sequence.
ACCESSION   CP001365 ABEB01000000 ABEB01000001 ABEB01000002 ABEB01000003
            ABEB01000004 ABEB01000005 ABEB01000006 ABEB01000007 ABEB01000008
            ABEB01000009 ABEB01000010 ABEB01000011 ABEB01000012 ABEB01000013
            ABEB01000014 ABEB01000015
VERSION     CP001365.1
DBLINK      BioProject: PRJNA412908
            BioSample: SAMN02598407
KEYWORDS    .
SOURCE      Halorubrum lacusprofundi ATCC 49239
  ORGANISM  Halorubrum lacusprofundi ATCC 49239
            Archaea; Euryarchaeota; Stenosarchaea group; Halobacteria;
            Haloferacales; Halorubraceae; Halorubrum.
REFERENCE   1  (bases 1 to 2735295)
  AUTHORS   Dassarma,S., Capes,M.D., Karan,R. and Dassarma,P.
  TITLE     Amino acid substitutions in cold-adapted proteins from Halorubrum
            lacusprofundi, an extremely halophilic microbe from antarctica
  JOURNAL   PLoS One 8 (3), e58587 (2013)
   PUBMED   23536799
REFERENCE   2  (bases 1 to 2735295)
  AUTHORS   Karan,R., Capes,M.D., DasSarma,P. and DasSarma,S.
  TITLE     Cloning, overexpression, purification, and characterization of a
            polyextremophilic beta-galactosidase from the Antarctic
            haloarchaeon Halorubrum lacusprofundi
  JOURNAL   BMC Biotechnol 13, 3 (2013)
   PUBMED   23320757
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 2735295)
  AUTHORS   Anderson,I.J., DasSarma,P., Lucas,S., Copeland,A., Lapidus,A., Del
            Rio,T.G., Tice,H., Dalin,E., Bruce,D.C., Goodwin,L., Pitluck,S.,
            Sims,D., Brettin,T.S., Detter,J.C., Han,C.S., Larimer,F.,
            Hauser,L., Land,M., Ivanova,N., Richardson,P., Cavicchioli,R.,
            DasSarma,S., Woese,C.R. and Kyrpides,N.C.
  TITLE     Complete genome sequence of the Antarctic Halorubrum lacusprofundi
            type strain ACAM 34
  JOURNAL   Stand Genomic Sci 11 (1), 70 (2016)
   PUBMED   27617060
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 2735295)
  AUTHORS   Laye,V.J., Karan,R., Kim,J.M., Pecher,W.T., DasSarma,P. and
            DasSarma,S.
  TITLE     Key amino acid residues conferring enhanced enzyme activity at cold
            temperatures in an Antarctic polyextremophilic beta-galactosidase
  JOURNAL   Proc Natl Acad Sci U S A 114 (47), 12530-12535 (2017)
   PUBMED   29109294
REFERENCE   5  (bases 1 to 2735295)
  AUTHORS   Laye,V.J. and DasSarma,S.
  TITLE     An Antarctic Extreme Halophile and Its Polyextremophilic Enzyme:
            Effects of Perchlorate Salts
  JOURNAL   Astrobiology 18 (4), 412-418 (2018)
   PUBMED   29189043
REFERENCE   6  (bases 1 to 2735295)
  AUTHORS   DasSarma,S., DasSarma,P., Laye,V.J. and Schwieterman,E.W.
  TITLE     Extremophilic models for astrobiology: haloarchaeal survival
            strategies and pigments for remote sensing
  JOURNAL   Extremophiles 24 (1), 31-41 (2020)
   PUBMED   31463573
REFERENCE   7  (bases 1 to 2735295)
  AUTHORS   Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Dalin,E.,
            Tice,H., Bruce,D., Goodwin,L., Pitluck,S., Sims,D., Brettin,T.,
            Detter,J.C., Han,C., Larimer,F., Land,M., Hauser,L., Kyrpides,N.,
            Ivanova,N., Anderson,I., DasSarma,S., Cavicchioli,R. and
            Richardson,P.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Direct Submission
  JOURNAL   Submitted (14-JAN-2009) US DOE Joint Genome Institute, 2800
            Mitchell Drive B310, Walnut Creek, CA 94598-1698, USA
COMMENT     URL -- http://www.jgi.doe.gov
            JGI Project ID: 4001421
            Source DNA available from Professor Shiladitya DasSarma
            Archaea available from ATCC: ATCC 49239
            Contacts: Ricardo Cavicchioli (r.cavicchioli@unsw.edu.au)
                      Shiladitya DasSarma (sdassarma@som.umaryland.edu)
                      David Bruce (microbe@cuba.jgi-psf.org)
            Annotation done by JGI-ORNL and JGI-PGF
            Finishing done by JGI-LANL
            Finished microbial genomes have been curated to close all gaps with
            greater than 98% coverage of at least two independent clones. Each
            base pair has a minimum q (quality) value of 30 and the total error
            rate is less than one per 50000.
            The JGI and collaborators endorse the principles for the
            distribution and use of large scale sequencing data adopted by the
            larger genome sequencing community and urge users of this data to
            follow them. it is our intention to publish the work of this
            project in a timely fashion and we welcome collaborative
            interaction on the project and analysis.
            (http://www.genome.gov/page.cfm?pageID=10506376).
FEATURES             Location/Qualifiers
     source          1..2735295
                     /organism="Halorubrum lacusprofundi ATCC 49239"
                     /mol_type="genomic DNA"
                     /strain="ATCC 49239"
                     /culture_collection="ATCC:49239"
                     /type_material="type strain of Halorubrum lacusprofundi"
                     /db_xref="taxon:416348"
                     /chromosome="1"
     gene            780..2453
                     /locus_tag="Hlac_0001"
     CDS             780..2453
                     /locus_tag="Hlac_0001"
                     /inference="protein motif:TFAM:TIGR02928"
                     /note="KEGG: nph:NP0596A cell division control protein
                     cdc6-like protein;
                     TIGRFAM: orc1/cdc6 family replication initiation protein;
                     PFAM: CDC6 domain protein;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="orc1/cdc6 family replication initiation protein"
                     /protein_id="ACM55607.1"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR014277"
                     /db_xref="InterPro:IPR015163"
                     /translation="MDEGENTPQADESKDNSGITGDRSGTDQVDETDGSDETDANLDD
                     PPSPGSTNSDLNTDLQSDPETDVSTDIDVGSGGRDRSSPDVDFDGVVLDDDDDNQGLF
                     DDLLSGEPIFENKEVLRPSYTPHELPHRNDQINRMATILVSALRGETPSNILIYGKTG
                     TGKTASAKFVSQELESTSQKYDVPCEVEYINCEVTDTQYRVLAQLANTFIEKNQAVIA
                     DQLERCRELRSAAADAPAALADTEFATLDDLDARIDELETDAEEMEEVPMTGWPTDRV
                     YSTFFEAVDYHERVVVIMLDEIDKLVEKSGDDTLYNLSRMNSELNRSRISIMGISNDL
                     KFTDFLDPRVKSSLGEEEIVFPPYDANQLRDILQHRADISFKQDALTDDVIPLCAAFA
                     AQEHGDARRALDLLRTAGELAERSQAEIVAEKHVRQAQDKIELDRVVEVVRTLPTQSK
                     IVLFAVILLEKNGVHNINTGEVFNIYKRLCEEIDADVLTQRRVTDLISELDMLGIVNA
                     VVVSKGRYGRTKEMGLSVPVEETEAVLLSDSRLGDIENAQPFVQARFDN"
     gene            complement(2519..3616)
                     /locus_tag="Hlac_0002"
     CDS             complement(2519..3616)
                     /locus_tag="Hlac_0002"
                     /inference="protein motif:COG:COG0681"
                     /note="KEGG: hwa:HQ1002A signal sequence peptidase"
                     /codon_start=1
                     /transl_table=11
                     /product="Signal peptidase I-like protein"
                     /protein_id="ACM55608.1"
                     /translation="MDEGDRSDGGDEPDRKTGSADSDPVNDGDFSGDDGNGGDQSVSK
                     EDCETGPGESSETGSADTETPSDERGRASDDRIETGQAGSKPSRGRGETGRDRTETDR
                     DSNSSGKGVLYRFRHNREGPLMWIREMLSSVAIVLVIGLILFGVSGVWPPMVAVESGS
                     MEPNIEVGDLVFVTEPGRLAPDAADNDIGVVTHEVGETADYQTFGSYGSVVIYRPPGR
                     TTSPIIHRAMFHVEEGENWHDRADDRYHNAADCGELNHCPAPHDGFITLGDNNGEYDQ
                     ANGLAAPVKADWVTGVARVRVPYLGYVRLITTGQADLSDVLATSVVMQTGGVGADADG
                     VSSGSGSSEKITVPDAKPIVSGGEVTAEAVA"
     gene            3728..5494
                     /locus_tag="Hlac_0003"
     CDS             3728..5494
                     /locus_tag="Hlac_0003"
                     /EC_number="2.7.7.7"
                     /inference="protein motif:PFAM:PF00149"
                     /note="PFAM: nucleic acid binding OB-fold
                     tRNA/helicase-type; metallophosphoesterase; DNA polymerase
                     epsilon subunit B;
                     KEGG: nph:NP0482A DNA polymerase II small subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="metallophosphoesterase"
                     /protein_id="ACM55609.1"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR007185"
                     /translation="MPLESNARIVKELARRGYNAEREAITLLASAPDSAAAVESVVDR
                     APDDALRITTDHVRAVTNDQSVSGGDSAVSPPDSAASGPGSAASGPGSAASGPGSTAS
                     VADPTTESPPTRNSDQPPSTTSTEGSPVEMEGSSLDHVPGSDRDAENPETDIDTEIDR
                     DSDSNADSSVDRSPDRSPDSTSHHDPDIRELEVGNDMTGQSTGTGEYSDFVRTFRDRY
                     ERLSKVLRGRVNHRPAEAIAEMPGGSDAAMIGLVNDVRSTKSGHWLVELEDTTGTFPA
                     LIMKDKGLADLVDEIMMDECLAIEGTLADDSGILFADSLHFPDVPRTHRTGAADRHVQ
                     AALISDIHVGSDEFMVDAWSSFTDWLHTPEAEPVEYLLLAGDMVEGVGVYPDQDEELE
                     IVDIYDQYEAFAEYLKEVPADTEIVMIPGNHDAVRLAEPQPGFNDEIRSIMDVHDAQI
                     VSNPATVTVEGVDVLMYHGVSLDEVIAELPEEKASYDEPHKAMYQLLKKRHVAPQFGG
                     HTRVAPEERDYLVIEDVPDVFHTGHVHKLGWGKYHNVLAVNSGCWQAQTDFQKSVNIN
                     PDSGYAPILDLDTLDMTVRKFA"
     gene            complement(5540..6172)
                     /locus_tag="Hlac_0004"
     CDS             complement(5540..6172)
                     /locus_tag="Hlac_0004"
                     /inference="protein motif:PFAM:PF01205"
                     /note="PFAM: protein of unknown function UPF0029; Domain
                     of unknown function DUF1949;
                     KEGG: hsl:OE4224F hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function UPF0029"
                     /protein_id="ACM55610.1"
                     /db_xref="InterPro:IPR001498"
                     /db_xref="InterPro:IPR015269"
                     /translation="MSETYLTVGESATARFEVQGSEFFGHVAPADTVAAAEEFIDRVR
                     TEYDDATHNVPAYRVPAGEASARTPGSEVMLREYSSDDGEPTGSAGKPALNVLQQRDI
                     RNVVAVVTRYYGGTNLGVGGLARAYSRAVKDGVDEAGVIEERPHRQLVVETAYDDSGT
                     VRGVIESSGVEFDADYDERVRLVLRVPVAEVESLVERLNSATSGRVEIDR"
     gene            complement(6169..6693)
                     /locus_tag="Hlac_0005"
     CDS             complement(6169..6693)
                     /locus_tag="Hlac_0005"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: GH24387 gene product from transcript
                     GH24387-RA"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACM55611.1"
                     /translation="MNATESGSDRQFTGRDTSRKRLLRAVAAQTAALSAAVHFLWAWP
                     RLAEPADARPYVFLLGGAFTVAIAVATLRADEYRRLYALGAGTLAAFLAGYAGWHGGG
                     TAAALASDPLAIVAKGAEVVGVAAFLALYRLAPPTSVVVERQEEAESGEEEATNGGEA
                     IGDTTASNDEDARA"
     gene            complement(6698..7303)
                     /locus_tag="Hlac_0006"
     CDS             complement(6698..7303)
                     /locus_tag="Hlac_0006"
                     /inference="similar to AA sequence:KEGG:HQ3430A"
                     /note="KEGG: hwa:HQ3430A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55612.1"
                     /translation="MGIFDTIRAVLGTSAETDATREADPEDLFGMSTAYMTMEADLGY
                     DHCGEAALCFSGVDSTRFDDAVETVEAILEAGEIDTGTGFHRHEDDHGYQWFVLEDND
                     PEDLVTSIHFAADQFIEEGFGSRLLAAVFGFERDGVDAYWIYSFRRGAYYPFSPKGTS
                     DRNQQVEFKLQSVLDGELGLEDDEAYWYPLWPDTPGNHPWE"
     gene            complement(7402..8322)
                     /locus_tag="Hlac_0007"
     CDS             complement(7402..8322)
                     /locus_tag="Hlac_0007"
                     /inference="protein motif:PFAM:PF00753"
                     /note="PFAM: beta-lactamase domain protein;
                     KEGG: nph:NP1688A hydrolase (hydroxyacylglutathione
                     hydrolase) 4"
                     /codon_start=1
                     /transl_table=11
                     /product="beta-lactamase domain protein"
                     /protein_id="ACM55613.1"
                     /db_xref="InterPro:IPR001279"
                     /translation="MHAGEFESVRGIADLYVHDTGMFGTDEYGAVYVYDTEKPAVIDT
                     GTGVNREALFKTLDEIGIGREELAWILPTHAHLDHAGGAGHLVERYPNAEVRLPEKGV
                     RHLIDPEALVAGTKSAVQDQWQYYDDPAPVPEDRISGLAEGDRIDLGDRELVVHEAPG
                     HAPHHAFYHEPDADVVFTADAAGIYVPAVDTVRPTTPPPQFDLDQCLTDLSAIEEIDP
                     EYLCFGHFGPREYEPSLIGEAKRAYVEWVEAVREKREALGDDEAVVEHFEETSRDVEF
                     WNPERARADASLNSRGILTYLNRIEGESEA"
     gene            8436..9371
                     /locus_tag="Hlac_0008"
     CDS             8436..9371
                     /locus_tag="Hlac_0008"
                     /inference="protein motif:PFAM:PF01370"
                     /note="PFAM: NAD-dependent epimerase/dehydratase;
                     dTDP-4-dehydrorhamnose reductase; NmrA family protein;
                     Male sterility domain;
                     KEGG: nph:NP0704A NADH dehydrogenase 32K chain-like
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent epimerase/dehydratase"
                     /protein_id="ACM55614.1"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR005913"
                     /db_xref="InterPro:IPR008030"
                     /db_xref="InterPro:IPR008162"
                     /db_xref="InterPro:IPR013120"
                     /translation="MRVLVTGATGFVGSRLVPALLDRGHEVVVLVRDADDYAPPAGVH
                     VVEGDLLEPNSLRSAFDIDGDPVDAAYYLVHSMDGGPGYEERDRNCAQNFIEAASTAG
                     VDRVIYLGGLGEDREDLSEHLKSRREVERILGTSDPALTTLRAAIIVGAGSASFEVIH
                     GLASRLPVMTTPKWVDTLCQPIAIDDVVGYLVGALEEPATADDTFEIGGPNVLTYAEI
                     LRQTRRQLGHKLWIIRVPVLSPELSAKWLRLVTDVNPYLARSLVEGLRNTVIVEDDRI
                     RDLVPIDQTPFEVAVARAINEANRSEAARSEATRS"
     gene            9368..10036
                     /locus_tag="Hlac_0009"
     CDS             9368..10036
                     /locus_tag="Hlac_0009"
                     /inference="similar to AA sequence:KEGG:NP0702A"
                     /note="KEGG: nph:NP0702A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55615.1"
                     /translation="MSRNYGEMWVYESLVGGIPGLDISRRLAVAIQFVLFEVGVVALG
                     WYYGLWDAVVAGTVAVAVAAVGSVEMHRLGAINRRLPTPPAHKRLLFGSSIEIVLGVL
                     AFIALVTYLIAWDGALLDRLFGPDPPIPVVYLSLLILWDLTYRIGTSWWSAVVALWRA
                     VHVDLSPAATSRARRLDAENIAFSALQLVLVPFLLSEPVLLGAVVGHVLAVAIVCSAA
                     IVLS"
     gene            complement(10106..10279)
                     /locus_tag="Hlac_0010"
     CDS             complement(10106..10279)
                     /locus_tag="Hlac_0010"
                     /inference="similar to AA sequence:KEGG:NP0700A"
                     /note="KEGG: nph:NP0700A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55616.1"
                     /translation="MSMGAYDEAEYERREKKNSEVDADFDAERPEYSGSLTYDTGDST
                     EALLDKFQELQDE"
     gene            10391..11437
                     /locus_tag="Hlac_0011"
     CDS             10391..11437
                     /locus_tag="Hlac_0011"
                     /inference="similar to AA sequence:KEGG:OE2975F"
                     /note="KEGG: hsl:OE2975F hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55617.1"
                     /translation="MAQPIRFRRAPGGWSDDRVRAQLERPLDDNLGATASDPWFAPPP
                     GYEARRFDMADGSFALFCWTDGDDNSPNGADGGPVGYWVGNTETPSELWRTDKYGFDE
                     VPYPVSRWVQRELLAGLHDDEPWFAAYPHVSWFFLPVFCSKDGAETTRAFFRDHAAGF
                     PDATREEGTGFVEETLRPGTLDDYRETMAGKLGTSTSLDLVRMSAAIAEFTAARILTE
                     AGYEVTPEIEVTTGHSLDFRATDPNTRTASLVEVTRPQPVSGRSASDPVAAVRDTAET
                     KTSGQLEAHGGGVTLFVDCTSFPADDWAAVREARPEVRHRPAVVLRARPDGHVEGYRK
                     GSVPIDLSAAIDWV"
     gene            complement(11560..11844)
                     /locus_tag="Hlac_0012"
     CDS             complement(11560..11844)
                     /locus_tag="Hlac_0012"
                     /inference="similar to AA sequence:KEGG:HQ3440A"
                     /note="KEGG: hwa:HQ3440A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55618.1"
                     /translation="MRLNGVDDRLERHQYPTTSEELIAAHGNATVELADGSERLGDVL
                     ERFGDQTFDNADDVFTTLRAGVCHRGVGRRFYSDRDPTTDADDGPSPVSF"
     gene            11986..12795
                     /locus_tag="Hlac_0013"
     CDS             11986..12795
                     /locus_tag="Hlac_0013"
                     /inference="protein motif:PFAM:PF02811"
                     /note="PFAM: PHP domain protein;
                     SMART: phosphoesterase PHP domain protein;
                     KEGG: hsl:OE4492F hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="PHP domain protein"
                     /protein_id="ACM55619.1"
                     /db_xref="InterPro:IPR003141"
                     /db_xref="InterPro:IPR004013"
                     /translation="MDTDRIVADLHAHTTVSDGTMTADELVDVARETGLDWVAITDHD
                     RVHPDLSAPVVERDDLRVVRGIELRVDAGFERLDLLGYAVGHTEALDAEIERLQTDRE
                     QRGAAIVDAVEDRLGVDLGVEPRSGLGRPHIARAIDESSAPYDYAGAFDELIGNDGPC
                     YVAREVTKLERGVELLRDACALVGLAHPFRYDDVGAALDVARELDAVERFYPYGRAVD
                     DALVERVAAESDLLLTGGTDAHERTLGEAGLTAEAFAPVRERLPNPIAESP"
     gene            12865..13029
                     /locus_tag="Hlac_0014"
     CDS             12865..13029
                     /locus_tag="Hlac_0014"
                     /inference="similar to AA sequence:KEGG:OE4491F"
                     /note="KEGG: hsl:OE4491F hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55620.1"
                     /translation="MRCHYCEREAAYEAEQSGVVVGLCEEHFKARVEELAESDELASL
                     RDKIDIESSE"
     gene            13164..14144
                     /locus_tag="Hlac_0015"
     CDS             13164..14144
                     /locus_tag="Hlac_0015"
                     /EC_number="4.2.1.24"
                     /inference="protein motif:PFAM:PF00490"
                     /note="PFAM: delta-aminolevulinic acid dehydratase;
                     KEGG: hma:rrnAC2610 delta-aminolevulinic acid dehydratase"
                     /codon_start=1
                     /transl_table=11
                     /product="delta-aminolevulinic acid dehydratase"
                     /protein_id="ACM55621.1"
                     /db_xref="InterPro:IPR001731"
                     /translation="MHPTDRPRRLRTDGARSLVSETSLSASDLVAPVFVDATTDERVP
                     IETMPGHERVPVDEAVARVEEVRETGVEAVIVFGIPESKDAEGTRAYAEDGVVQRAIR
                     RITAETDAYVIGDVCLCEYTDHGHCGVIEESAETDPTLTVKNDETLELLAETAVSQAD
                     AGADMVAPSAMTDGQVRAIREALDAAGHADVGLMSYAVKYESAFYGPFRDAADGAPAF
                     GDRRHYQMDPANRREALREARIDAEEGADVLMVKPGLPYLDIVGDLRREFDHPIAAYN
                     VSGEYAMLHAAAEKGWLDLEATAHESLLSLKRAGADLIITYFAEDLAERL"
     gene            complement(14486..14728)
                     /locus_tag="Hlac_0016"
     CDS             complement(14486..14728)
                     /locus_tag="Hlac_0016"
                     /inference="similar to AA sequence:KEGG:rrnAC2875"
                     /note="KEGG: hma:rrnAC2875 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55622.1"
                     /db_xref="InterPro:IPR001450"
                     /translation="MRVKFDRDTCVGMYQCVAEWDAFEKNLNDGKADLRGSEEEDEDV
                     FVVEVPDGEEFDAKFAARVCPVDAIEVYDDDGEQVV"
     gene            15109..15363
                     /locus_tag="Hlac_0017"
     CDS             15109..15363
                     /locus_tag="Hlac_0017"
                     /inference="similar to AA sequence:KEGG:OE4341R"
                     /note="KEGG: hsl:OE4341R hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55623.1"
                     /translation="MTTVWLVDRQFDSKGLVRLTYATEDGERMHTKELAEQRLVTGDG
                     VTAGREVEENALGESPADEIERFATEASKMAAEHDLDDRV"
     gene            15448..18126
                     /locus_tag="Hlac_0018"
     CDS             15448..18126
                     /locus_tag="Hlac_0018"
                     /inference="protein motif:TFAM:TIGR00422"
                     /note="TIGRFAM: valyl-tRNA synthetase;
                     KEGG: hwa:HQ1051A valyl-tRNA synthetase"
                     /codon_start=1
                     /transl_table=11
                     /product="valyl-tRNA synthetase"
                     /protein_id="ACM55624.1"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR002300"
                     /db_xref="InterPro:IPR002303"
                     /db_xref="InterPro:IPR013155"
                     /db_xref="InterPro:IPR015413"
                     /translation="MPSGEYDPDTVEPRWQRRWVDEETYAYPDDDPVDPNTVFSIDTP
                     PPTVSGSLHMGHLYGFTLQDFVARFERMNGGETFFPFGYDDNGIASERLTEDELDIRH
                     QDFERREFQAKCREVCAEYEAQFTENVQSLGVSVDWDHTYQTIEPRVQRISQLSFLDL
                     YDQGREYREKAPAIWCPECETAISQVETEDDEQASHFHDIAFPVVGGDATDDGAEEFV
                     ISTTRPELLPACVAVFVHPDDDENQNLVGESAEVPLFGHEVPIIADERVDMETGSGIV
                     MCCTFGDQNDIEWYQVHDLNLRVAIDESGHMTDVAEGYEGMHADEAREAIVEDLDGAG
                     ALLDRRDITHTVNVHERCGTSVEFLVTEQWYVEMLDKTDEYLEIGREMEWSPEKMFTR
                     YEHWVEGLQWDWLISRQRSSGIPFPVWYCEDCGEIVVAEKADLPVDPLSDDPPVDACP
                     ECGHDEFEPEDDVLDTWATSSLTPLINAGWDWDEDAGEFTMEHPELYQFDLRPQGHDI
                     ISFWLFHTLVKCYEHTGEVPFEETMINGHVLDENREKMSKSVGNVVEPEAVLAEFPVD
                     ATRYWAAGTAVGDDFPFKEKDLRAGEKLIRKLWNASKLVESLAPEPYPDTPADEDLRE
                     LDRWLLAELDDRIERLTGLFEDRAFSKARDELRSFFWNTFCDDYLEIVKQREDDAAAY
                     TLRTAHRRFLKLFAPLLAHVTEELWHDMYADGASDPDAVDAAVADGARDSIHLADWPE
                     PLGLEADHEAGAAATAVVGALRKYKSKNQLPLNAELDAVEVYADVRGFEEDITGVMHV
                     ADLTVHPDEDAPVETVITGIDLDYATVGPKYGDQVGDIEAALAKEEYEIDGEELHVTG
                     VTLVEEEFAIEEERQYQGDGELLEADDVVVIVRNEA"
     gene            complement(18147..19229)
                     /locus_tag="Hlac_0019"
     CDS             complement(18147..19229)
                     /locus_tag="Hlac_0019"
                     /EC_number="1.3.98.1"
                     /inference="protein motif:PFAM:PF01180"
                     /note="PFAM: dihydroorotate dehydrogenase;
                     KEGG: hsl:OE4508R dihydroorotate oxidase"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroorotate dehydrogenase"
                     /protein_id="ACM55625.1"
                     /db_xref="InterPro:IPR001295"
                     /db_xref="InterPro:IPR005719"
                     /translation="MPVRDETETMGAYDLLKPALFGLPPETAHGLTHRLLRAVQTTPV
                     TEHLHSRFSVNDPRLRVEAFGNEFPNPVGVAAGFDKNAEVPRGLAALGFGHVEVGGVT
                     AEQQPGNPRPRLFRLREDEALINRMGFNNEGADIVGERLDREPLPEIPVGINIGKSKS
                     TPLAEAPEDYLYTYERVADAGDYFVVNVSSPNTPGLRELQNRAALEEILGTLTDAGAD
                     PLLVKLSPDLPEPAVEDALGVVDDLGLDGVIATNTTTSRPNSLKSPQQAERGGLSGKP
                     IEPIATERVRFVAERTDVPVIGVGGISDAKGAYEKIRAGASLIQLYTGLVYEGPGLAR
                     DINGGVLDLLDRDGFDSVEAAVGADL"
     gene            complement(19335..19538)
                     /locus_tag="Hlac_0020"
     CDS             complement(19335..19538)
                     /locus_tag="Hlac_0020"
                     /inference="similar to AA sequence:KEGG:NP0426A"
                     /note="KEGG: nph:NP0426A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55626.1"
                     /translation="MVRKKKLSPSGAKDDEGEYHNVHVNLHEDELAVAGMDIGDEVFV
                     RVRDGKIIIQKADSSPEDLEHDF"
     gene            19833..20162
                     /locus_tag="Hlac_0021"
     CDS             19833..20162
                     /locus_tag="Hlac_0021"
                     /inference="protein motif:PFAM:PF05854"
                     /note="PFAM: Non-histone chromosomal MC1 family protein;
                     KEGG: hsl:OE4509F nonhistone chromosomal protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Non-histone chromosomal MC1 family protein"
                     /protein_id="ACM55627.1"
                     /db_xref="InterPro:IPR008674"
                     /translation="MVREDGKRNFALREEDGSEPSEFSGNMPRQAALKAARTLEPAPS
                     EEEAERITLRLREKGTQKVHEYEGWAWKDSAPEVDDAADEFWLNDLDDITKANVSKQG
                     IEYIDDE"
     gene            complement(20374..20517)
                     /locus_tag="Hlac_0022"
     CDS             complement(20374..20517)
                     /locus_tag="Hlac_0022"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACM55628.1"
                     /translation="MVYVVSGPPSDLDDTELPRLTSDFLLRRSAGGEILIFADLIVPS
                     DGL"
     gene            20596..22065
                     /locus_tag="Hlac_R0001"
     rRNA            20596..22065
                     /locus_tag="Hlac_R0001"
                     /product="16S ribosomal RNA"
                     /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res.
                     Apr2 2, 2007"
     gene            22224..22295
                     /locus_tag="Hlac_R0002"
                     /note="tRNA-Ala1"
     tRNA            22224..22295
                     /locus_tag="Hlac_R0002"
                     /product="tRNA-Ala"
     gene            22579..25484
                     /locus_tag="Hlac_R0003"
     rRNA            22579..25484
                     /locus_tag="Hlac_R0003"
                     /product="23S ribosomal RNA"
                     /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res.
                     Apr2 2, 2007"
     gene            25628..25745
                     /locus_tag="Hlac_R0004"
     rRNA            25628..25745
                     /locus_tag="Hlac_R0004"
                     /product="5S ribosomal RNA"
                     /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res.
                     Apr2 2, 2007"
     gene            25892..25967
                     /locus_tag="Hlac_R0005"
                     /note="tRNA-Cys1"
     tRNA            25892..25967
                     /locus_tag="Hlac_R0005"
                     /product="tRNA-Cys"
     gene            complement(26033..26836)
                     /locus_tag="Hlac_0023"
     CDS             complement(26033..26836)
                     /locus_tag="Hlac_0023"
                     /inference="protein motif:SMART:SM00419"
                     /note="SMART: regulatory protein Crp;
                     KEGG: hal:VNG1548C hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="regulatory protein Crp"
                     /protein_id="ACM55629.1"
                     /db_xref="InterPro:IPR001808"
                     /translation="MTDSDRATPPEVLDSKRDATRYQVLVEIAARQPAVSQTEIAEAI
                     GVTSQAVSDYVRDLVEHEYVEKEGRGRYTVTKEGVDWLISRTDSLEAYLNRVSSDVLG
                     SVDVDAAIAMDDIAEGSDVGLLMRNGVLHANPAGGTATAVTVTAAAAGEAVGVADFEG
                     VVDYETGYVTVLPVPAVTDAASVAPDVLTATRPSESLLAVAGTEAYALAARADAHPDI
                     RFGTVDAVAEAAVRGMNVLLIVTADQLPKHTARLRDENIPHEVLDAGDF"
     gene            27137..27994
                     /locus_tag="Hlac_0024"
     CDS             27137..27994
                     /locus_tag="Hlac_0024"
                     /inference="similar to AA sequence:KEGG:HQ1122A"
                     /note="KEGG: hwa:HQ1122A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55630.1"
                     /db_xref="InterPro:IPR010916"
                     /translation="MQRRAVAVYAALFVLVAGVAGVLTVTADSPEIGFENPDYEVSDG
                     ETIEVEGQEYVVEITEVEESGGGGHGGGGGGTSLVATIERNMTVEQSEAWANGSTVQF
                     NEREWRVEITGEDPSEFTLVEVPDRQAILEADPQADNETVQRDDGEYVVVTEDGESSL
                     IPVGEYFPAPEERSYATGGTLEYSSQTATVDNVTADQAVLVWEATETESIEVQDEGIV
                     TLVETDLVAHFADSSTLHLSSDIEGYDAQVAEIEQFEQYNSGLTRVVILALFSIVLLL
                     SAAFIPSRY"
     sig_peptide     27137..27220
                     /locus_tag="Hlac_0024"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.996) with cleavage site probability 0.847 at
                     residue 28"
     gene            28130..28339
                     /locus_tag="Hlac_0025"
     CDS             28130..28339
                     /locus_tag="Hlac_0025"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACM55631.1"
                     /translation="MTDTAEKIRQLAPHWGVMFVVMFVVLAIVERVVGSLSFLASMLL
                     VFVVAFGYPIVVRALGVAPPIWQRP"
     gene            complement(28383..28529)
                     /locus_tag="Hlac_0026"
     CDS             complement(28383..28529)
                     /locus_tag="Hlac_0026"
                     /inference="similar to AA sequence:KEGG:NP2006A"
                     /note="KEGG: nph:NP2006A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55632.1"
                     /translation="MEILLHSGLEHPNTLWIAAAAVISFVLGVVSTTYGRRIAAPFRD
                     STEE"
     gene            28706..29320
                     /locus_tag="Hlac_0027"
     CDS             28706..29320
                     /locus_tag="Hlac_0027"
                     /inference="protein motif:PFAM:PF00903"
                     /note="PFAM: Glyoxalase/bleomycin resistance
                     protein/dioxygenase;
                     KEGG: hsl:OE1899R homolog to lactoylglutathione lyase /
                     aromatic compounds dioxygenase"
                     /codon_start=1
                     /transl_table=11
                     /product="Glyoxalase/bleomycin resistance
                     protein/dioxygenase"
                     /protein_id="ACM55633.1"
                     /db_xref="InterPro:IPR004360"
                     /translation="MSDDIPAPVTPERPDAPFHTTGTDHVTVWGSNEADTIAFYRDLL
                     GMPLVLRQPNLDDPSQTHLFFDTGDGRILTFFVSDDRPSARGQRAGTGAVHHLCFSVD
                     PDEYEDIMSALEDAGKGYNVFDRGIFHSIYTQDNNGLVIELSSDKYEIPDDRKGEVLA
                     TAQRLREEDGADFAKDRHMEAALEELGLPVNKYDLPDADAGVGV"
     gene            29317..30066
                     /locus_tag="Hlac_0028"
     CDS             29317..30066
                     /locus_tag="Hlac_0028"
                     /inference="protein motif:PFAM:PF02230"
                     /note="PFAM: phospholipase/Carboxylesterase;
                     KEGG: hma:rrnAC1163 phospholipase/carboxylesterase"
                     /codon_start=1
                     /transl_table=11
                     /product="phospholipase/Carboxylesterase"
                     /protein_id="ACM55634.1"
                     /db_xref="InterPro:IPR003140"
                     /translation="MSRGPLHTGDDPHADEELVTAGTDIEAADAAVVLVHGRGATARS
                     IVEFGTEVAGDYDIALSPAASPPAVRETSGLSLLAPQAAANTWYPNSFLAPVADNEPG
                     RSSGLRAIGRAVETATDAGIPAECVLVGGFSQGACLASEFVARNPSQYGGLAALSGGL
                     IGESIDLDDYVSHAAAAVDGDPADALAGTPAFLGCSDVDPHIPEERVHETADVLAALG
                     GNVETRIYEGMGHGINEEETASVSEMVANLT"
     gene            complement(30107..32185)
                     /locus_tag="Hlac_0029"
     CDS             complement(30107..32185)
                     /locus_tag="Hlac_0029"
                     /inference="protein motif:PFAM:PF04293"
                     /note="PFAM: SpoVR family protein;
                     KEGG: hwa:HQ3000A spore cortext formation protein"
                     /codon_start=1
                     /transl_table=11
                     /product="SpoVR family protein"
                     /protein_id="ACM55635.1"
                     /db_xref="InterPro:IPR007390"
                     /translation="MRDERVEAKREAESLGVPAAEARALAERLGLEPYPVRYWIVDHD
                     EMNELIAYGGFQRRYPHWRWGMNYERQSKLDRHGLGKAFEIVNNDDPSHAFLQESNSP
                     ADQKAVITHVEAHADFFANNRWFGLYADRGKGGPNAAARLERNADRIAAIADRPEVDR
                     DEVERLIDAVSALEDTIDQHSPADAARSVDEPGVDEDVNGPDDDPLAAIEERIAELDL
                     SEEVRRDVFDDEWLEARGEGVEPEEPRPDVLAFLRDYGKRYDPESGKAVDREPWETTV
                     IDALREEAYYFAGQKSTKVMNEGWATYWESVMMGGEGFADPDEFLTYADHMSRVLGSP
                     GLNPYKLGFELWTHVELRAARRDVIDKLLRIEGVTPENFHSRIDLDEVAAALEPHPAI
                     AGAGPATLDELAELAADRDPRVDAEAVDRALSARDGESPGTDSDAGPDSGPDIERYPW
                     KLLTREGLAERHYVLSRPEHRNSLRNVSRETLTEQARYMFDVDRYATVDEALADVDRA
                     TGWDRMLEVRESHNDVTFIDAFLTDEFVREGNYFTYEYSRATEQHRVASVDADDVRKK
                     LLLRFTNFGKPTVVVLDGNFRNRGELLLGHRYNGVALDEESARETLKRVFELWGRPAN
                     LATIRVEYSDEAIRRAMRRGTEPEGKEVGVRFQYDGGEVTEHDLDPEIKARIAADEID
                     YDTKPDDWLA"
     gene            complement(32182..33564)
                     /locus_tag="Hlac_0030"
     CDS             complement(32182..33564)
                     /locus_tag="Hlac_0030"
                     /inference="protein motif:PFAM:PF04285"
                     /note="PFAM: protein of unknown function DUF444;
                     KEGG: hma:rrnAC1069 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF444"
                     /protein_id="ACM55636.1"
                     /db_xref="InterPro:IPR006698"
                     /translation="MGLTEDRERFREVGEKRREDLAEFISHGDLGGSDPDRVRIPVKI
                     VDLPEFKYDRREAGGVGQGESGQPQPGQPVEPKSDGDEEGDPGEEGGEHEYYEMDPEE
                     FARELDEELGLDLEPKGKRVVEEMEGDYTDTARAGPRGTLDVDEFFKRGLKRHLATDF
                     DEDYVREGLHVAGADVDDVFAWARNQGIPVSRAWIADAAATAADEHGEPVEALDRWVS
                     FDALDEDIDREPATHRIRREGLDSVPFRREDERFRHPEVIEKRERNVVVVNVRDVSGS
                     MRETKRELVERVFTPMDWYLTGKYDAAEFRYVVHDAEAWEVDRGEFFGIQSGGGTRIS
                     SAYELVAEILEEYPYSEWNRYVFAAGDSENAGSDTTESVMPLMESIDANLHAYVETQP
                     GGAAPNARHADEVEEALGNTGNIAVARVSEPGDVTDAIYEILSTEAEGDGAATAGEAA
                     SGLTDGGERR"
     gene            complement(33555..35996)
                     /locus_tag="Hlac_0031"
     CDS             complement(33555..35996)
                     /locus_tag="Hlac_0031"
                     /inference="protein motif:PFAM:PF08298"
                     /note="PFAM: PrkA AAA domain protein;
                     KEGG: hwa:HQ3002A serine protein kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="putative serine protein kinase, PrkA"
                     /protein_id="ACM55637.1"
                     /db_xref="InterPro:IPR013153"
                     /translation="MTERDTPDGDAFVRDADETLRGAYDPPMSLEEYVDRVLENPTAA
                     ASGARYLLAAVESQGTREVRERGERLERYRFFDDPFNDGEHAVLGNTAALNAFVDDLR
                     AAAAGRGNDETIVWIDGPTATGKSEFKRCLVNGLREFSKTEAGRRYTVEWNVTGAGTG
                     SGVGAGAASLSYGDGGDAAAWYRSPVQTHPLSVFPEAVRESIADAVDDDAYPIAADVD
                     LDPFSREAYDHLESVYRDEGRRDLFSAITDRDHLRVTSYVVDVGEGVGVLHAEDDGSP
                     KERLVGSWMGGMLRELDSRGRKNPQAFSYDGVLSQGNGVATIVEDASQHADLLRRLLN
                     VPDERRVKLDKGIGMDLDTQLIVISNPDLDAELDRHAEREGADPLKALKRRLTRHEFR
                     YLTNRRLEAELLRREVGGPRGVPTVDGIEDDEPIDTGENPARDPASEPSAASLTIGVR
                     DGDKGITERELAPHAVGAAALYAVVTRLDTDDLPAGIDLVEKAELYENGEIRRERSGE
                     EQRITVDDIEFGDGDGRNGIPVTYVRDIVAELLGSDADRSHPELPVERVITPTDVLDA
                     MAEALSDAPVFSRTEVAEFESRKAPVAERVRERQRADVVDAILAEETVPEATVAEYVE
                     HVYAWDAEVPVETERGPEEPDALAMKVFETETLGRFDESDYRGTDPTEPVGTFRRERV
                     IRALTRYAWRNRGNAFSVGDADLGEIPELKAVLESNDLADVKRRFPDLDPAEWADPPA
                     DTETERTKATTIARLVDRGYSPASAELTSRAVMRNVRDEWTSLTADGNTASEATPDRP
                     IEDRSGRNGGGRTWD"
     gene            complement(35998..38073)
                     /locus_tag="Hlac_0032"
     CDS             complement(35998..38073)
                     /locus_tag="Hlac_0032"
                     /inference="protein motif:PFAM:PF08298"
                     /note="PFAM: PrkA serine kinase; PrkA AAA domain protein;
                     KEGG: hwa:HQ3003A serine protein kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="putative serine protein kinase, PrkA"
                     /protein_id="ACM55638.1"
                     /db_xref="InterPro:IPR010650"
                     /db_xref="InterPro:IPR013153"
                     /translation="MPNRHTLERLSEEYRTNVPDDLREPRSFNWYLDALYEEPRIARN
                     AHQRVADMFDHYGTQYDEERGVVEYALAADDPLHDGENVFYGREVHEAIHEFVNKVKS
                     GARGLGPEKRIKLLLGPVGSGKSHFDWLVRRYFEAYTREDAGRMYTFRWVNLCSVIDD
                     QDPGDDTVRSPMNQDPLVLIPRPQREGVIDELNERLDAPYTLRNDQHPDPASEFYLNE
                     LLAHYDDDLQRVLDNHVEVVRLVADENRRECIETFEPKDKKNQDETELTGDVNYAKLA
                     VYGESDPRAFDYAGAFCNANRGLFSGEELLKLQREFLYDFLHASQESTIKPKNNPRID
                     IDQVIVGRTNMPEYREKTGDEKMEAFNDRTKRIDYPYVLEYESEAKIYEKMLNNADVP
                     NVHVEPHALEMAGLFGVLTRLEEPADETVSLLDKAKVYNGELEDEEIDRRKLREDAAE
                     SADVGEGMDGISARFVGDEIAEAIMDATHRDRSYLSPLSVFDHFEANLGGHGSIAEAD
                     LDRYERLLETVREEYRERAIEDVRHALAYDVDELRRQGEKYMDHVMAYIDDATVDDEL
                     TGRETEPDETFLRAVEEQLDVPSDRKDDFRQEVSNWVSRRAREGRGFDPRENDRLRRA
                     LERKLWEDKKHNINFSALVSATDLDDEERSAWVDALVDRGYSEDGAAEVLEYAGAAVA
                     RSEIENGGD"
     gene            38462..39142
                     /locus_tag="Hlac_0033"
     CDS             38462..39142
                     /locus_tag="Hlac_0033"
                     /inference="protein motif:PFAM:PF06267"
                     /note="PFAM: protein of unknown function DUF1028;
                     KEGG: hsl:OE4714F hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF1028"
                     /protein_id="ACM55639.1"
                     /db_xref="InterPro:IPR010430"
                     /translation="MTFSICVRERYTDDDGDDQIRYGVAVTTRLPGVGTLCPFASADG
                     AVATQSLVNVELGRKGIAYLGDGLAVDDALESLLNADEGKSQRQLHGVDADGTFAFSG
                     EECNDWYGHVVGENYTVAGNLLTGEDVIDDVAAAYESDAHGEAPLAERLIDALAAGHE
                     AGGDKREDLKVQSAALQVTNTDEATDDPYYNDLRIDASETPIDDLRETYETAKRGYET
                     VMEKYADE"
     gene            complement(39163..40005)
                     /locus_tag="Hlac_0034"
     CDS             complement(39163..40005)
                     /locus_tag="Hlac_0034"
                     /inference="protein motif:PFAM:PF03372"
                     /note="PFAM: Endonuclease/exonuclease/phosphatase;
                     KEGG: hma:rrnAC3397 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Endonuclease/exonuclease/phosphatase"
                     /protein_id="ACM55640.1"
                     /db_xref="InterPro:IPR005135"
                     /translation="MTAIRVLSYNVRYANRDDHHDAWHDRRDAVGRLVRFHRPDVAAF
                     QEPLPGQRRDLRERLSEYEFVGRGREADDEGESCPIAVRTDRWEVVDDDTFWLSETPS
                     EPSTDWGADYPRIATWARVRAIDGDAALLVVNTHFDHVSAHARRESARLLCQRLPDVA
                     GPDAGESDETIPVVLVGDFNCTSGSDPHRILVGDDPTAETDTAPIDDSGIALRDAATA
                     ADLRHGPETSLTDFARLIDGRRIDHALVSPEVGAEAFATLTDRDDRGRYPSDHLPVLA
                     RLAL"
     gene            complement(40168..40650)
                     /locus_tag="Hlac_0035"
     CDS             complement(40168..40650)
                     /locus_tag="Hlac_0035"
                     /inference="protein motif:PFAM:PF01472"
                     /note="PFAM: PUA domain containing protein;
                     KEGG: hma:rrnAC2087 PUA domain-containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="PUA domain containing protein"
                     /protein_id="ACM55641.1"
                     /db_xref="InterPro:IPR002478"
                     /db_xref="InterPro:IPR004521"
                     /translation="MEVKSRHHLRSDDITAIREAVADHLGVDIDGDTFEFVEFVDANY
                     ELVLVDGEPAVFYVDDDEPFLTVRGANDYEPETGIVTVDAGAISFVSGGADVMRPGIV
                     EADSAIREGDLVVIAEETHEKVLAVGRALVDGDNMVGDSGKVVESIHHVGDELYEFSG
                     "
     gene            40700..40819
                     /locus_tag="Hlac_0036"
     CDS             40700..40819
                     /locus_tag="Hlac_0036"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACM55642.1"
                     /translation="MVAVAEGAAVADDVAVAENVAVVRSTVGTFMQLDRSKRP"
     gene            40843..41445
                     /locus_tag="Hlac_0037"
     CDS             40843..41445
                     /locus_tag="Hlac_0037"
                     /inference="protein motif:PFAM:PF00111"
                     /note="PFAM: ferredoxin;
                     KEGG: hwa:HQ1076A ferredoxin (2Fe-2S)"
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin"
                     /protein_id="ACM55643.1"
                     /db_xref="InterPro:IPR001041"
                     /translation="MLNPLITTIVNPTAIVVAVIATLLVVLVSSLKGRGWEPATDISD
                     EVLQRRAAAVPETEFPEPGNRSIGGGGGGGAIPAGGEGEEGELEDGAAGGSGPGDIPE
                     DEVEYFEVEFVKQGETVELSNNEPILDQGEDQGWDLPYACRQGQCVSCAGRIADGPSE
                     DFVEHDNQQMLEDAEIEDGYTLTCVAYPRGSFSIETGEAP"
     gene            41554..41880
                     /locus_tag="Hlac_0038"
     CDS             41554..41880
                     /locus_tag="Hlac_0038"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACM55644.1"
                     /translation="MSLITALGAGAAALLAAVAAALVYRDAGRVGVDLGSPRLWAAFV
                     IVTSGISVITVLLVPDAPLPGVLVIAALGPLLYLLERDDSMHGDGPADPTRLPSDGDE
                     PERPDE"
     sig_peptide     41554..41613
                     /locus_tag="Hlac_0038"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.471 at
                     residue 20"
     gene            42002..42328
                     /locus_tag="Hlac_0039"
     CDS             42002..42328
                     /locus_tag="Hlac_0039"
                     /inference="similar to AA sequence:KEGG:HQ3107A"
                     /note="KEGG: hwa:HQ3107A NifU domain-containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="NifU domain-containing protein"
                     /protein_id="ACM55645.1"
                     /translation="MSDESLADRVEKWMVGQMPIIQMHGGTSVVREADAETGEVVVEL
                     GGTCSGCGISNITADNIRRDLIMDFDEVENVTVRSASSGDQGASTVEGGRGGELKHET
                     ESANHF"
     gene            complement(42396..43853)
                     /locus_tag="Hlac_0040"
     CDS             complement(42396..43853)
                     /locus_tag="Hlac_0040"
                     /inference="protein motif:PFAM:PF04167"
                     /note="PFAM: protein of unknown function DUF402;
                     KEGG: hma:rrnAC2113 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF402"
                     /protein_id="ACM55646.1"
                     /db_xref="InterPro:IPR003029"
                     /db_xref="InterPro:IPR007295"
                     /translation="MKARVRGIYATALTEALLDAGHEVVGASTPIRRRFDAEFESAPP
                     DARIATTEDRQGVGAHGDPDAIGTLRGLLTDTGLDALAWTDPTPPGTVCDGTVTETLG
                     GGAVVRLRVGGGESEGDATTEGYLPYGSVDDRIETGDPVRVQVRESAAPWTDRRPELD
                     GSLRAGGGLVTLEPGSGTRVDARNDKDARELSGMLDLLGLKPPEGWRAVWKPPAVDAD
                     TEELQAGLDRAVAAVEGLDDAVDAAGGAGVLDGSDSVREEPLTRPNAGVWVWFGRESR
                     FALDDRRREATATMPGHHRVKAGSADASSGVDLAEALCEPDADASFPFGVVTDAFGPA
                     EGDALRLEHGKPDGRLITLGEATVTTVDADGSVAVEREMTGGGSYDGLDVPREAGDIA
                     ETSLKEGRWWYPTTYRGRDGTVRGTYVNVCTPVEVFPDAARYVDLHVDVMKHPDGTVE
                     RVDDDELRDAEAAGDVPEPLAEKARSVASALENAL"
     gene            complement(43850..44272)
                     /locus_tag="Hlac_0041"
     CDS             complement(43850..44272)
                     /locus_tag="Hlac_0041"
                     /inference="similar to AA sequence:KEGG:NP0752A"
                     /note="KEGG: nph:NP0752A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55647.1"
                     /translation="MHFDARTQRALREAGLDTDAIAAASDRVAELVDEDADSLREFFA
                     PAGHYYSDMEMAHSATERQEHATADVDLFTHGSDLRGYLSLEGWGVPIEGGRVLRTAE
                     TGGDDEEGDNDETPVLVELSLGATVHDRVRFARDPDEL"
     gene            44396..45406
                     /locus_tag="Hlac_0042"
     CDS             44396..45406
                     /locus_tag="Hlac_0042"
                     /inference="similar to AA sequence:KEGG:HQ1397A"
                     /note="KEGG: hwa:HQ1397A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55648.1"
                     /translation="MPSRSDPVESRADDDRDLYDIATWEERTSLDGLSVALHWLITRS
                     AKAIVVFVALLGLLAILGSFGLGLVFDPAVGMLVGLSAIPALGLAAYVYVSDVTTGEP
                     LSLLVATFLLSILTATFAALLNSVAQPYFQPFGFPGLVLFFFAIVGPIEESVKLLAVR
                     LYAYTDDRFDAVIDGAVYGAIAGLGFVVIENLVYIAQTVDLGELSLSIATLGAGDGIA
                     ALRALAGPGHVIYSAFAGYYLGLAKFNPGNRGPIVVKGLIIAAAIHALYNTLVGPVTT
                     VLSVATGLPQLVSLFVFVLLFQGAFAYVLLRKLRRYRDAYLETRDAVDPDVKPEMTEF
                     ED"
     gene            complement(45462..46442)
                     /locus_tag="Hlac_0043"
     CDS             complement(45462..46442)
                     /locus_tag="Hlac_0043"
                     /inference="protein motif:PFAM:PF00480"
                     /note="PFAM: ROK family protein;
                     KEGG: hma:rrnAC0547 glucokinase"
                     /codon_start=1
                     /transl_table=11
                     /product="ROK family protein"
                     /protein_id="ACM55649.1"
                     /db_xref="InterPro:IPR000600"
                     /translation="MYYVGVDLGATNVRAVVGDETATVLGSDSRGTPSGPNGIAVTEA
                     VLGVVRGACEDAGIDPTAVVAAGIGSIGPLDLAAGIVQGPANLPDTVERIPLIGPVSQ
                     LLDTDEVHLHNDTIAGVIGERFHSERNPDDMVYLTISSGIGAGVAVDGNVLSGWDGNA
                     GEVGHMTVDPHGFMTCGCGLDGHWEGYCSGNNIPKYARELHEEDPIETSLPIEDPDFS
                     AVDVFEAAGEDTFADHVIAQVAHWNAMGVANVIHAYAPLVVSVGGAVALNNPELVLDP
                     IREKLADMVFINVPEVRLTELGDDVVVKGALASALTGGTGDRSRVDPPPR"
     gene            complement(46564..47019)
                     /locus_tag="Hlac_0044"
     CDS             complement(46564..47019)
                     /locus_tag="Hlac_0044"
                     /inference="protein motif:PFAM:PF00582"
                     /note="PFAM: UspA domain protein;
                     KEGG: hma:rrnAC0561 universal stress protein"
                     /codon_start=1
                     /transl_table=11
                     /product="UspA domain protein"
                     /protein_id="ACM55650.1"
                     /db_xref="InterPro:IPR006015"
                     /db_xref="InterPro:IPR006016"
                     /translation="MSIKKVMLAVGTEDEERTERLAEEAIAVAEPAGAEVVLTHVFTD
                     EEFDTVRSRLGVDETSEGSTPDAVAERHTTTRALSEALTEAGVSHSVRGAVGDHADEV
                     VEAASAIGADRVVVGGRRRSPTGKAVFGSVAQEVLLSSPCPVTFVRSAS"
     gene            complement(47168..47536)
                     /locus_tag="Hlac_0045"
     CDS             complement(47168..47536)
                     /locus_tag="Hlac_0045"
                     /inference="similar to AA sequence:KEGG:OE4712F"
                     /note="KEGG: hsl:OE4712F hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55651.1"
                     /translation="MRRGEHLDDRMPDLKGSIEEYFGEVTDTEEWQDHELYVVEDPDN
                     PVFDRIVAGATKYGSKKDKLAVHFEERPAEDVIAEGNADAAADAVDAKNEFLLEATGR
                     DAKSRRESLKREVEDDAPDY"
     gene            complement(47675..48769)
                     /locus_tag="Hlac_0046"
     CDS             complement(47675..48769)
                     /locus_tag="Hlac_0046"
                     /inference="similar to AA sequence:KEGG:HQ3110A"
                     /note="KEGG: hwa:HQ3110A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55652.1"
                     /translation="MGLRCLLGHDFGEPELRREREEDGNEVVTTVTEVKTCARCGETQ
                     VVSENTEVTTMKQLTDEATVVGDEPTGPDADSDRETPVTGVEGTGPDGDIDGDDAVII
                     GNSPEDGDDTADIPAEPGAADARTPETKPGDTTASESETEADVEAGAAGDDGGAELID
                     EGPSGAGDDDSNGSLERDDGEYAAYPEAETTEPTADEERAETDDGVILDEEGEDADDR
                     ERGAWPDVDESDEGGEEPTPWPEHGGEDEGFSAELDDGNTGDVEFGGGLTPEAADQPT
                     DGEDADYVEAPAQTAVEANGAAETGSAVDDGVGITRGDSPDLETSTSEVTTEYYCPEC
                     EMTRAADGNSMRAGDICPECKRGYVDERPI"
     gene            48991..49305
                     /locus_tag="Hlac_0047"
     CDS             48991..49305
                     /locus_tag="Hlac_0047"
                     /inference="protein motif:PFAM:PF00111"
                     /note="PFAM: ferredoxin;
                     KEGG: nph:NP4918A ferredoxin I 4"
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin"
                     /protein_id="ACM55653.1"
                     /db_xref="InterPro:IPR001041"
                     /translation="MPTVSYQGEEIECEEGAILRDVLKEAGLSVYNGRAEQFNCRGTG
                     SCGTCAVQVDGAVSEPGKKEKARLWLPPHHPSHDVRLACQTRVEGDVEVRKGRGLWGQ
                     HI"
     gene            complement(49494..49688)
                     /locus_tag="Hlac_0048"
     CDS             complement(49494..49688)
                     /locus_tag="Hlac_0048"
                     /inference="protein motif:PFAM:PF00313"
                     /note="PFAM: Cold-shock protein DNA-binding;
                     SMART: Cold shock protein;
                     KEGG: hwa:HQ1268A cold shock protein"
                     /codon_start=1
                     /transl_table=11
                     /product="cold-shock DNA-binding domain protein"
                     /protein_id="ACM55654.1"
                     /db_xref="InterPro:IPR002059"
                     /db_xref="InterPro:IPR011129"
                     /translation="MATGKVDFFNDTGGYGFIETDDADDDVFFHMEDVEGPDLEEGQE
                     LEFDIESSPKGPRASNVVRQ"
     gene            49902..50417
                     /locus_tag="Hlac_0049"
     CDS             49902..50417
                     /locus_tag="Hlac_0049"
                     /inference="similar to AA sequence:KEGG:NP1836A"
                     /note="KEGG: nph:NP1836A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55655.1"
                     /translation="MFRSLRENGPGLLVPAAWTVVAATVLGVISTRALFVAHVVMSVL
                     LVAFVAASWRDMSDGVLRAWKLVILAGTPVTLAGVAGFLAFGDTFGVPPDALLAVSLF
                     GWALLPAAGFAYTRSRVEEGARIYDVGAACCVAGTVGIALAPSATWTAAALAVVGAGQ
                     TAGILDATLRY"
     sig_peptide     49902..49970
                     /locus_tag="Hlac_0049"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.714) with cleavage site probability 0.445 at
                     residue 23"
     gene            50487..50792
                     /locus_tag="Hlac_0050"
     CDS             50487..50792
                     /locus_tag="Hlac_0050"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: hsl:OE3839F hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACM55656.1"
                     /translation="MIDPGLLYLAVIGALLLVALGLGVRVLWDIVGDAREIRRRRRSG
                     GLEPYTEDEEHDRVPRDPVEDDGDDGRASATCPQCGADNDPAFTYCRRCVSPLPPDE"
     gene            50898..51791
                     /locus_tag="Hlac_0051"
     CDS             50898..51791
                     /locus_tag="Hlac_0051"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACM55657.1"
                     /translation="MHREFREWVDFGADGRAPESVSIDYRPDAMASVVEDQSERIDRL
                     WESAKRERPGLFDAPGFRLLEASDTGIVVGPAQFKQHFVRRLLLSDSLETSATRLRDE
                     LEESIRYLSSMVAIVAGDDLLIGVKRRTDSNFLSLPGSGYLDRNGDMRAGELCPTAEI
                     VAREVYEETGLEDLDRIRCFGIFEDLHPESHLNPALFSIITTSRSSDHVLDRIDRAED
                     ADEFDRFLAVPLRPDALSALIRTDTNDAELPVAAPKLEGDLNGISDKTLLMLLLIGRN
                     RFGRDWFQRELANSSVVLVRK"
     gene            complement(51841..52593)
                     /locus_tag="Hlac_0052"
     CDS             complement(51841..52593)
                     /locus_tag="Hlac_0052"
                     /EC_number="3.1.3.25"
                     /inference="protein motif:PFAM:PF00459"
                     /note="PFAM: inositol monophosphatase;
                     KEGG: glo:Glov_0416 inositol-phosphate phosphatase"
                     /codon_start=1
                     /transl_table=11
                     /product="inositol monophosphatase"
                     /protein_id="ACM55658.1"
                     /db_xref="InterPro:IPR000760"
                     /translation="MSEYLSVAIEAAKIAGEYQRNQFEEITEHDYKSPGNPVSGVDHR
                     SEALIVERLSSSFPDHTILSEESGMMGDHETKWIVDPLDGTSNYLRGLPDFTVSIGLS
                     VGGETELGVVYRPVSDELFAASKRSEPPDEAVTLGVSDRDAIEEALVAIPYSSRNKDR
                     DRVWETHRYFGSQVEGLRSTGSGALDLANLASGVTDIVYAFDQSEWDRTAGRFLVEIA
                     DGVVTGHDGGATSTGDFVASNEKLHERATDLK"
     gene            complement(52649..53089)
                     /locus_tag="Hlac_0053"
     CDS             complement(52649..53089)
                     /locus_tag="Hlac_0053"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACM55659.1"
                     /translation="MGEIEYPHVELIVTNYTRLSEESQYRDDLLIRANYFSLAVIAVL
                     IGTLLQASPVVRPLVAMAGVAIAYSFWLATESYKGARDVLNDSMRRTETQFEELSVVE
                     DYDTRSRSQIEKRSLSSYFIGLQMTTTFVWLVLYALLVTEFVYL"
     gene            53180..54352
                     /locus_tag="Hlac_0054"
     CDS             53180..54352
                     /locus_tag="Hlac_0054"
                     /inference="protein motif:PFAM:PF01609"
                     /note="PFAM: transposase IS4 family protein;
                     KEGG: hsl:OE5225R transposase (ISH3)"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS4 family protein"
                     /protein_id="ACM55660.1"
                     /db_xref="InterPro:IPR002559"
                     /translation="MFTIPDPDEYLSASDVKDVAEEVITPLPLPGVEGSPLDPGDIWL
                     VVILACTNQNSIWDTCNDTEGTPCDDTVLRWLHTLNRQWLEVVANLLLARLAMTIFDP
                     DRSRTVSIDFIDNPYHGEHHAEKGELCSMAPKDGTTTCHRYCTAYVVSNGKPVTLAMT
                     YVRSDEDEADAVERVLARVENYPFEIDLLLADSGFYNERVIRRARDIAPTVVHVPKKG
                     ERMKDKLETHKSYMTTYRMYKDSERELRFPLAVAVSYQNGDRGKHGEVVRGYVACGVT
                     DRSAKQVEHRYRKRSGIETTYRLLRQARGITTTRDPVVRFAIMLVAALLENLWLVLRW
                     AVVARPRRGGRDLPEEFTFKTFCDWIRHELEEELRRRWKIKANGVGVPASQATAAG"
     gene            complement(55031..55651)
                     /locus_tag="Hlac_0055"
     CDS             complement(55031..55651)
                     /locus_tag="Hlac_0055"
                     /inference="protein motif:PFAM:PF02987"
                     /note="PFAM: Late embryogenesis abundant protein;
                     KEGG: hit:NTHI1667 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Late embryogenesis abundant protein"
                     /protein_id="ACM55661.1"
                     /db_xref="InterPro:IPR004238"
                     /translation="MKRPSLKDQFGESESSVDDQIREAIVEALSANDKVIEIRPAKRS
                     KGMRLKRLLLLGAAAIAFAYWVQNSQKPNNLIKGVKEKTANRIHQTAESIEKGSESAS
                     ERIEESSERASEAVHEAAEKASDKAEEAGEKVSDKAEEAGEKASEKAEEAGEKASDKA
                     EEAGEKASDKAEESGEEVVERMVKGDKKTSDETDSDDSDDSDSSEK"
     gene            complement(56281..56354)
                     /locus_tag="Hlac_R0006"
                     /note="tRNA-Phe2"
     tRNA            complement(56281..56354)
                     /locus_tag="Hlac_R0006"
                     /product="tRNA-Phe"
     gene            complement(56692..56762)
                     /locus_tag="Hlac_R0007"
                     /note="tRNA-Pro3"
     tRNA            complement(56692..56762)
                     /locus_tag="Hlac_R0007"
                     /product="tRNA-Pro"
     gene            complement(56851..58905)
                     /locus_tag="Hlac_0056"
     CDS             complement(56851..58905)
                     /locus_tag="Hlac_0056"
                     /inference="protein motif:PFAM:PF00270"
                     /note="PFAM: helicase domain protein; DEAD/DEAH box
                     helicase domain protein;
                     SMART: DEAD-like helicases;
                     KEGG: hwa:HQ3065A superfamily II helicase"
                     /codon_start=1
                     /transl_table=11
                     /product="DEAD/DEAH box helicase domain protein"
                     /protein_id="ACM55662.1"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014021"
                     /translation="MSQQLAEVETLFLHEARSDYTVVATRDGNRILRGRLELKETSAG
                     PRPGKFRVIRDGEDHPRQPGEFVDLARAAGRIRISEQTSPKNRKRLQAMLDGYQLEAM
                     AVRTCRRCANDGRYGPITSDGAIEHNDELICRDCARRELERELSYKGEFTGAAEERLE
                     ELLYESGDLDRIVNLLQGGLDPDLTKYDEVSANVDDISPVRTEDLDLHPDLSAHLQGR
                     FEELLPVQSLSVRNGLLDGTDQLVVSATATGKTLVGELAGIDRALKGDGKLLFLVPLV
                     ALANQKHEDFKDRYGDRLNVSIRVGSSRVNDDGNRFDPNADVIVGTYEGIDHALRTGK
                     DLGDIGTVVIDEVHTLKEGERGHRLDGLISRLKYYSENRMETHEGYGGTQFVYLSATV
                     GNPEWLAEKLRATLIEYEERPVPIERHVTFADSREKAQIADKLVKREFDTKSSKGYRG
                     QTIIFTNSRRRCHEISRKLRYDSAPYHAGLDYKRRKKVERQFGNQDLSAVVTTAALAA
                     GVDFPASQVIFDSLAMGIEWLSVQEFSQMLGRAGRPDYHDRGRVYLLVEPDGVYHNSM
                     DRTEDEVAFTLLKGEMEDVATHYDETAAVEETLANVVVAGKKAKRLNDRMIGEVPTKH
                     AVGKLLEWKFIDGFSPTPLGRGITRHFLAPDEAFFMLDAIRKGTDPYQIVADLELRDD
                     EE"
     gene            complement(59022..59552)
                     /locus_tag="Hlac_0057"
     CDS             complement(59022..59552)
                     /locus_tag="Hlac_0057"
                     /inference="protein motif:PFAM:PF00252"
                     /note="PFAM: ribosomal protein L16;
                     KEGG: hsl:OE1160R ribosomal protein L10.eR"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal protein L16"
                     /protein_id="ACM55663.1"
                     /db_xref="InterPro:IPR000114"
                     /db_xref="InterPro:IPR001197"
                     /translation="MSDKPASMYRTIDKPSYTRREYITGIPGSKIAQHNMGDLSAEPD
                     DYPVQISLRVEEELQIRHGSLESSRLSANRHLIKELGEGNYKMTLRKFPHQVIRENKQ
                     ATGAGADRVSDGMRQAFGKPVGTAARLNKDDIVFTAYCDVEQASVVKEAFRRAYNKLS
                     PPCRITVDRGEELLVS"
     gene            complement(59697..60437)
                     /locus_tag="Hlac_0058"
     CDS             complement(59697..60437)
                     /locus_tag="Hlac_0058"
                     /inference="protein motif:PFAM:PF01939"
                     /note="PFAM: protein of unknown function DUF91;
                     KEGG: hwa:HQ1390A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF91"
                     /protein_id="ACM55664.1"
                     /db_xref="InterPro:IPR002793"
                     /translation="MTVTSVHDPSHREALWELEDAFEGGDLISLFGRCTVSYEGRAAS
                     DLGAGDRLLVLKPDGAALVHTDEGRQPVNWQPPGSEHHAAVREGQLRVRSTRSNPDET
                     LTVRFSDIHQLSAMAVTGGRDLTLHGSEEDLRTRILERPELVEPGFEPRETERPSSAG
                     PMDVFGVDADGDPVVVELKRRRVGPDAVGQLARYVRALRAELGAEEGADTPVVRGVLV
                     APSVTDRAAERLADRGFDHVALDPTPEE"
     gene            complement(60774..62063)
                     /locus_tag="Hlac_0059"
     CDS             complement(60774..62063)
                     /locus_tag="Hlac_0059"
                     /EC_number="3.3.1.1"
                     /inference="protein motif:TFAM:TIGR00936"
                     /note="TIGRFAM: adenosylhomocysteinase;
                     PFAM: S-adenosyl-L-homocysteine hydrolase;
                     S-adenosyl-L-homocysteine hydrolase, NAD binding;
                     KEGG: hma:rrnAC2840 S-adenosyl-L-homocysteine hydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="adenosylhomocysteinase"
                     /protein_id="ACM55665.1"
                     /db_xref="InterPro:IPR000043"
                     /db_xref="InterPro:IPR015878"
                     /translation="MSETAYSPVSQHLSDIETAREEGRRKMDWALQHMPILNALREEF
                     VNEQPLAGETIAMAMHVEAKTANLVELLADGGAEVAITGCNPLSTHDDVSAALDTHES
                     ITSYAVRGVDDEEYYDAMHACIAHDPTITVDDGMDMVKLVHEEYPDLIDSIIGGAEET
                     TTGVHRLRAMDADGELHYPVFAVNDTPMKQLFDNVHGTGESSLATIAMTTNLSWAGKN
                     VVVGGYGQCGKGVAMKASGQNANVIVCEVDPRKALEAHMEGYEVLPMVEAAKKGDVFI
                     TTTGNRDVITREDFEEMQDGVLLANAGHFDVEVNLDDLDDLAVDRFEARDGVEGFEMA
                     DGRVLNVLAEGRLVNLAAPISLGHPVEVMDQSFGVQAVVVRELAANGESYEPGVHDVP
                     DDLDREVAEIKLDAEGVEHDALTDEQREYMGSWEHGT"
     gene            complement(62166..63548)
                     /locus_tag="Hlac_0060"
     CDS             complement(62166..63548)
                     /locus_tag="Hlac_0060"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: hma:rrnAC2838 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACM55666.1"
                     /translation="MSKHTIGLLLIAVVALGAMTGVAAAEGDLGVTVDDADGEPTVTV
                     TENGTAVENATVNVSVVDPANESYAGASEYTTDANGTVGLSTPEEDVTVNVTAEYEND
                     STTTTIDLEAPDGLVIDVESTDGEPVVTVTDNDTAVENASVNVTTADGQNVTYADEGD
                     YETDENGTVTLSAAEEDVTIDVTATDENESVSTTVDLETPEGLALDVSNTDGEPVVTV
                     TDDDEAAENASVNVTTADGQNVTYVGEGSYETDENGTVTLNAAEANVTVDVTAGYEND
                     TVSTTVDLTVDGGEAEDQSFGQLVQDFIDRLQDREGGIGAAVSDFVTENNPGNAPDHA
                     GSPSGPDDAGNGSDADNGRNAGNASDGPGNAPDHAGQGNGNDGEQGPPDHTGQGNGND
                     GEQGPPDHAGPDGDDGDDTKEDDTDDADDADKSGEEGEDGAEDDDDDGNAGNGPGNGN
                     GQGNGNGPQN"
     sig_peptide     complement(63474..63548)
                     /locus_tag="Hlac_0060"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.612 at
                     residue 25"
     gene            complement(64231..65565)
                     /locus_tag="Hlac_0061"
     CDS             complement(64231..65565)
                     /locus_tag="Hlac_0061"
                     /inference="protein motif:PFAM:PF01979"
                     /note="PFAM: amidohydrolase; Amidohydrolase 3;
                     KEGG: hsl:OE4157F putative chlorohydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="amidohydrolase"
                     /protein_id="ACM55667.1"
                     /db_xref="InterPro:IPR000169"
                     /db_xref="InterPro:IPR006680"
                     /db_xref="InterPro:IPR013108"
                     /translation="MNTLRVTGGRVLRPDGRVTESDVTIDRDAGTIVAVGDETVSDAE
                     AGSDAEVASDGETLDASGSLVIPGLVNAHTHVAMTLLRGYADDKPLDPWLREDIWPAE
                     AELTPDDIEAGAELGVVEMIRSGTTAFADMYFAMDRVADVVDRAGLRARLGHGVVTIG
                     KDAEGARADVEESLAVARELDGAGDGRIRTAFMPHSLTTVGEEYLHEGVAEAREAGVP
                     IHLHANETEDEVDPIVDERGERPIAYAQDLDALGPDDFFAHGVHLDGSEIDQIADAGT
                     AIVHCPASNMKLASGMAPVQRLRDAGVTVALGTDGAASNNDLDVFDEMRDAAMLGKLA
                     ADDATAVPAEAVVEMATAGGADALGLPGGRIEPGAAADLAVVDLDAPHLTPVHDPVSH
                     LAYAAHGSDVRHTVCDGEVLMRDREVLTLDAERVQERAATAASDLVDRVSES"
     gene            65682..66035
                     /locus_tag="Hlac_0062"
     CDS             65682..66035
                     /locus_tag="Hlac_0062"
                     /inference="protein motif:PFAM:PF04036"
                     /note="PFAM: Protein of unknown function DUF372; Protein
                     of unknown function DUF381;
                     KEGG: hsl:OE1207R hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Protein of unknown function DUF372"
                     /protein_id="ACM55668.1"
                     /db_xref="InterPro:IPR007179"
                     /db_xref="InterPro:IPR007181"
                     /translation="MTTDAQQACFEAGIKFGSLYHQFAGTPVSPASARSLEAAMAEAI
                     ENQPFCESVTVEIHDDRVADAIDHENGYTELTGSLMDVEMQIAYEGIEVRTRMAMRDG
                     YPLMELVSVEAAKSD"
     gene            complement(66270..66815)
                     /locus_tag="Hlac_0063"
     CDS             complement(66270..66815)
                     /locus_tag="Hlac_0063"
                     /inference="similar to AA sequence:KEGG:OE4296F"
                     /note="KEGG: hsl:OE4296F hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55669.1"
                     /translation="MVRTEPNGSDTDDAQRRAQTVKQSKAGLQQTIADMKAMAADREE
                     AGYETLTVAAGDTTPKTPDTGESDEWGLSYVVPSNVEDEFVALYDRASFDEIGVYQAD
                     AEGIRFIVTEYLDHDEQIAVFIAGTFRLQFAAPLARTALDRGHMYTHVKKLDGTHLGS
                     IDHDDPDAFFPDPESVYAYER"
     gene            complement(66856..67254)
                     /locus_tag="Hlac_0064"
     CDS             complement(66856..67254)
                     /locus_tag="Hlac_0064"
                     /inference="similar to AA sequence:KEGG:HQ1476A"
                     /note="KEGG: hwa:HQ1476A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55670.1"
                     /translation="MQTASSFARISEFAIWVGAASTVVVVACATVAYAFGDGLLTLKY
                     VLFVVGFALFGLGGLAIQPKAKRRDRKRVSFDTEQEWEIEARLAQLPPLRGMTIPFEK
                     RVSRNVKMFATSLVVLAVSLSLEVVAGVSV"
     sig_peptide     complement(67150..67254)
                     /locus_tag="Hlac_0064"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.926) with cleavage site probability 0.769 at
                     residue 35"
     gene            complement(67238..68572)
                     /locus_tag="Hlac_0065"
     CDS             complement(67238..68572)
                     /locus_tag="Hlac_0065"
                     /inference="protein motif:TFAM:TIGR01727"
                     /note="KEGG: hsl:OE4301R dipeptide/oligopeptide/nickel ABC
                     transporter ATP-binding protein;
                     TIGRFAM: oligopeptide/dipeptide ABC transporter, ATPase
                     subunit;
                     PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
                     transporter domain protein;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="oligopeptide/dipeptide ABC transporter, ATPase
                     subunit"
                     /protein_id="ACM55671.1"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010066"
                     /db_xref="InterPro:IPR013563"
                     /db_xref="InterPro:IPR017871"
                     /translation="MSNAVEQSSPTEESEVLVEVEGLKKYYGGDGLFADPPVKAVDGV
                     DFEIRRGETLGLVGESGCGKSTLGRTLLALERATEGSIVYNGTDVTTLSGTELKEWRK
                     NAQMVFQDPESSLNDRMTVGEIIREPLDAHDWKTMNDRRERVLDLLSAVGLPDKHYFR
                     YPHQFSGGQRQRIGIARALALEPDFLVLDEPVSALDVSVQAKIISLLEDLQEEFNLTY
                     LLIAHDLSVVRYISDRVAVMYLGKIMEMGEAEELFTDASNPYTQSLLSAIPEPDPTET
                     SRRITLSGTPPSPSDAPPGCNLSTRCPAKIKPEAYANLDSDLWNAIEQFREVVRERAR
                     ITLSTSDRVRRRFDRFERFDDIEESMADTFDDLEVPERVDEQIRTAVEMVKRGRPTEA
                     QEHLYDEFASVCDREPPEMHKVSASGRYSYCHRHTDEYEDVGPVITRRADSE"
     gene            complement(68569..69657)
                     /locus_tag="Hlac_0066"
     CDS             complement(68569..69657)
                     /locus_tag="Hlac_0066"
                     /inference="protein motif:TFAM:TIGR01727"
                     /note="KEGG: hwa:HQ1478A ABC-type
                     dipeptide/oligopeptide/nickel transport system, ATPase
                     protein I;
                     TIGRFAM: oligopeptide/dipeptide ABC transporter, ATPase
                     subunit;
                     PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
                     transporter domain protein;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="oligopeptide/dipeptide ABC transporter, ATPase
                     subunit"
                     /protein_id="ACM55672.1"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010066"
                     /db_xref="InterPro:IPR013563"
                     /db_xref="InterPro:IPR017871"
                     /translation="MSQPQNTTAEATEGREDPILSVRDLQTVFYTDNETIRAVDSISF
                     DVGRGETVGIVGESGSGKSVTARSIMGLIESPGKVLPGSSISFDGQELTDLSEKQYQS
                     IRGSGIGMVFQDPQQSLNPVYTVGNQIRESLAINRDITGEKATTEATRLLRAVGIPDA
                     KRRLDEYPHEFSGGMRQRAVIAMMLACDPDFLICDEPTTALDVTIQAQILELLKELQE
                     ERGLSILFITHDMGVVADIANRVNVMYAGQIVEKATVEDLFANPQHPYTRALLRSIPG
                     EHSRADGLETIEGQVPTPNEPADHCRFAPRCSKAFDACENVPPQHVPVGDSEDHTASC
                     LLYPDDLSETARVERHVERATERTEEHS"
     gene            complement(69657..71090)
                     /locus_tag="Hlac_0067"
     CDS             complement(69657..71090)
                     /locus_tag="Hlac_0067"
                     /inference="protein motif:PFAM:PF00528"
                     /note="PFAM: binding-protein-dependent transport systems
                     inner membrane component;
                     KEGG: hwa:HQ1479A ABC-type dipeptide/oligopeptide/nickel
                     transport system, permease components II"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport systems
                     inner membrane component"
                     /protein_id="ACM55673.1"
                     /db_xref="InterPro:IPR000515"
                     /translation="MFVLIAVEFATWAGIAVGMLDALVLGVTAVIEIALSYVTPGLAQ
                     VVIDFQTGAVGMLRDVGGTLGELPTLFGRELIPNQGHQTPDGSWQGTFLGLQPAVAWA
                     IRFSLIIAYALFTAYWVFRGWLVYREHYREADWTPTDDIVDNLRGHRWGQFGLIVLIV
                     FLTMATFGSALAPSTVDQNIQSPYAEENQIQYLSEEGTVETVFAGDANFNSKSKGAVE
                     TNVGVMSYDDYSRFHPFGTLPNGRDLFTFMMGGARITMIVSGMAITGAAGVAMTLSML
                     SAYYRGSLDLGVLTVSDGVVSIPQLLLLIMVSAVFADTWLGGVLDGGFLLALIFAFTT
                     WPFLWRAVRGPALQVAQEEWVRAAESYGQQPRKIMRKHMLPYILGYLLVYASMSVGGI
                     IISLSALSFLGNGLGIDPPTPAWGRAISAGQSYVSSVSWHISLIPGLMIVLLVTGMNA
                     LGDGIRDAIDPETESGEGEEAAAGGGA"
     gene            complement(71209..72297)
                     /locus_tag="Hlac_0068"
     CDS             complement(71209..72297)
                     /locus_tag="Hlac_0068"
                     /inference="protein motif:PFAM:PF00528"
                     /note="PFAM: binding-protein-dependent transport systems
                     inner membrane component;
                     KEGG: hwa:HQ1480A ABC-type dipeptide/oligopeptide/nickel
                     transport system, permease protein I"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport systems
                     inner membrane component"
                     /protein_id="ACM55674.1"
                     /db_xref="InterPro:IPR000515"
                     /translation="MNRGAYIIKRLGLAVPVMMFGITMSFLILYLGPIDPVGSILGQQ
                     ATPEDIRQLRMELNYIDAAGNPVPLWEQYFGVVSDLFTLDFGESWTIQRETPVTELII
                     NRMPATLWLGFWSVIIALGAGVPLGLYAGLRANTLRDYTASGFGIVWRAMPNFWLAVI
                     ISGLITAGGALEFYRTAIVETPVSGTPDALNNLFTTVDIFAGVPYLELLFIPVPNLGP
                     MFVAFKWILPAALVLGSSSMGNEVRIGRTAVLESINSKYVETAKAKGLSPRRIIVKHV
                     GRNAVIPLLPVIMGEFYLLVGGSVLVEAVFGINGLGNLFFNAVLGPDIPLVMALVFIF
                     IVIQILFNIGQDLLYTYIDPRISLGESE"
     gene            complement(72570..74471)
                     /locus_tag="Hlac_0069"
     CDS             complement(72570..74471)
                     /locus_tag="Hlac_0069"
                     /inference="protein motif:PFAM:PF00496"
                     /note="PFAM: extracellular solute-binding protein family
                     5;
                     KEGG: hwa:HQ1481A ABC-type dipeptide/oligopeptide/nickel
                     transport systems, substrate-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="extracellular solute-binding protein family 5"
                     /protein_id="ACM55675.1"
                     /db_xref="InterPro:IPR000914"
                     /translation="MSDKDELRRRQFLRVTGASALTAGIAGCSGDSGGEPSDGGDGSD
                     GEDGSDSEDGSDGEDGSDGEDGSDQLMPSSYPYGANENRISEARAVMEEAGYGPDNRF
                     SLDWLQYNSPAWEEIANTLRARLESVHVDMNISKADFGALLERTEKGEMDAFTLGWIA
                     DYPGVRNFAQLVDPDNTIYDAEGASPNGARLFWSEDSYTDPEVRSAMSEAFAQLSENP
                     GNKDEAESARAEATLRLEKLLWESAALLPVYHSVEDVFWYDRVDYNPPGGMGVSRAKT
                     STSVQGLEGSDTLKGTSATFNALDPIASGNTASGSKVMDIFDAPLNYVNGTVEVEPLL
                     IEDYTTNDDLTEYEFTLKQGVQFHGDYGELTADDMVYSIRRLVESSNSTNTYFPISVL
                     NIDREEDEDGNVVPGSVAVEATGDYTFSVTLRNSFGYALEVLSYSAFSAVPEGIVGDV
                     EGYDGDMDYQQFSTNPVGCGPYVFEEWNSGVGGEFRASAFTDYHGGEPAAANIQDAIL
                     SEPNAIYNRFLNENADVSAIPTSQFDPGLSDLTSQDGAQQTGTYGPLGNDQTVNMSRT
                     PTIDTFYIAFNMENVPKPVRQAMAYVMTGDDFTESVFKGRGESAYHLTPPQIFPGGGE
                     GYADHWQGE"
     gene            complement(74640..76262)
                     /locus_tag="Hlac_0070"
     CDS             complement(74640..76262)
                     /locus_tag="Hlac_0070"
                     /inference="protein motif:PFAM:PF00009"
                     /note="PFAM: protein synthesis factor GTP-binding;
                     elongation factor Tu domain protein; elongation factor Tu
                     domain 2 protein;
                     KEGG: nph:NP1740A translation elongation factor aEF-1
                     alpha subunit-like protein"
                     /codon_start=1
                     /transl_table=11
                     /product="protein synthesis factor GTP-binding"
                     /protein_id="ACM55676.1"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004160"
                     /db_xref="InterPro:IPR004161"
                     /translation="MSADRSALRRAIERGERDGGAIEFKERLTRRVHLVDGRMESLVA
                     QLRHRILSGDGEATYVLGVTDDGGLAGIAPDAFSETMDVLSLLADEADAHIADVETWS
                     AGSAGNGNTEGLVGLATLREGGMFEADDDHLVIGTAGHVDHGKSTLVGTLVTGRADDG
                     QGGTRGFLDVQPHEIERGLSADLSYAVYGFDDDGDEPIRMDNPHRKSDRAQIVEEADR
                     LVSFVDTVGHEPWLRTTIRGLVGQKLDYGLLVVAADDGPTKTTREHLGILLATELPTI
                     VAITKTDAVSDERLTEVEREVESTLRDAGQTPLLVDRHGIDTAVAEVGDGVVPLLRTS
                     AVTKEGIGTLDRLFETLPKRATPERETFRMYVDRSYKVTGVGAVASGTVNSGTVEAGD
                     ELLLGPMADSSFREVEARSIEMHYHRVDKATAGRIVGIALKGVDESEIERGMALVPRD
                     SDSEPVREFEAEVMVLNHPTRIQEGYEPVVHVETVSEAAVFAPEGGRLLPGDTGRTTI
                     RFKFRPYLIEEGQRFVFREGSSKGVGTVRDVE"
     gene            76604..77593
                     /locus_tag="Hlac_0071"
     CDS             76604..77593
                     /locus_tag="Hlac_0071"
                     /inference="protein motif:PFAM:PF01758"
                     /note="PFAM: Bile acid:sodium symporter;
                     KEGG: amt:Amet_1885 bile acid:sodium symporter"
                     /codon_start=1
                     /transl_table=11
                     /product="Bile acid:sodium symporter"
                     /protein_id="ACM55677.1"
                     /db_xref="InterPro:IPR002657"
                     /translation="MDLVEKYQSALVLAAIAVGLAVGQIDGVASVADRLILPFLMVML
                     FAAFVGIPLSHLREAFGNRRVVGSSLLVNFVWSPLLAVGLGAVFLRDQPALWVGLIML
                     LVTPCTDWYLVFTDIADGDVPLATSVLPYNLVLQLVLLPVYLYAFAGTLVDLPLALLV
                     ESVLLVLVVPLIFGGIARWGLTQTKGETWFRERFLPRLSPIQIVFLALAIGAMFASQG
                     EVVVENPRLLALLAVPVVLFYAINLAVGFAAGRLLSFSYGEMVCFNNTILSRNSPTAL
                     AIAVVAFPNEPLIPLALVIGPLLELPLLGVIAQVHLAVRERWTTRFDVSSNDR"
     gene            complement(77693..78685)
                     /locus_tag="Hlac_0072"
     CDS             complement(77693..78685)
                     /locus_tag="Hlac_0072"
                     /inference="protein motif:PFAM:PF00382"
                     /note="PFAM: Zinc finger TFIIB-type domain protein;
                     Transcription factor TFIIB cyclin-related;
                     SMART: Cyclin domain protein;
                     KEGG: hwa:HQ3654A transcription initiation factor TFB"
                     /codon_start=1
                     /transl_table=11
                     /product="Transcription factor TFIIB cyclin-related"
                     /protein_id="ACM55678.1"
                     /db_xref="InterPro:IPR000812"
                     /db_xref="InterPro:IPR006670"
                     /db_xref="InterPro:IPR013137"
                     /db_xref="InterPro:IPR013150"
                     /translation="MSEARSTQTRSPRTETDDVATADRTATTDRAATADADETADADE
                     TAARETCPECGGRTRVDAAERVCTDCGLVVEADRIDHGPEWRSFDDDDTNPKRTGAPL
                     TRSRHDRGLSTEIGRSTKVKGRKRRRLARMRTQHNRAQISTKRDRNKVYAYTEIRRLT
                     GALELPDSVRDTACTLFASAQDESLLRGRSLEGFAAACVYVACRTADVARTVGEICAE
                     AKATEAEHRAAFDAMNRELGLPIAPTGPAEYLPRFASELDCDADVERRAGELAKRAVE
                     EGISNGRNPVGVAAACLYTAARELGAECTQQEAADVADVTPVTVRRTYVDLTEE"
     gene            78849..79385
                     /locus_tag="Hlac_0073"
     CDS             78849..79385
                     /locus_tag="Hlac_0073"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: hma:rrnAC2770 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACM55679.1"
                     /translation="MTLSEIADGLEVTASQRDRGVAVADDTETPLVDRLAEHADDLPC
                     TPEATATLVDAYTAGRSVGDAAREAGVTPMTGAKALHRCGVEGVCPLAPSRRDVVRDW
                     LDGRLARSEAIALTGGDEVDFALATYVETHDPLSAVAEAVDAHVAGSAPLGAGSAGSG
                     GNDADALGGALGSPDGLR"
     gene            complement(79414..80205)
                     /locus_tag="Hlac_0074"
     CDS             complement(79414..80205)
                     /locus_tag="Hlac_0074"
                     /inference="similar to AA sequence:KEGG:rrnAC2639"
                     /note="KEGG: hma:rrnAC2639 cell division inhibitor"
                     /codon_start=1
                     /transl_table=11
                     /product="cell division inhibitor"
                     /protein_id="ACM55680.1"
                     /translation="MHATTLALVGATGGAGTTRTAVELAALGARDGRDVAVVDAAFTT
                     QGLSEYVSGRIGTDLTTLVTDETGASLSAGTYPIALGDGGTGGDSSGGNAPDLPGRAD
                     VIPARAPFERVARAKTAEAARKLERRIDEAATSYDAVIVDAAPVGSNEAVAGVTTADR
                     TAAVFPATTHGRDALQRLRGRIADVGGGLDRSIAVARNADGDETENDANVRLPPTDPA
                     VASAPTAATGSGAYARAVTAAFEDAFDATVGIEFEEPGLVDRLRS"
     sig_peptide     complement(80140..80205)
                     /locus_tag="Hlac_0074"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.901) with cleavage site probability 0.650 at
                     residue 22"
     gene            complement(80264..80695)
                     /locus_tag="Hlac_0075"
     CDS             complement(80264..80695)
                     /locus_tag="Hlac_0075"
                     /inference="protein motif:PFAM:PF01230"
                     /note="PFAM: histidine triad (HIT) protein;
                     KEGG: nph:NP5090A histidine triad (HIT) hydrolase 2
                     (bis(5'-nucleosyl)-tetraphosphatase (asymmetrical))"
                     /codon_start=1
                     /transl_table=11
                     /product="histidine triad (HIT) protein"
                     /protein_id="ACM55681.1"
                     /db_xref="InterPro:IPR001310"
                     /translation="MSADCIFCSIVDGDIPARTVHETDDVLAFLDANPLAPGHTLVIP
                     KAHAQHVGDLDDDLASDLFAAVTELTPRVQAAVDAEGANVGINDGEAAGQEVPHVHVH
                     VIPRFEGDGGAPLHAVGGKRPDLSEEELDAIADDVAAAIDE"
     gene            complement(80775..81707)
                     /locus_tag="Hlac_0076"
     CDS             complement(80775..81707)
                     /locus_tag="Hlac_0076"
                     /EC_number="3.1.26.11"
                     /inference="protein motif:TFAM:TIGR02651"
                     /note="TIGRFAM: ribonuclease Z;
                     PFAM: beta-lactamase domain protein;
                     KEGG: nph:NP2254A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease Z"
                     /protein_id="ACM55682.1"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="InterPro:IPR013471"
                     /translation="MSLRVTFLGTGGAVPTTERAPSALFVNREGDRLLFDCGEGTQRG
                     MMRFGTGFGIDHLFVSHLHGDHVLGIPGLVQTLGFNDRAEPLTIHCPPGTEDDLHDLV
                     HAVGHDPAFQIRIESVAPGEVALDADGYEVRAFETVHRTKSQGYVLEEDDRPGRFDRP
                     KAEELGVPVGPKFGRLHEGEPVEAEDGSIVEPDQVVGPPRPGRKFVYTADTRPREGTV
                     AVAEDADLLVHDATFADDMEDRARDTAHSTGREAGSVAERAGAKRLALVHISSRYAAD
                     ASPIRREAREAFDGECLLPDDGDLIEVPFPDADE"
     gene            81745..82095
                     /locus_tag="Hlac_0077"
     CDS             81745..82095
                     /locus_tag="Hlac_0077"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: hwa:HQ1139A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACM55683.1"
                     /translation="MTLPVDTPRQRHRHVPAAPMTTVHDSIAALVEQEGWRAEGDAAR
                     VHYDGGGDRFAVEFYANAERVLYWTVPSAESDATAATAAPVPREQVPDPLRRRIREDL
                     DAAGVDPDVERREV"
     gene            82260..84206
                     /locus_tag="Hlac_0078"
     CDS             82260..84206
                     /locus_tag="Hlac_0078"
                     /inference="protein motif:PFAM:PF00005"
                     /note="PFAM: ABC transporter transmembrane region; ABC
                     transporter related;
                     SMART: AAA ATPase;
                     KEGG: nph:NP0006A ABC-type transport system ATP-binding
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter related"
                     /protein_id="ACM55684.1"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR017940"
                     /translation="MSSAEWEDDDPFEEQRDKIENPMKRLFLAYGRDYLPQVSVGIFA
                     SVFARLLDLLPPLMLGIAIDAVFYEDALFSEQIPLVILPDAWLPTGQTEQFWFTIAVI
                     GAAFGIGAGFHWIRNWGFNAFAQNIQHDVRTDTYDKMQRLNMEFFSDKQTGEMMSILS
                     NDVNRLERFLNDGMNSLFRLSVMVVGIGVLLFWINWQLALVALLPVPIIGGFTYLFIK
                     IIQPKYAEVRSSVGKMNSRLENNLGGIQVIKSSNTEPYESDRVDDVSMDYFDANWDAI
                     TTRIKFFPALRVLAGIGFVLTFVIGGLWVFQDTPPGPFTGDLSVGMFVVFILYTQRFI
                     WPMAQFGQIINMYQRARASSARIFGLMDEPSRLAEDPDAEDLTVGDGDVVYDDVSFGY
                     DEETIVSDIDFAVEGGETLALVGPTGAGKSTVLKLLLRMYDVDEGSIRIDGQDVRDVT
                     LKSLRRSIGYVGQSSYLFYGTIRENITYGTFEATDEEVREAAEAAEAHEFIKNLPEGY
                     DTMVGERGVKLSGGQRQRVTIARAVLKDPDLLILDEATSDVDTETEMLIQRSLDRLTA
                     DRTTFAIAHRLSTIKDADTILVLEGGEIAERGTHDELLDNSGLYAHLWGVQAGEIDEL
                     PQEFIDRAQERTARLVEDAESDDD"
     gene            complement(84225..84566)
                     /locus_tag="Hlac_0079"
     CDS             complement(84225..84566)
                     /locus_tag="Hlac_0079"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: nph:NP0720A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACM55685.1"
                     /translation="MDNDKEDPARAYGVTFGPLKPALREHQYPVSVSELIEQYGGFEL
                     ETAAGEQRLESVLQECEATTFAEPWEVREAVLSGLNDDAVVGYHGDPAESEGRDASEI
                     DGTGDWSQLSE"
     gene            84685..85434
                     /locus_tag="Hlac_0080"
     CDS             84685..85434
                     /locus_tag="Hlac_0080"
                     /inference="protein motif:PFAM:PF02633"
                     /note="PFAM: Creatininase;
                     KEGG: hsl:OE1203F creatininase"
                     /codon_start=1
                     /transl_table=11
                     /product="Creatininase"
                     /protein_id="ACM55686.1"
                     /db_xref="InterPro:IPR003785"
                     /translation="MRLADATWTDVRDADIDVAFVPVGSTEQHGPHAPLGTDTLNAVA
                     VAEAGAAAYEAVETESSADVVVTPPIPVGVAEEHRAFDGTMWISPDTFRAYVREAAES
                     LPHHGIDRVVFVNGHGGNVEALAEVARRFSRDDGHDGYAVAFTWFEAVGEHAGDMGHA
                     GPLETALLRATNPDLVREDRIEAAREGAADRWGEWVSGVNLAHDSDEFSDNGVVGDPT
                     AGDAERGEVLLDLASDALAELTAAVVDRKSV"
     gene            complement(85461..85904)
                     /locus_tag="Hlac_0081"
     CDS             complement(85461..85904)
                     /locus_tag="Hlac_0081"
                     /inference="similar to AA sequence:KEGG:rrnAC2308"
                     /note="KEGG: hma:rrnAC2308 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55687.1"
                     /translation="MSQSTFDDDDDLFGEAAEETRAEVEEHLQAARAELPDADAVWET
                     DADNVLGALNGLKSALDVGDAVDSVRSAKKAYVLGERADAFEDADDLKAEIEALESLV
                     ADIEAAAEEVASLTGTVPAIRGALQDAAEAGDDESEDDEDGEDEE"
     gene            complement(86332..87138)
                     /locus_tag="Hlac_0082"
     CDS             complement(86332..87138)
                     /locus_tag="Hlac_0082"
                     /inference="protein motif:PFAM:PF00248"
                     /note="PFAM: aldo/keto reductase;
                     KEGG: hma:pNG7293 aldehyde reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="aldo/keto reductase"
                     /protein_id="ACM55688.1"
                     /db_xref="InterPro:IPR001395"
                     /translation="MSNTFDRLGYGTYKLADGEECVGGVAHAIETGYRHIDTAQGYDN
                     EASVSVGIDRTDVGREDLFVATKLSTGNLSYDDATATARVSRDRLGVDSIDLLYVHWP
                     INTYDPEETLPALDDLVDDGVVDRIGLSNFQPDQLDEAIDRLDHDVFAHQVECHPLLQ
                     QEKLRERAAEHDHWLVAYSPIARNRVADVDVLQEIAAAHDASPAQVSLAWLLSKDRVA
                     PIPKAADFDHVEANWAAREIDLTADEIGRIDTLDRGERIVDFEEAPWNHE"
     gene            87308..87862
                     /locus_tag="Hlac_0083"
     CDS             87308..87862
                     /locus_tag="Hlac_0083"
                     /inference="protein motif:PFAM:PF07681"
                     /note="PFAM: DoxX family protein;
                     KEGG: hma:pNG6051 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="DoxX family protein"
                     /protein_id="ACM55689.1"
                     /db_xref="InterPro:IPR011637"
                     /translation="MSTQEVALRSTIGGVSVEGRLHTLSVWFILALRLMIGLAFFQSG
                     LDKVLSGEFSAVGYLQNAPAANGSPAAGLFAAMGESALFIDFVNVAVPWGEVLIGLGV
                     IVGLLTRLAAFWGAFMMLMFYLGNWDISHGYINGDFAYMLVFLSVAAFGAGRILGLDA
                     YVEQYEIGGQPLVERYPWTRYLLG"
     gene            87996..89711
                     /locus_tag="Hlac_0084"
     CDS             87996..89711
                     /locus_tag="Hlac_0084"
                     /inference="protein motif:PFAM:PF00015"
                     /note="PFAM: histidine kinase HAMP region domain protein;
                     chemotaxis sensory transducer;
                     KEGG: hma:rrnAC0013 MCP domain-containing signal
                     transducer"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis sensory transducer"
                     /protein_id="ACM55690.1"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR004089"
                     /db_xref="InterPro:IPR004090"
                     /translation="MQAESSSGVRSSYGAKLALSLIGVMGVSVSYGVIVYLRAEEAGA
                     AGAEVRSGLIGMTLLTVIGLALIGVTVGSNTVISLRQLTDKAERMAEGDLDVRLETGR
                     TDEIGRLFRAFDAMRGSLRSEIDDAEAAREEAERARREATGRAETVERKATEYESAMR
                     AFADGDLTQRVDSDSDNEAMARVGAAFNEMADELEGTVASVATVAEDTADVAGTVDDR
                     TESLRATTGTVSDAVEEIAEGARTQRDDLQGATDEAENLASSAEEVASTVTDVAETAE
                     HAAAVGEEGREAAEEALAEMDAVEETTAETTAEVEALAEEVEEIGEVVDTISEIAEQT
                     NLLALNASIEAARSGADGAGFAVVAEEVKALAEETQKSASEIEARIHSVQERAETGAD
                     AMERTEQRISAGVETVETSIDALERLAEASERTDTSMTEITRATETQANSVDAVVGHV
                     EDVSAISAQTASAAGDVTGAVDEQEQTLGAVETAAESLSDRALALRGAVDDFEFAADD
                     GLGAASTPVSDGRGRDATTTAVSDGGSDGGTDDGSFDFSHGSEAPDRAGDNPADEGVD
                     GAGVN"
     gene            89713..90477
                     /locus_tag="Hlac_0085"
     CDS             89713..90477
                     /locus_tag="Hlac_0085"
                     /inference="protein motif:PFAM:PF01036"
                     /note="PFAM: rhodopsin;
                     KEGG: hsl:OE3480R sensory rhodopsin II"
                     /codon_start=1
                     /transl_table=11
                     /product="rhodopsin"
                     /protein_id="ACM55691.1"
                     /db_xref="InterPro:IPR001425"
                     /translation="MLVDTSVWAWLGVLAMGAGTILPLWAWFSRSSETGESHAVYYLT
                     LAGVTGVAALAYFAMALDVGTVSVSAGDLEVVRYVDWLVTTPLLILYLGLLARPSRRV
                     LVGLIGVDVVIIAGGIVAAATTGTVSWVAFGVAGVAYLGLVYGLLVSLPRSASAEGDR
                     IRAVFGTLRNITVVLWTLYPVVWLLAPTGFGLLTPTTEMLVFVYLDIVSKVGFVVVAV
                     MGADALNRLDDDREFVATDPAVAPDAEEHTTVLGDD"
     gene            complement(90498..91613)
                     /locus_tag="Hlac_0086"
     CDS             complement(90498..91613)
                     /locus_tag="Hlac_0086"
                     /inference="similar to AA sequence:KEGG:OE3689R"
                     /note="KEGG: hsl:OE3689R heme biosynthesis protein nirDL"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator, AsnC family"
                     /protein_id="ACM55692.1"
                     /db_xref="InterPro:IPR001680"
                     /translation="MSLDADWRADIDAVDAALIDEYQSGFPVESRPFERVARDITAET
                     GVDIDADAVLDRVRDLRERGVFRRFGAVLNPPVIGSSTLAAVRAPEDRFNEVAEVING
                     YQQVNHNYRRDHEWNQWFVVTAGSRETRDAILAEIEERTGCEVLALPMLTDYYIDLEF
                     PVVNGDRFARESGEARSASDSASGERSDPRASDHTDVSATRISENARGDLTPLEGDLL
                     LAIQDGFPLSSTPYADVASEIDAPIEDVLAAVEQLLADGCIKRIGCVVNHVVTGFTNN
                     CMVVWDVPDDELDERGEAVGSLPYVTLCYHRPRRPEQEWEYNLFTMIHGREAEAVDAK
                     IDELAADHLPFTHERLYSTETLKQTGARYEDLVADGE"
     gene            complement(91738..91896)
                     /locus_tag="Hlac_0087"
     CDS             complement(91738..91896)
                     /locus_tag="Hlac_0087"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACM55693.1"
                     /translation="MTSKSVATALTLYRARTLTLEQAATVGGCSTAQLEESARAFAPT
                     PGETPADD"
     gene            92216..93322
                     /locus_tag="Hlac_0088"
     CDS             92216..93322
                     /locus_tag="Hlac_0088"
                     /EC_number="2.4.2.18"
                     /inference="protein motif:PFAM:PF00591"
                     /note="PFAM: glycosyl transferase family 3;
                     KEGG: hma:rrnAC3306 anthranilate
                     phosphoribosyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family 3"
                     /protein_id="ACM55694.1"
                     /db_xref="InterPro:IPR000312"
                     /translation="MAQATQEFGDWPLKRLMTDVCGSGHKSADDLTRAQATEAFERIL
                     ADEPDPTTLGAFWLANRWKRNTAEELGAYVDVMCERVEYAEPDADPVDCGANYDGKGR
                     SAILGVAAGVVAAAAGTPVVVHSGDRVPTQKQDAYKHVLDELGVHTELTPSDSADMVD
                     ETGFGFYYQPAFNPAIDDLFDRRDQMGVRTFVNTIETLANPAGASVHLGSFYHLAFAK
                     KVVDTFVESEFHDLDRVLMFQGMEGYDDVRPGYTKVAEWDAAGGDGDEAGDAGSEGAS
                     FDDFEIETAKYGMDLEEEDLAVDDVAVESAEITEAVLTGERDGPFADAVAVNAALRIY
                     AREDADSIEDGLDAARAVIDDGSAHDVLEALRDF"
     gene            93525..93674
                     /locus_tag="Hlac_0089"
     CDS             93525..93674
                     /locus_tag="Hlac_0089"
                     /inference="similar to AA sequence:KEGG:HQ3677A"
                     /note="KEGG: hwa:HQ3677A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55695.1"
                     /translation="MPTCEHCEAHVSDRFARVFSDARGRIHACPNCSANAGIAEVAKE
                     RAQNA"
     gene            complement(93736..94569)
                     /locus_tag="Hlac_0090"
     CDS             complement(93736..94569)
                     /locus_tag="Hlac_0090"
                     /inference="protein motif:TFAM:TIGR00552"
                     /note="TIGRFAM: NAD+ synthetase;
                     PFAM: NAD synthase;
                     KEGG: hwa:HQ1091A NAD(+) synthase (glutamine-hydrolyzing)"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD+ synthetase"
                     /protein_id="ACM55696.1"
                     /db_xref="InterPro:IPR003694"
                     /translation="MSRTSDQSVLLSDDPPLDLRLSEEELENARERIVSFIADLVDDA
                     GSEGAVLGLSGGIDSTLTAHLAVEALGEDGLHGITMPAEVNDPDVMSDAERVAHDLGI
                     EYDVVEIQPIAESVFDAFPEAADDRMAAGNVYVRTRAVLNYFVANAENRIVLGTGNRA
                     EAMTGYFTKYGDQAVDCNPIGNLYKQQVRQLAAHVGVPRDLVMQEPTAGMWEGQTDAA
                     EMGLDYDTVDAILAVHVDGGLSRAATVRELDVPEEAVDRVVELVERSAHKRSMPPAPE
                     R"
     gene            complement(94665..95090)
                     /locus_tag="Hlac_0091"
     CDS             complement(94665..95090)
                     /locus_tag="Hlac_0091"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACM55697.1"
                     /translation="MIVLQTGPDTSNILLAGVVGLALLASAVAIVAVVSRDAAARGVS
                     KPRRWLIGVGAALFPVPVFVAYILFASRIGERAEPVPRIDRIAGWLAASAAISVLGGA
                     ILSPPDPVTQLRYAAGLFVALAALFYIPTFRRGPLVGGA"
     sig_peptide     complement(94995..95090)
                     /locus_tag="Hlac_0091"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.931) with cleavage site probability 0.426 at
                     residue 32"
     gene            complement(95146..95736)
                     /locus_tag="Hlac_0092"
     CDS             complement(95146..95736)
                     /locus_tag="Hlac_0092"
                     /inference="protein motif:PFAM:PF00293"
                     /note="PFAM: NUDIX hydrolase;
                     KEGG: hwa:HQ3163A ADP-ribose pyrophosphatase; Mut/NUDIX
                     family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="NUDIX hydrolase"
                     /protein_id="ACM55698.1"
                     /db_xref="InterPro:IPR000086"
                     /translation="MSDDLRDLPAFDDGRTHSLPGEPEWPVREVVVEYDEGWFVGGYD
                     RVEQPDGTEKKYYWAELSPATIVVAVADDQVLFVEQYRPTVRNTQLELPAGIVEPGES
                     YTAAGARELAEETGFEPSSTSLLQEVWCSTGVLRHKRGYVFAEGLEPVDVDHDSNEFL
                     VPRTVPIDEALAVAREPPTNDATLEGLLLAKADGCL"
     gene            complement(95733..96116)
                     /locus_tag="Hlac_0093"
     CDS             complement(95733..96116)
                     /locus_tag="Hlac_0093"
                     /inference="similar to AA sequence:KEGG:rrnAC2154"
                     /note="KEGG: hma:rrnAC2154 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55699.1"
                     /translation="MRRVTRNLLIAIALVVVALLALGALPSYLGSGDPYYLTAEPIET
                     NETAADVNNVSDRRYPFLTSALASDDGRSEGYQTGPYGVKKWFTHTPFDEVDALTRQV
                     PEAATGDGVRVRRDGRVYYVEVVRP"
     sig_peptide     complement(96045..96116)
                     /locus_tag="Hlac_0093"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.409 at
                     residue 24"
     gene            96254..97210
                     /locus_tag="Hlac_0094"
     CDS             96254..97210
                     /locus_tag="Hlac_0094"
                     /inference="similar to AA sequence:KEGG:OE3879F"
                     /note="KEGG: hsl:OE3879F hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55700.1"
                     /translation="MEFRFELALCAALESPDRVVARQLGAGIENPGGRIVDVCVLTPG
                     PGFDRRAAITPDRIPDPAIEAAVGPGEAVPLKKAFDLPPDRAEAVAERAAEVGYLERE
                     RRDGRPIVRATARYPDDWVGSLTAIENKPDLGTPGDLAAQLRYDAALGLFDEVVLATA
                     SYVTRAHLNRIPEAVGVWRFDPDTGEREVVRESTPFEPDAPGVEIREERALQTDVALV
                     DPAAKARKRRRIAERAYGKGWRPDPPGCAHASTTADGRPHCNRFDRIVDPGRDCGAPC
                     RAHEPADPPATDRGPLRDERTAWVADPTGDGPRRQSGLSRFL"
     gene            97267..97674
                     /locus_tag="Hlac_0095"
     CDS             97267..97674
                     /locus_tag="Hlac_0095"
                     /inference="protein motif:PFAM:PF00571"
                     /note="PFAM: CBS domain containing protein;
                     KEGG: hma:rrnAC0168 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="putative signal transduction protein with CBS
                     domains"
                     /protein_id="ACM55701.1"
                     /db_xref="InterPro:IPR000644"
                     /translation="MDEIDDVFVARLMTSDIHTVTPDTLVEDAAAVLLDNDISSALVV
                     DDDGALVGILTTTDFVDIVAKSQPKAETTVERYMTRDPITAGAQDSVSAVASLMVEHG
                     FHHVPVVDGDTPIGIITTSDFAAYVSSPETLSP"
     gene            97884..99260
                     /locus_tag="Hlac_0096"
     CDS             97884..99260
                     /locus_tag="Hlac_0096"
                     /inference="similar to AA sequence:KEGG:OB2778"
                     /note="KEGG: oih:OB2778 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55702.1"
                     /translation="MSDHLHLNLFTMASVEHVSPGSWTYPGDRSPEYTDREYWTEVAR
                     TAERGGFDAVFFADVRGIYDVYGDDRETAVEKAVQTPASDPQLVVPAMAEVTDDLGFA
                     ITRSTTYTHPYQLAREFSTLDHLTDGRVAINVVTSYLQSAAENLGLSERMDKQTRYDR
                     ADEFLDVCYKLWEESWDDDAVEIDREAGRYTDPEKVSTIDHEGEHFSVPGPHGCEPSP
                     QRTPVIYQAGSSDRGREFAAANAEAVFASQPTEEGVREYVTDVKSRAADHGRDPESLR
                     FFIGVVPVVGETEAAAEAKHEAYKSHVDVEATLALLSGFLDMDLSELDPDQKVEHIET
                     DAIQGTMNAFTKAQPDREWTVREVAEFCGLGTTSPTIVGTPEQVVDDLEHWHEAVGVD
                     GFNVKEVVRPDSLTDFVDLVVPELRERGLVPDPDDAGDSPRGDGTLRERLLGTGQSQL
                     RDDHPAKQ"
     gene            complement(99610..100083)
                     /locus_tag="Hlac_0097"
     CDS             complement(99610..100083)
                     /locus_tag="Hlac_0097"
                     /inference="similar to AA sequence:KEGG:rrnAC2159"
                     /note="KEGG: hma:rrnAC2159 deoxyuridine 5'-triphosphate
                     nucleotidohydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyuridine 5'-triphosphate
                     nucleotidohydrolase"
                     /protein_id="ACM55703.1"
                     /translation="MFDSGQTVATALNAGGADLDDTQRQPNGVDLTVGAIYEQTEPGA
                     IRRDGKRVGEREEIEPEDGAYRLEAGTYVVRYGEPVRIPDERIGFVLPRSTLLRNSCT
                     IDTAVWDAGYEGVGEGRLDVGHAIAIEPGARIAQLVLATADHDGTYDGTYQGERL"
     gene            100350..102335
                     /locus_tag="Hlac_0098"
     CDS             100350..102335
                     /locus_tag="Hlac_0098"
                     /inference="protein motif:TFAM:TIGR01342"
                     /note="TIGRFAM: aconitate hydratase;
                     PFAM: aconitate hydratase domain protein;
                     KEGG: hsl:OE4613F aconitate hydratase"
                     /codon_start=1
                     /transl_table=11
                     /product="aconitate hydratase"
                     /protein_id="ACM55704.1"
                     /db_xref="InterPro:IPR000573"
                     /db_xref="InterPro:IPR001030"
                     /db_xref="InterPro:IPR006250"
                     /translation="MGQTITEKILGDHLVEGELTPGEEIGIEIDQVLTQDTTGTMVWL
                     QFEALDLDEVQTELAAQYCDHQTYQFDFKNTDDHRFLRSAAGTYGAYFSRPGNGICHQ
                     VHKENFAAPGKTLLGSDSHTPTPGGLGELAIGAGGLDIAVAMGGGPYYVEMPEVVNVH
                     LEGELPEWATAKDVALHLLGELTVKGGVGKIFEYTGPGAEKLSIPERTTITNLGTELG
                     ATSSIFATDEKTKDWLARQDREEEHVDLQPDDDAEYAETIEVDLGELEPLVAAPSMPD
                     NVAPVSEYEGTDVEQVIIGSCTNGAYEDILPSAKMLEGREVNKGTEMIVAPGSKQASE
                     MLAREGWTAEMMAAGVNFSEATCGACIGIGHVPASDSVSLRTFNRNFEGRSGIEDDSV
                     FLCSPEVATAAAITGKIVDPRDLAADLGDLEAPGLEMGTKYGPGMGQDDADIISPDEA
                     IDDGLVKGPNIGDVPLKDGIDVDGGEALLKMKDNITTDHIIPATADILKFRSNIEKLS
                     EFTLSRVDDTFAQRALDADGGVLVAGENYGQGSSREHAALCPMYLGIEAVFAQSFARI
                     HKANLFNFGIVPLAIDAETYEKIEQGDDLEIVDDVPAGVSSGQEEFTVSVNGEWEFTA
                     DLDASEREREILSAGGKLSWVKQQHVDDGSGAAPADD"
     gene            complement(102386..103678)
                     /locus_tag="Hlac_0099"
     CDS             complement(102386..103678)
                     /locus_tag="Hlac_0099"
                     /inference="protein motif:PFAM:PF00375"
                     /note="PFAM: sodium:dicarboxylate symporter;
                     KEGG: hsl:OE5200R glutamate/aspartate transport protein"
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:dicarboxylate symporter"
                     /protein_id="ACM55705.1"
                     /db_xref="InterPro:IPR001991"
                     /db_xref="InterPro:IPR011304"
                     /translation="MRSWRRYRSVPIVYRIGVAFVLGSVFGLVVGQPATALQPLGDLF
                     VNLLSMLIVPIVVFTLLMGARRLSPSNLGKIGGQVVVLYALTSAAAVGFGLLVANLID
                     PGANLELGDAEAQTAEAPDIVEVILGIVPQNPIGAMASGDILPTIFFVIVFGLALALV
                     EQSTDSADIRNGVESFYDLAEAGAEAMFKVVWGVMEYGVIGVFALMAAVFGEAGVDAI
                     VPFALLIVTLAIAVVAHIAVVHLGIIVRLLAGQSPIGFLTGGRDALITALSIRSSSGT
                     LPVTMANADNNFHIDEGVYSFSLPLGATINMDGTALYQGVAAIFAANLVGVQLSIAEQ
                     VTVVLVAVLASVGAAGVPGTGLIMLTLVLTQLGLPLEVVGFVAGVDPILDRMRTMTNI
                     SGDLAVTTIVAKWNGAVDFTQGAWVGEHGDSGVVADDD"
     sig_peptide     complement(103568..103678)
                     /locus_tag="Hlac_0099"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.960) with cleavage site probability 0.654 at
                     residue 37"
     gene            complement(103848..104501)
                     /locus_tag="Hlac_0100"
     CDS             complement(103848..104501)
                     /locus_tag="Hlac_0100"
                     /inference="protein motif:PFAM:PF00177"
                     /note="PFAM: ribosomal protein S7;
                     KEGG: nph:NP0124A 30S ribosomal protein S7P"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal protein S7"
                     /protein_id="ACM55706.1"
                     /db_xref="InterPro:IPR000235"
                     /db_xref="InterPro:IPR005716"
                     /translation="MSGEETEAPSDEDVAADEPEPDAPASSEAANENAQLFDVWDVTE
                     IAYEDPSTKRYMTVTPIAHTMGRHASKQFKKSEISLVERMINRLMQTDENTGKKQQAT
                     RIVRDAFDIIHERTEENPVQILVTAVENAAPREETVRLKYGGISVPKAVDVAPQRRVD
                     QALLFISDGVANATYKSTTSAAEALANELITAADYDPERSYSISQKEERERVAAAAR"
     gene            complement(104498..104926)
                     /locus_tag="Hlac_0101"
     CDS             complement(104498..104926)
                     /locus_tag="Hlac_0101"
                     /inference="protein motif:TFAM:TIGR00982"
                     /note="TIGRFAM: ribosomal protein S23 (S12);
                     PFAM: ribosomal protein S12/S23;
                     KEGG: hwa:HQ3391A 30S ribosomal protein S12P"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal protein S23 (S12)"
                     /protein_id="ACM55707.1"
                     /db_xref="InterPro:IPR005679"
                     /db_xref="InterPro:IPR005680"
                     /db_xref="InterPro:IPR006032"
                     /translation="MANGKYAARKLKQDRQKRRWSDSEYARRERGLKKKSDPLEGAPQ
                     ARGIVLEKVGIEAKQPNSAIRKCVRVQLIKNGKQVTAFCPGDGAISFIDEHDEVTIAG
                     IGGAKGRAMGDLSGVNYKVEKVNGVSMIELVRGNAEKPVR"
     gene            complement(105138..105947)
                     /locus_tag="Hlac_0102"
     CDS             complement(105138..105947)
                     /locus_tag="Hlac_0102"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: hsl:OE3190F hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACM55708.1"
                     /translation="MDRRRFFIGVGTGVAVGSAGCLGGEPDRPFPDADWRDEDGLDVA
                     TLSERHVEALVDAGGITLFSTAETTHDGDTEPSPWLPSQEYESAYDLENGRQYVRQEL
                     TETEETDVSELYVADGEALVRQRIGDETQYGRQSVDRSADDLESAMRSEVVTGIRVEG
                     QTAGGETEYEGLNLWNPTSDGEGEVRGEPTAKFTADAFEGDRNIPETVETASATVHVY
                     EFGVVPRLKQSWAGEHEGQEATVDVDIDYRDPGVTVAEPDWAEEAREETSA"
     sig_peptide     complement(105876..105947)
                     /locus_tag="Hlac_0102"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.948) with cleavage site probability 0.935 at
                     residue 24"
     gene            complement(105993..106412)
                     /locus_tag="Hlac_0103"
     CDS             complement(105993..106412)
                     /locus_tag="Hlac_0103"
                     /inference="protein motif:TFAM:TIGR01952"
                     /note="TIGRFAM: NusA family KH domain protein;
                     PFAM: KH type 2 domain protein;
                     KEGG: hwa:HQ3392A transcription elongation factor
                     NusA-like protein"
                     /codon_start=1
                     /transl_table=11
                     /product="NusA family KH domain protein"
                     /protein_id="ACM55709.1"
                     /db_xref="InterPro:IPR004044"
                     /db_xref="InterPro:IPR010212"
                     /translation="MYVELSDEARRYIGRFDELTGVAPKDCLVEGDRLVFLVPAGKMA
                     AAIGQAGETVEEAERRLAKSIELVEDADTPEAFVASALAPAAVNAVTISEQNDRVAYV
                     EVPEPDRGVAIGADGANIETARTLAKRHYDIDDIQLT"
     gene            complement(106412..107626)
                     /locus_tag="Hlac_0104"
     CDS             complement(106412..107626)
                     /locus_tag="Hlac_0104"
                     /inference="protein motif:TFAM:TIGR02389"
                     /note="TIGRFAM: DNA-directed RNA polymerase, subunit A'';
                     PFAM: RNA polymerase Rpb1 domain 5;
                     KEGG: hma:rrnAC2427 DNA-directed RNA polymerase subunit
                     A''"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase, subunit A''"
                     /protein_id="ACM55710.1"
                     /db_xref="InterPro:IPR007081"
                     /db_xref="InterPro:IPR012757"
                     /translation="MTEYDHVTDDMEAVVGATELPARLKDEVYEAINRKAEETGEVTV
                     EQATDIATGVENRYIETRVDPLDPVGTVSAQSIGEPGTQMTMNTFHYAGVAEIDVTQG
                     LPRLIELVDARKTPDTPMMTVHLDDEYGTDREKAHEVVWSIEATRILALGDVSTNVAD
                     MLVRIDLNDDTLLERWPTHSDPSKVAAIIAETIEDSLGVNTRQSGTVVEFGPNEPSYR
                     ELLQLVERLREIVFKGIEEIERVVIRKEEIDGDEEFVLYTEGSAFGDALDIEGVDASR
                     TTCNNIHEIYRNLGVEAARETIIDETKNTLEEQGLDDVNVRHLMLVADMMTTNGEIDS
                     IGRHGISGSKDSVLARAAFEVTVNHLLDAAIHGEYDELDGVIENVIAGKPISLGTGDV
                     DLRMGSRVVGDD"
     gene            complement(107619..110546)
                     /locus_tag="Hlac_0105"
     CDS             complement(107619..110546)
                     /locus_tag="Hlac_0105"
                     /inference="protein motif:TFAM:TIGR02390"
                     /note="KEGG: hwa:HQ3394A DNA-directed RNA polymerase
                     subunit alpha;
                     TIGRFAM: DNA-directed RNA polymerase subunit A';
                     PFAM: RNA polymerase alpha subunit; RNA polymerase Rpb1
                     domain 3; RNA polymerase Rpb1 domain 1; RNA polymerase
                     Rpb1 domain 4;
                     SMART: RNA polymerase I subunit A domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit A'"
                     /protein_id="ACM55711.1"
                     /db_xref="InterPro:IPR000722"
                     /db_xref="InterPro:IPR006592"
                     /db_xref="InterPro:IPR007066"
                     /db_xref="InterPro:IPR007080"
                     /db_xref="InterPro:IPR007083"
                     /db_xref="InterPro:IPR012758"
                     /translation="MSMQTPKVLGGIDFGLMDPETYRDMSATKVITADTYNDDGYPID
                     MGLMDPRLGVIDPGLECRTCGSHSGSCNGHFGHIELAAPVIHVGFTKLIRRLLRSTCR
                     ECGKLALDEEQRDEFRDRYERAKELGNDEHDVLKAAVRQARKASTCPFCGEPQADIKH
                     EKPTTYYEVQDVLSGDYSERIAAAMQPDEEEDDPGTSPQELAEKTDIDLERINEIMAG
                     EFRPRKEDRRAIEKALDIDLTEEDMNKLMPSDIRDWFEDIPDEDLEVLGIDSEHSRPE
                     WMILTVLPVPPVTTRPSITLDNGQRSEDDLTHKLVDIIRINQRFMENREAGAPQLIIE
                     DLWELLQYHVTTFVDNEISGTPPARHRSGRPLKTLSQRLKGKEGRFRGSLSGKRVNFS
                     ARTVISPDPTLSLNEVGVPDRVAMEMTQTLNVTERNVEEARQYVRNGPEAHPGANYVR
                     RPDGRRLKVTEKNCEELAEKVEADWEVNRHLVDGDIVIFNRQPSLHRMSIMAHEVVVM
                     PYKTFRLNTVVCPPYNADFDGDEMNMHALQNEEARAEARVLMRVQEQILSPRFGGNII
                     GAIQDHISGTYLLTHSNPEFTETQALDLLRATRVDELPEADGVDDEGREYWTGRTLFS
                     ELLPDDLSLHFSSSTGDDVIIEDGQLIEGTIDEDAVGAFGGEVVDTLTKEYGETRSRV
                     FINEIASLAMRAIMHFGFSIGIDDESIPPEAEEQVDDAIESAYDRVQELIATYEAGEL
                     ESLPGRGVDETLEMKIMQTLGKARDSAGDIADQHFGDDNPAVVMARSGARGSMLNLTQ
                     MAGSVGQQAVRGERINRGYEDRTLSHYRPNDLSSEAHGFVENSYRSGLTPEEFFFHAM
                     GGREGLVDTAVRTSKSGYLQRRLINALSELEAQYDGSVRDTSGRIVQFEFGEDGTSPV
                     KVSSGEGDGIDVDDIVDRVVDSEFDSDDEKERFLGERTPPTNLSEHSGPGLNKASGVE
                     SDD"
     gene            complement(110547..112376)
                     /locus_tag="Hlac_0106"
     CDS             complement(110547..112376)
                     /locus_tag="Hlac_0106"
                     /inference="protein motif:PFAM:PF00562"
                     /note="PFAM: RNA polymerase Rpb2 domain 6; RNA polymerase
                     Rpb2 domain 7; RNA polymerase Rpb2, domain 4 protein; RNA
                     polymerase Rpb2, domain 5 protein;
                     KEGG: hwa:HQ3395A DNA-directed RNA polymerase subunit B'"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase Rpb2 domain 6"
                     /protein_id="ACM55712.1"
                     /db_xref="InterPro:IPR007120"
                     /db_xref="InterPro:IPR007121"
                     /db_xref="InterPro:IPR007641"
                     /db_xref="InterPro:IPR007646"
                     /db_xref="InterPro:IPR007647"
                     /translation="MAQAEREAKVYVNGSLVGTHPDPEALAEQIREARRRGDVSEMVN
                     VSVKDRTQEVIVNADAGRARRPLIVVENGEPLLGDEEIEALERGDVEFEDLVERGYVE
                     FIDAEEEEDILVAVDEEDVTDDHTHLEIDPQLVFGIGAGMIPYPEHNASPRITMGAGM
                     MKQSLGLPSANYRIRPDTRQHLLHYPQLAMVKTQTSDQISFDKRPAAQNFVVAVMSYE
                     GFNIEDALVMNQGSVDRALTRSHFFRTYEGEERRYPGGQEDRFEIPDQDVRGARGEDA
                     YTHLDEDGLVNPETKVDESSVLLGKTSPPRFLEEPDDMGGLSPQKRRETSVTMRSGES
                     GVVDTVTLMEGEDGSKLSKVKVRDQRVPELGDKFASRHGQKGVVGHLAPQEDMPFTEE
                     GVVPDLVMNPHALPSRMTVGHVLEMLGGKVGSLRGSRVDGTPFQGEDEEELRGGLEEH
                     GFKSSGKEVMYSGVTGEKIEAEIFVGTIFYHKLYHMVSNKLHARSRGPVQVLTRQPTE
                     GRAREGGLRVGEMERDTIIGHGASMVLNERLLESSDAETVHVSAETGLVAVEDREQRR
                     VYDPVTGDEDDIHELEVSYAFKLLLDEMIALGIRPKLELEDAI"
     gene            complement(112378..113943)
                     /locus_tag="Hlac_0107"
     CDS             complement(112378..113943)
                     /locus_tag="Hlac_0107"
                     /inference="protein motif:PFAM:PF04563"
                     /note="PFAM: RNA polymerase Rpb2 domain 2; RNA polymerase
                     beta subunit; RNA polymerase Rpb2 domain 3;
                     KEGG: hma:rrnAC2430 DNA-directed RNA polymerase subunit
                     beta''"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase beta subunit"
                     /protein_id="ACM55713.1"
                     /db_xref="InterPro:IPR007642"
                     /db_xref="InterPro:IPR007644"
                     /db_xref="InterPro:IPR007645"
                     /translation="MNRQDRRVVSREYFSDERLAEHHFRSFNNFLDRGMQEVVDEKET
                     IETDIGDKEGQEPVYVELGDVRMVTPRVREADGSEELLYPQEARLRNITYSAPVFMEM
                     SIVRGGEDEPEQVVDTTETKVGRMPIMVGSNKCNMAGFSDDELIDIGEDPVDPGGYFI
                     VNGSERVLMTSEDLAPNKILAEYDSKYGDEIQVAKTFSQRRGYRALVLCERNREGLLE
                     VSFPSVSGSIDFVTLVRALGLESDEEIVHRVSDDPEIVKFMLENLEEAEVQTTEGAIE
                     TLGERVASGQGKNYQLKRANYVIDRYLLPHLHEEGVDEEDVRINKAYYLCRMAEACFE
                     LALERREADDKDHYANKRLKVSGDLMRDLFRTALNKLARDVKYQLERANMRNRDLTVN
                     TVVRSDVLTERLEHPIATGNWVGGRSGVSQLVDRTDYMGVLSHLRRLRSPLSRSQPHF
                     KARDLHATQWGRICPSETPEGPNCGLVKNFAQAMELSQTVDDEQGLKRELASMGVEGI
                     PGIEGVDRQTADD"
     gene            complement(113940..114167)
                     /locus_tag="Hlac_0108"
     CDS             complement(113940..114167)
                     /locus_tag="Hlac_0108"
                     /inference="protein motif:PFAM:PF01191"
                     /note="PFAM: RNA polymerase Rpb5;
                     KEGG: nph:NP0108A DNA-directed RNA polymerase subunit H"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase Rpb5"
                     /protein_id="ACM55714.1"
                     /db_xref="InterPro:IPR000783"
                     /translation="MVDVSQHELVPDHVLLEAEEVDEVLAEYDVKRTNLPKIKRTDPA
                     LPDEAEVGDVVKIVRNSRTTEEAVVYRLVVS"
     gene            114519..114591
                     /locus_tag="Hlac_R0008"
                     /note="tRNA-Asp1"
     tRNA            114519..114591
                     /locus_tag="Hlac_R0008"
                     /product="tRNA-Asp"
     gene            114621..114693
                     /locus_tag="Hlac_R0009"
                     /note="tRNA-Asp2"
     tRNA            114621..114693
                     /locus_tag="Hlac_R0009"
                     /product="tRNA-Asp"
     gene            complement(114841..115845)
                     /locus_tag="Hlac_0109"
     CDS             complement(114841..115845)
                     /locus_tag="Hlac_0109"
                     /inference="protein motif:PFAM:PF00850"
                     /note="PFAM: histone deacetylase superfamily;
                     KEGG: hwa:HQ1437A histone deacetylase"
                     /codon_start=1
                     /transl_table=11
                     /product="histone deacetylase superfamily"
                     /protein_id="ACM55715.1"
                     /db_xref="InterPro:IPR000286"
                     /translation="MRFGYSDRCLEHDTGERHPENPDRLRAIRRGLAKRHGVEYAEAD
                     PATREEVVAVHDAEYVDELEAFVADGGGSWDPDTVASEGTWDAALASAGLAQWAARSA
                     LNGADGRDTPFALGRPPGHHAVPDDAMGFCFFNNAAVAAQTVLDDGAADRVAVFDWDV
                     HHGNGTQDVFYDRGDVLYASIHEDGLYPDTGALDETGHDEGAGTTVNLPLSAGAGDAD
                     YLYAIDEVVAPAIKRFDPDLVIVSAGFDAHRHDPISRMRVSSEGYALMTDRIRTVTDN
                     IEAANSYVLEGGYGLDTLAEGVSMVHETFDGRTPVGDDDDPDEKTESLVTELRELLDL
                     "
     gene            complement(115846..116277)
                     /locus_tag="Hlac_0110"
     CDS             complement(115846..116277)
                     /locus_tag="Hlac_0110"
                     /inference="protein motif:PFAM:PF00808"
                     /note="PFAM: Transcription factor CBF/NF-Y/histone domain
                     protein; Histone core domain protein;
                     KEGG: hwa:HQ1436A histone"
                     /codon_start=1
                     /transl_table=11
                     /product="Transcription factor CBF/NF-Y/histone domain
                     protein"
                     /protein_id="ACM55716.1"
                     /db_xref="InterPro:IPR003958"
                     /db_xref="InterPro:IPR007125"
                     /translation="MSVELPFAPVDGIIRRNAGDLRVSADAAEELARRIQAHGAELAI
                     DAAERATEDGRKTLMASDFGVEQVISREDLILPVAPIDRIARLRIDDRYRVGVDARIA
                     LADILEDYADNVASAAATLARHADRRTVQAEDIETYFALFE"
     gene            complement(116382..117887)
                     /locus_tag="Hlac_0111"
     CDS             complement(116382..117887)
                     /locus_tag="Hlac_0111"
                     /inference="protein motif:PFAM:PF01336"
                     /note="PFAM: nucleic acid binding OB-fold
                     tRNA/helicase-type;
                     KEGG: hma:rrnAC2302 replication factor A"
                     /codon_start=1
                     /transl_table=11
                     /product="nucleic acid binding OB-fold tRNA/helicase-type"
                     /protein_id="ACM55717.1"
                     /db_xref="InterPro:IPR004365"
                     /translation="MGVIEDVYEDLDTDVEFEEFEAAVEDKVEQMGGLADEETAAMLI
                     AHELRDEEADTIADIEPGMNDVKFLGKVTSIGDIRTFERDDEDAEEGRVCNVDVADAS
                     GSVRVALWDDMAAAAEEQLEVGQVLRVMGRPKEGYSGLEVSADKVEPDEDAEVDVQVL
                     DTYRVEDLSLGASDVDLVGQVLDTDSIRTFDRDDGSEGRVANLTVGDETGRVRVTLWD
                     DKADLVEEFEAGEVVEVGDGYVRERDGDLELHVGDRGTVERVDEDVEYVPETTDIAEL
                     EIGETVDIGGGVIETDPKRTFDRDDGSEGQVRNVRIKDDTGEIRVALWGDKADREIEL
                     ADRVVFTDVEVQDGWQDDLEASANWRSTVTVLDEGSDAVGGASGSGSAGSSDDGDAHG
                     TNNTGLGAFAGDEQKAAAEAVAGETGGDGGNSGVGGGNGGSGGAATATAEQSAEEIEF
                     TGTVVQTGDPVVLDDGQRTKSVETDASLRLGEEVTVRGTERDGTIDADDVF"
     gene            118230..118302
                     /locus_tag="Hlac_R0010"
                     /note="tRNA-Arg1"
     tRNA            118230..118302
                     /locus_tag="Hlac_R0010"
                     /product="tRNA-Arg"
     gene            complement(118518..120371)
                     /locus_tag="Hlac_0112"
     CDS             complement(118518..120371)
                     /locus_tag="Hlac_0112"
                     /inference="protein motif:PFAM:PF02254"
                     /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
                     sodium/hydrogen exchanger;
                     KEGG: nph:NP1576A TrkA-domain-containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="TrkA-N domain protein"
                     /protein_id="ACM55718.1"
                     /db_xref="InterPro:IPR003148"
                     /db_xref="InterPro:IPR006036"
                     /db_xref="InterPro:IPR006037"
                     /db_xref="InterPro:IPR006153"
                     /translation="MSSLLPVIAAILVSGLVVQLVAHHLKIPSVIFYLLIGVVLGPEV
                     LGLVTLDTFGNGLEIIVGISVAIIVFEGAFALRIERIRGASTVSLRLVTISALVMFLG
                     TAAAVRFFEGANWEISLLIGALLVATGPTVITPILNVVRVRDHVAAALETEGIVNDVT
                     AAIVAVVIFETLLLDDLGVPATLFSFVERLGVGVLAGVLATVVIYYLLDSDLVPERDV
                     QASQFLVLAAAVGAFAAAEAVAAEAGIAAAATSGILLGNLDINNREEIERFAENTTLV
                     VLSFVFISLAALINVEAIAALGLGAVALVLVIMLVLRPLGALIATAGVERFTRPERLF
                     LASVGPRGIIPASVATLFAIELELAGNVAAGELLVGTVFAVIFATVAIEAGLARQIGD
                     VLGVSPMRTIIIGGGRVGRALATRLERRGEYVVIVEIDDEEIERARSEGFTVHEGDGS
                     DTETLRGAGIGDAKRVITVTGDDDINLLACQLAITKFDIEAVYSRVNEPDNVDAFDSI
                     GVKAIDSPTATAVAIDDEIERPAITHWMSELGDSHDVQEVEVTAENLAGKTIRDLNAQ
                     IPDGTFVAVVSRDGENHVPSADSVLEYGDHVTFIGDTDAVKRAMKRFHPHD"
     sig_peptide     complement(120303..120371)
                     /locus_tag="Hlac_0112"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.724) with cleavage site probability 0.635 at
                     residue 23"
     gene            120592..120693
                     /locus_tag="Hlac_0113"
     CDS             120592..120693
                     /locus_tag="Hlac_0113"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACM55719.1"
                     /translation="MIVRNSIPMLAPLWSVGKRGRGTVVDRFDAVAA"
     gene            120825..121091
                     /locus_tag="Hlac_0114"
     CDS             120825..121091
                     /locus_tag="Hlac_0114"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: hsl:OE2878F hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACM55720.1"
                     /translation="MAVHPCHRATDVALRLAVPRDAAGDLHAGIRATIAGRDGVDVET
                     VDVVALRPRLNDLTVTVDASIRLAPGVEVDDLSETVGIHEARPR"
     gene            121191..121484
                     /locus_tag="Hlac_0115"
     CDS             121191..121484
                     /locus_tag="Hlac_0115"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACM55721.1"
                     /translation="MTRDHPPSRRTRHPDLYAGPAPPDRTPSWRATVVLAALPVLTLA
                     VAAFPTAAAFAAASLAGAVAGVALYRRYPDAFDRAFDRALSASGDEPVGAADG"
     sig_peptide     121191..121358
                     /locus_tag="Hlac_0115"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.873) with cleavage site probability 0.746 at
                     residue 56"
     gene            121664..122365
                     /locus_tag="Hlac_0116"
     CDS             121664..122365
                     /locus_tag="Hlac_0116"
                     /inference="protein motif:PFAM:PF03745"
                     /note="PFAM: protein of unknown function DUF309;
                     KEGG: nph:NP0312A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF309"
                     /protein_id="ACM55722.1"
                     /db_xref="InterPro:IPR005500"
                     /translation="MTDRECGSGSRETAAEDTDDGHAGDEGTIPTVPAALRAGAALFN
                     EGYVLAAHDPWEAAWLPLAEGSDERLLHGLIAAAAATHHAGARNWSGAVGCAGNAVEY
                     LGGVGPTPRGVDIEPVRDWCRRLATDPETIERTAPPTLRIEGPALRFGDLDLPAALLA
                     APALAGAVTHGDEATFETAAGLAREERETGRTQFAELLFAFLRESDTRPQVAARLADH
                     VELAQRKRRDVDDLF"
     gene            complement(122380..123276)
                     /locus_tag="Hlac_0117"
     CDS             complement(122380..123276)
                     /locus_tag="Hlac_0117"
                     /inference="protein motif:PFAM:PF01370"
                     /note="PFAM: NAD-dependent epimerase/dehydratase;
                     short-chain dehydrogenase/reductase SDR; 3-beta
                     hydroxysteroid dehydrogenase/isomerase; polysaccharide
                     biosynthesis protein CapD; Male sterility domain;
                     KEGG: hma:rrnAC2305 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent epimerase/dehydratase"
                     /protein_id="ACM55723.1"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002225"
                     /db_xref="InterPro:IPR003869"
                     /db_xref="InterPro:IPR013120"
                     /translation="MDEPVLLTGAGGRVGQAILRGIGDDYEWRLLDREPLPAAKVPDG
                     VTDADQYVADITNADAVREAMEGVGAVIHLAGDPRKTAPWDSVLRNNIDGTQVVMRAA
                     VDAGVKKFAFASSNHAVGGYETEERTPDLYRPDDGYRLDGTELPRPGNLYGVSKAAGE
                     SLGRFYHDEHGMSVVCVRIGNLTKDHPPREYERGQAMWLSHRDCGHLFDRCLQADYGY
                     EIVYGISNNDRRYYSIERAREVLGYDPADNSADYTFEGKPKDETGDENDNPTADGGET
                     RFDDPPAEPNFPSDPDTPTDGA"
     gene            complement(123355..123705)
                     /locus_tag="Hlac_0118"
     CDS             complement(123355..123705)
                     /locus_tag="Hlac_0118"
                     /inference="protein motif:PFAM:PF07783"
                     /note="PFAM: Protein of unknown function DUF1621;
                     KEGG: hsl:OE4713R hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Protein of unknown function DUF1621"
                     /protein_id="ACM55724.1"
                     /db_xref="InterPro:IPR012426"
                     /translation="MGIMSKILGGGGNRSVDDYVELDLDDFAEAHAETGMQVHIAEIG
                     DQGDVIPIKDAVYDGDFVIADITRHSTSDRTIEHIIDELRQVAREVDGDIVQKGDDQI
                     IVTPTGVSISREKL"
     gene            complement(123768..126563)
                     /locus_tag="Hlac_0119"
     CDS             complement(123768..126563)
                     /locus_tag="Hlac_0119"
                     /inference="protein motif:TFAM:TIGR01070"
                     /note="TIGRFAM: DNA mismatch repair protein MutS;
                     PFAM: DNA mismatch repair protein MutS domain protein;
                     MutS III domain protein; MutS II domain protein; MutS IV
                     domain protein;
                     KEGG: hma:rrnAC2532 DNA mismatch repair protein"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein MutS"
                     /protein_id="ACM55725.1"
                     /db_xref="InterPro:IPR000432"
                     /db_xref="InterPro:IPR005748"
                     /db_xref="InterPro:IPR007695"
                     /db_xref="InterPro:IPR007696"
                     /db_xref="InterPro:IPR007860"
                     /db_xref="InterPro:IPR007861"
                     /translation="MPTGIVGEFLDLKAETDADILAMQCGDFYEFFADDAELVADELD
                     LTVSQKSSHGSSYPMAGVPLSELTPYVKALVERGYRVAVADQYETEDGHAREITRVVT
                     PGTLLETADDDARYLAAIVREGDDADGPYGLALADVTTGRFLVTEVDDEGDLRAELYR
                     FDPAEVLPGPRVRNDDRLLGAVREDLSGSVSVFDAEAFAPGRAKHAVREQFGRETADS
                     VGIDSELALRAAGAVLGYVEETGAGVLASITRLTAYGDGDHVAVDATTQRNLELTETM
                     RGDADGSLFETVDHTVTAAGGRLLREWITRPRRDREELNRRLDAVEALASAALARDRL
                     RETLGDAYDLERLAARATSGSAGARELLSVRDSLALVPALADAVSGTALADSPVAAVL
                     ERIDRERAATLHDELADALAEDPPKTKTQGGLLRVGYDGELDELIARHEKANEWLDRL
                     AEREKRQYGLSHVTVDRNKTDGYYIQVGKSAADGVPEHYREIKTLKNSKRFVTDELEE
                     REREVLRLEEARGELEYELFEELRERVAADAELLQDVGRAVAEIDALASLATHAAGND
                     WTRPELADERRLDVEAGRHPVVERTTDFVPNDLRLDGERGFLIVTGPNMSGKSTYMRQ
                     AALIQLLAQAGSFVPARTATVGLVDGIYTRVGALDELAQGRSTFMVEMQELSNILHSA
                     TADSIVILDEVGRGTATYDGISIAWAATEYLHNEVRARTLFATHYHELTTLADHLPRV
                     ENVHVAVDKRDGEVTFLRTVRDGPTNRSYGVHVADLAGVPAPVVSRAGTVLDRLREEK
                     AIEAKGGARGGGGERGGFTGTADGDTKQVVFDLSSGSFSESDDAESTAAGAPGSGGGR
                     NGATPGSASDGASGSAGTAETAGAAETAESAETDRFDPETRAVIEELADVDVAETAPV
                     ELLSRVQEWQERLDENR"
     gene            complement(126648..127202)
                     /locus_tag="Hlac_0120"
     CDS             complement(126648..127202)
                     /locus_tag="Hlac_0120"
                     /inference="similar to AA sequence:KEGG:rrnAC3527"
                     /note="KEGG: hma:rrnAC3527 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55726.1"
                     /translation="MTPQLIGEKEATNNDADEPSRDEVFKALSNRRRRNVITYLKQHD
                     DDARVRDIAEQLAAWENDVEIPEVTYKQRKRVYTALHQSHLPKLAGGGFIDYEPNRGI
                     VSLTEESRQLEMYLEVVSGNEILWGEYYIGLAVVCGLLGGAAWIGTVPFAAVSGYAYA
                     VLFAVLFGLSGVIHRVSTRRNRLG"
     gene            127514..128425
                     /locus_tag="Hlac_0121"
     CDS             127514..128425
                     /locus_tag="Hlac_0121"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: hma:rrnAC0926 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACM55727.1"
                     /translation="MTASHDTDTPLGRLRRPEYTGENRCLPCTVVNVAIAAVGAVAVG
                     ALIAVELGAVVLAVALAAIWLRGYLVPGTPELTKRYLPGRALRLFGKGRDAGPPAEVD
                     AESYLLSAEVLVETPDGSDLAFAPWFESAWRTHLAALRDAADAEFGASSVPGEAVGAA
                     ETAPDGTCPASPADIAALARLAGVDEDGLSLRWRGEAGFAHAGNERIGHWESRSAFLA
                     DVAADRALTAHLDDWASLPLVSRSGVLGALRLFVERCPTCEGPVQLEERVVESCCSSY
                     EVVAGRCTACTARLFELDLPPSLAEAR"
     gene            complement(128659..129222)
                     /locus_tag="Hlac_0122"
     CDS             complement(128659..129222)
                     /locus_tag="Hlac_0122"
                     /inference="similar to AA sequence:KEGG:rrnAC3527"
                     /note="KEGG: hma:rrnAC3527 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55728.1"
                     /translation="MKLRTDLLPAEQVYTILANERRRRALEQLGSVGGVVTVHELSAL
                     VAGHETGESPPPKRCRESVYTSLVQTHLPKLEELGVIEYDRETQTIEVSRHARDVALY
                     TEVVASAGVTWSELYRALGVVSLTVLLAALLGVPLVSAIDPVLLTSLALALFAAASAY
                     QLWINRFSVLRQLRAGRSATLRLRRRG"
     gene            129671..131146
                     /locus_tag="Hlac_0123"
     CDS             129671..131146
                     /locus_tag="Hlac_0123"
                     /inference="protein motif:PFAM:PF00092"
                     /note="PFAM: von Willebrand factor type A;
                     KEGG: afu:AF1661 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="von Willebrand factor type A"
                     /protein_id="ACM55729.1"
                     /db_xref="InterPro:IPR002035"
                     /translation="MNPDTNDTIGLSRRTLLAGLGAVGVASAGAGLGTTAYFNDTESF
                     EGNTLTAGELDLKLDYRATYAGGPGRIDEINGWYPDFEVEEEEDGVYLIGEVPNIDEG
                     EWPDIVQERDFCAPDVGLINGDQIPVFTLDDVKPGDCGEVTISLHICDNPSWVWMNGE
                     LTANDENTVSEPEAGADGEGNALGDDSDGPISGEGELADAIDVTVWYDENCNNILDAD
                     AEEAGDSVCVQLVIDTSGSMGGSRIANTKSGAKQLAETILDANPDNQVGVTRFNNGAS
                     TPQQLTDDLDDVEAAIDGLSASGGTNAQAGVDAGQAELENCPHDNRVMVVFGDGDINT
                     DGSAAKVAGTEIFAIGVGGASFSDLEDLASDPADEHVFFAIDDGAIEQIFGQVAETIT
                     VGEEVIFEGSLAGAMAALSDGIALDGNRSVEGRQPYEGGLTQCIGFEWCLPAEVGNEV
                     QTDSVAFDLGFYAEQSRHNDAPDVSFNGTAPTSNSTANVSQ"
     sig_peptide     129671..129763
                     /locus_tag="Hlac_0123"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.928) with cleavage site probability 0.612 at
                     residue 31"
     gene            131279..132631
                     /locus_tag="Hlac_0124"
     CDS             131279..132631
                     /locus_tag="Hlac_0124"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: afu:AF1661 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACM55730.1"
                     /translation="MNDDTIGLSRRKMLVGLGAVGVASAGAGLGTTAYFNDTESFDDN
                     TLTAGELDLFVHVDYSEDQGSYAQYSTPDGTFIDGNVVGGGEGDPLSIQVSDLKPGDS
                     GEGEFCFSIVDNPAYMWMCGAVTENNENGQSEPEMDADTTGGDPGEGMGELADAMQVT
                     VSYCTDDDGEYALGEEIASGSLADVMSALDNGIPLSGDGDAEAPVDGRAPFEGVDSAF
                     VNETEVNAAEQCVCFEWEVPFDVGNEIQTDSVAFDFEFYAVQSRHNDGSANPCITSRE
                     VEGFGKQDYEPDADVLWASKARNGGSNTFELIVGDDNSNADTADYDFGGSSFDGDLTV
                     AYDADTGEATLELANGTTTDVSYAVSNAAGDVISIVARGSDASHLASVSNVRVNGTAP
                     TGPDAVEADGSETVSLLIEDVDASADWELTADVAFEGLDDDPSASDENPAVYVEVLDA
                     "
     sig_peptide     131279..131362
                     /locus_tag="Hlac_0124"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.869) with cleavage site probability 0.539 at
                     residue 28"
     gene            132752..134467
                     /locus_tag="Hlac_0125"
     CDS             132752..134467
                     /locus_tag="Hlac_0125"
                     /inference="protein motif:PFAM:PF00092"
                     /note="PFAM: von Willebrand factor type A;
                     KEGG: afu:AF1661 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="von Willebrand factor type A"
                     /protein_id="ACM55731.1"
                     /db_xref="InterPro:IPR002035"
                     /translation="MADNDNIDTIGLSRRTLLAGLGAIGVASAGAGLGTTAYFNDTES
                     FENNTLTAGQLDLLVDWQQTYDFGDGHQFVSAHPDHDGDGEQSIAADNDAGEIKYSDF
                     PDDEDEDSNGANIPVLDCETIPPLSEADFGTDPVTGEEMETLVQFTDVKPGDSGEITF
                     SLHLCDNPGYIWMQAGNVSDEGGAFTEPEDVAAGENAADLADAIDAKLWYDEDCDNVH
                     DDAGPIDIMLTLDFSGSMLYDQYGGVVSTDPIQVDGQSYGETTKIDLVELGTRQFIDY
                     LQAQNADVQVGVVYFDGEGSGENTPRTGILEPLTTNLSAVDTALSNLRQKLANVVSDA
                     APSTPFDNDGNPDPYSNADGIATGTYISEGLDDAQTELASNGRASAEKRNIVLSDGES
                     FNGDGNTNYAPPASAAANARAASPAPATDVYTINVNGSASTLQAMAGPAGGSGGDPVF
                     FNDINDPLNIPTVFGNLAAQTVAEKVIMEDTLANVLDALADGNGVPLDGNRATLYDEL
                     SDDPNDPDREAFRGDGVMHCVALSWELPFDVGNEIQGDTLRFDLGFYTEQARHNDGTG
                     PDLPA"
     gene            134667..135461
                     /locus_tag="Hlac_0126"
     CDS             134667..135461
                     /locus_tag="Hlac_0126"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: scl:sce5811 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACM55732.1"
                     /translation="MTQKESKLTRREALAGVGAVGFATLGAASGRPTGTDGWSEYSEY
                     TYAQSDTPWDLRVGWRRTVNGAVVGSSPIDGVVDVEAAGIRLVDVEDALPGDYGTASV
                     GLRLDDPAGTAPDGVRVWLRIDPRLGDADAASAALAERITLDVRYDTGILGIGGCGGA
                     ESDFAGYGEPIASGTLASLDGSALATGVELNPRLLGNGCLTTDERRCLIFAWEFESEG
                     GNAGQGGAVDFDVEFAADDCGAEGNPFEATDGASGDSSLDADGGSA"
     sig_peptide     134667..134759
                     /locus_tag="Hlac_0126"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.963) with cleavage site probability 0.327 at
                     residue 31"
     gene            135458..136537
                     /locus_tag="Hlac_0127"
     CDS             135458..136537
                     /locus_tag="Hlac_0127"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: GK18045"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACM55733.1"
                     /translation="MTLGDDGAGRPSEMSRRRLLAGIGGIGAAGMASGLGTGAYLSDR
                     ETFPNNGFGAGEVELVVNDTVSDGTFAVDVSEINRGHDGTERFDIEVRTNPVRVWLAT
                     DCPDASDALANVLEIKVIVDGESLTGDYRSLADVERDLVAGERLVEGCLDSDDRVTVE
                     VYWHLPASAPDEVAAETTDLTFRLYAEQCRHVSEADAAGSNPFADRVCEGPECVPCAD
                     ENGVKIGSLTLRYLGNEPADVVVVATGGGAGGVGGGGTEVFVAAVGPDETFVVDGSAS
                     PTGDPDWIGPNISVDDGSETGESNGNGNGNGNNGNGNGGNRPAGVNIHTSCSVSIGPG
                     DIYGDFEIVAATTTDGEPICGSEEL"
     gene            136537..137598
                     /locus_tag="Hlac_0128"
     CDS             136537..137598
                     /locus_tag="Hlac_0128"
                     /inference="protein motif:TFAM:TIGR02228"
                     /note="TIGRFAM: peptidase S26B, signal peptidase;
                     KEGG: sth:STH1180 signal peptidase, type I"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase S26B, signal peptidase"
                     /protein_id="ACM55734.1"
                     /db_xref="InterPro:IPR001733"
                     /translation="MNNPLTSPRLRKAANVLGIVLLIAIVAPFAVYAAPEIVGADESF
                     VVLTPSMTPEIAPGDVVIVAERDPTAIVEGDVITFARGASDVPVTHRVIDVVDEGGGL
                     AFETQGDANEGPDPGLVPAANLVGAVTLTIPYIGYVIQFAGTRTGFVMLVLLPFGLLA
                     ITEIWSVVRDRDERGASTAAAAESTDGSSDNSIDETGGKTTSSATPIEPAATSSGGVS
                     VDAVGGAAAVLAAFAPYAVYVALQLRTAAAIAIAVGASTLLLGALAAWVPASGVLDRG
                     EPVAKPSEDDGASDADWETPALADDPENGIDGRPTPTDGSTDAGDTSDPAAAIDGSGS
                     APPEAPPAPGQPNGAGEGN"
     sig_peptide     136537..136638
                     /locus_tag="Hlac_0128"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 1.000 at
                     residue 34"
     gene            137598..138137
                     /locus_tag="Hlac_0129"
     CDS             137598..138137
                     /locus_tag="Hlac_0129"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: mac:MA2926 cell surface protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACM55735.1"
                     /translation="MAGNRGLVGLLALAVLVWGVAFGGGLTVAVLTSSVNVTATFETT
                     DGLTAIDESIGSDPAAATVPVGNGTGDAEGLENVTVPPENVSLPSDEPVTNGSVTPKN
                     ETVPPENASEPTENAPESSENAVTPPTDEGAPTTNESAHTGNTAAESASAFRGSIPES
                     MTPDARRSMTSPTRSAGEA"
     sig_peptide     137598..137669
                     /locus_tag="Hlac_0129"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.990) with cleavage site probability 0.882 at
                     residue 24"
     gene            138341..139138
                     /locus_tag="Hlac_0130"
     CDS             138341..139138
                     /locus_tag="Hlac_0130"
                     /inference="protein motif:PFAM:PF02535"
                     /note="PFAM: zinc/iron permease;
                     KEGG: hma:rrnAC3110 metal transporter family GufA protein"
                     /codon_start=1
                     /transl_table=11
                     /product="zinc/iron permease"
                     /protein_id="ACM55736.1"
                     /db_xref="InterPro:IPR003689"
                     /translation="MVALDAFAFVFVAGLITALATGIGALPFFFFDSISDRGNVALWG
                     FASGIMLAASLFGLVDEGLAEGTPGEIGIGMLAGVALVVLAHDVLMDAEIDPQEYEEA
                     DFKKLVLILGVLTVHSFPEGIAVGVSFADLGLEGGTQLFGFTVPLLAVFMTLAISIHN
                     VPEGTAISIPLRSMGVSKWKMVWWSVFSSLPQPIGAVVAFAFVRYAREFLPYGFGFAA
                     GAMIYLVVSEFIPEALETGADLPGGGKPVLAGGIGLGVLLMVPLNFI"
     gene            139253..139912
                     /locus_tag="Hlac_0131"
     CDS             139253..139912
                     /locus_tag="Hlac_0131"
                     /inference="protein motif:PFAM:PF01323"
                     /note="PFAM: DSBA oxidoreductase;
                     KEGG: hma:rrnAC2450 thioredoxin"
                     /codon_start=1
                     /transl_table=11
                     /product="DSBA oxidoreductase"
                     /protein_id="ACM55737.1"
                     /db_xref="InterPro:IPR001853"
                     /translation="MSNTDAADAPTPDATESITIYSDYVCPFCYLGRQSFARYQETRE
                     EPLAIDWHPFDLRAGKRGPDGEIDDTADDGKDEEYYEQARENVRRLQEKYDAEMAQEL
                     RTDVDSLPAQIVSVHVRETAPESWLAFDEAIFAALWQDGRDIGDREVLADIAADVDGL
                     DPEIVDEALADDDLRDRVTDLFTAARERGVTGVPTFAYDGHAARGAVPPEQLERLVGD
                     V"
     gene            complement(139928..140752)
                     /locus_tag="Hlac_0132"
     CDS             complement(139928..140752)
                     /locus_tag="Hlac_0132"
                     /inference="protein motif:PFAM:PF01569"
                     /note="PFAM: phosphoesterase PA-phosphatase related;
                     KEGG: nph:NP2984A homolog 2 to
                     phosphatidylglycerophosphatase"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoesterase PA-phosphatase related"
                     /protein_id="ACM55738.1"
                     /db_xref="InterPro:IPR000326"
                     /translation="MSRLLSVVSSLAVWVGAALLVASVAIIGPRRLYALWDDLRDRLW
                     EIQRPLAALVIVLIASAVGRGSLQTVSELFGLQLTWAIYALEGNFVAWVQATFGSPEL
                     TVYFSAVYVYGYVFLLAFPFLAYLALPRTTTLKRLVVAYALNYAIGLVLYTVVLAYGP
                     RNVMPDMVTPLLFTHNPGIMALTGEINEATNVFPSLHTSLSVTVGTFAVLTRREYPLW
                     TPIAAWLAVSVVIATMYLGIHWLTDVIGGTALALGAVYLSYRLVDEDGSDSGAVRE"
     sig_peptide     complement(140684..140752)
                     /locus_tag="Hlac_0132"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.993) with cleavage site probability 0.598 at
                     residue 23"
     gene            complement(140749..142743)
                     /locus_tag="Hlac_0133"
     CDS             complement(140749..142743)
                     /locus_tag="Hlac_0133"
                     /inference="protein motif:PFAM:PF00496"
                     /note="PFAM: extracellular solute-binding protein family
                     5;
                     KEGG: nph:NP2986A dipeptide/oligopeptide/nickel ABC
                     transporter periplasmic substrate-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="extracellular solute-binding protein family 5"
                     /protein_id="ACM55739.1"
                     /db_xref="InterPro:IPR000914"
                     /db_xref="InterPro:IPR008162"
                     /translation="MTRQISRRGALAGGFAALSAGCLGRTRNIAGRDRSSQLTLEINA
                     PPADRDPNAIRIARHLAENLNAVGIDARISTLGHTDLRRKVLINHNFDVYVGQFREAE
                     PFDPDAMYAFTHSQFVAESGWQNPFGFTDINGVDELLATQRRADGDERREAVAELQRT
                     LGELQPFTVVAFPDPLIAVREDRFENWTNHQPLSVGGLLGLERSAAADGDADGSGAKI
                     EDGGTEAGNGTADGNETADGDEIDGNETAVNETDDGLIDDNPLTDDDDGADDAATLRL
                     VTTDERITQNWNPIAAEYRRYGTFTSLLYDRLVLVDDGEVIPWLAADWEQVGDAGVKI
                     SLREADWHDGEPVTAEDVAFTYEFLQDTSLGTTESPVPTPTFRGRVSAVETATAIDET
                     TVRLTLDGVNDAVGMRALQVPILPKHVWGERTDMATIAGFEFDAETTEAVVTNNENPI
                     GSGPVRFVEATPEESVVFERNPDHFLVRAADGGESAGDATDPLTEISERFHGKPAFGR
                     LEIEVMGSDIAAVQAVGDGFADATVSNLGPDSVPRIGREADARLVTGRSGGFYHIGYN
                     TRRAPLSNPRFRRVLASLIDKQTLVDVAFDGYAEPAASPLAATPEWVPSDLRWEDRET
                     DPVHPFVGESGSLDSETARNRLREVGYRFDEEGRLLAPNT"
     sig_peptide     complement(142669..142743)
                     /locus_tag="Hlac_0133"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.978) with cleavage site probability 0.962 at
                     residue 25"
     gene            complement(142865..144079)
                     /locus_tag="Hlac_0134"
     CDS             complement(142865..144079)
                     /locus_tag="Hlac_0134"
                     /inference="similar to AA sequence:KEGG:NP2990A"
                     /note="KEGG: nph:NP2990A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55740.1"
                     /translation="MRRTTVVVALLVVVGVGLAASGFFAGAGDEAPPPIVDEPAPSAV
                     EEESLITVDGDYRLWPYTSRDTSVEGRTLAINVLVHADAETTRHAIERRTGTDWEETE
                     EAEAAATADADQVLALVERDWADAHSSDRYSYMEEPDRGVWLGETFELHDGAYLGVRD
                     HLRAYESPDGTYTAVQAHEEYYDWFRLRHTVPGIDDPAVRLEDEFIYGAVDAEVSREY
                     RGMEGGWSDGWVSVIEPASVAMLGGALLRRRTRAAAVELARRTQREAVRHADAAVLGT
                     ALAALIVGVRVAGVALEAAYPGVGPKLIAGPLYLVIAVGIPALVVAQAPDSDPSAAFL
                     GVVVGLGAGFVIDFAALGVAVPPDLLVHRVALLAALGVVAIGRAAADRPVLAAGLVSW
                     AIGLTLPLADVI"
     sig_peptide     complement(143996..144079)
                     /locus_tag="Hlac_0134"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.916 at
                     residue 28"
     gene            complement(144141..144443)
                     /locus_tag="Hlac_0135"
     CDS             complement(144141..144443)
                     /locus_tag="Hlac_0135"
                     /inference="similar to AA sequence:KEGG:NP1286A"
                     /note="KEGG: nph:NP1286A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55741.1"
                     /translation="MDDQLERVIRQQLRKAGKQFEEAKRAYSEAKTDPAGDGSGAEQY
                     DLPTDDEGRARIVCRRHAERRAVAVDAEGRPSCFEGGHPDCEGCAEDVREGFVETW"
     gene            144799..145725
                     /locus_tag="Hlac_0136"
     CDS             144799..145725
                     /locus_tag="Hlac_0136"
                     /inference="protein motif:PFAM:PF01336"
                     /note="PFAM: nucleic acid binding OB-fold
                     tRNA/helicase-type;
                     KEGG: hma:rrnAC2744 replication factor A"
                     /codon_start=1
                     /transl_table=11
                     /product="nucleic acid binding OB-fold tRNA/helicase-type"
                     /protein_id="ACM55742.1"
                     /db_xref="InterPro:IPR004365"
                     /translation="MSELRQEAEAIAEQFSDHLDVGADEVEERLENLVNEYRVPLDEA
                     RRSVTNSYLEDAGMERDELGRGGSESVLVNEIDEDEQWVDLRVELVDLWEPRSDSISQ
                     VGLLGDESGTIKFVAFETSDLPELTEGQAYELSNVVTDEYEGSYSVKLNRTTQITEID
                     EEIEVGDNADTVEGALVDIQSGSGLIKRCPEEDCTRVLQNGRCSEHGQVEGEFDLRIK
                     GVLDDGETVTEVIFDREATEELTGMGLEEAKDMAMDALDTTVVAEEMGDDVLGRYYRV
                     TGPTFGRYVLVDEMEDPGAVDVENALIEARSI"
     gene            145726..146412
                     /locus_tag="Hlac_0137"
     CDS             145726..146412
                     /locus_tag="Hlac_0137"
                     /inference="similar to AA sequence:KEGG:HQ3264A"
                     /note="KEGG: hwa:HQ3264A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55743.1"
                     /translation="MSQSAPTREVARRVFATEFNDAGFTFTESDDERAPVYALLPTGE
                     SSNRVFFVGTLTEKEDVGEDAEYWRGRIVDPTGTFFVYAGQYQPEAASKLRDLEPPAY
                     VAVVGKPRTYETDDGTVRVSVRPESITEVDANTRDRWVAETAKRTIERAAAFDDEGNE
                     YARMAREEYDLDPETYKAAALSALEDLDESDGDELAGDGSEGDDTATDDTASDDTAPD
                     GSDSAGTPEP"
     gene            146517..146921
                     /locus_tag="Hlac_0138"
     CDS             146517..146921
                     /locus_tag="Hlac_0138"
                     /inference="similar to AA sequence:KEGG:NP5152A"
                     /note="KEGG: nph:NP5152A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55744.1"
                     /translation="MGNKNKTISFRVNEDAFETLRDIAEERDISLSAVFRDYVDTLVA
                     HDGQVRVIPEAELESMGDTGESFPPKIEVPKSFVREHERLELEADHLREQLEEHKRYV
                     NYLREQLEDGDEEVIQLEDLDGEPDEPSFRLG"
     gene            147209..148336
                     /locus_tag="Hlac_0139"
     CDS             147209..148336
                     /locus_tag="Hlac_0139"
                     /EC_number="1.2.4.1"
                     /inference="protein motif:TFAM:TIGR03181"
                     /note="TIGRFAM: pyruvate dehydrogenase
                     (acetyl-transferring) E1 component, alpha subunit;
                     PFAM: dehydrogenase E1 component;
                     KEGG: hsl:OE4113F putative branched-chain amino acid
                     dehydrogenase E1 component alpha subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate dehydrogenase (acetyl-transferring) E1
                     component, alpha subunit"
                     /protein_id="ACM55745.1"
                     /db_xref="InterPro:IPR000821"
                     /db_xref="InterPro:IPR001017"
                     /db_xref="InterPro:IPR017596"
                     /translation="MYEEVGSTVSVFDRAYDDPVRVLDEGGEVVGDVPDLDDEALVEM
                     YRDMRLARHFDGRAVSLQRQGRMGTYPPLSGQEGAQIGSATALDEDDWMVPSYREHGA
                     ALVRGLPLKQTLLYWMGHEAGNATPEGVNVFPVAVPIASQVPHATGAAWASKLRGEND
                     AFLCYFGDGATSEGDFHEGVNFAGVFDTPTVFFCNNNQWAISVPRERQTRSATLAQKA
                     EAYGIDGVQVDGMDPLAVYSVTKAAVEKARDPETDRPRPTLIEAIQYRFGAHTTADDP
                     TVYRDDDEVESWKRKDPIPRLERYLRSEGVLDDERVAEIETAVETRVAEAIEAAESEV
                     RPKPQEMFEHAYAELPPELERQYEEFAAFREAHGDEAFLEE"
     gene            148337..149323
                     /locus_tag="Hlac_0140"
     CDS             148337..149323
                     /locus_tag="Hlac_0140"
                     /inference="protein motif:PFAM:PF02779"
                     /note="PFAM: Transketolase central region; Transketolase
                     domain protein;
                     KEGG: nph:NP0558A 2-oxoacid dehydrogenase E1 component,
                     beta subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="Transketolase central region"
                     /protein_id="ACM55746.1"
                     /db_xref="InterPro:IPR005475"
                     /db_xref="InterPro:IPR005476"
                     /translation="MSETQNLTVVQAVRDGLYTEMREDDDVLVLGQDVGKNGGVFRAT
                     EGLFDEFGGDRVVDTPLAESGIVGAAVGMAAMGLKPVPEIQFSGFMYPGFDQIVSHMA
                     RFRTRSRGRFNLPMTLRAPYGGGIRAPEHHSESKEAFYAHEAGLKVVIPSTPYDAKGL
                     LAASIRDPDPVIFLEPKLIYRAFRGEVPEEPYTVPIGEAVTRREGGDVAVFTYGAMTR
                     PTLEAAETLAEEGIDCEVVDLRTVSPLDREAIIEAFEATGRAVVVHEAPKTGGLAGEI
                     TAIIQEEALLYQEAPVKRVTGFDVPYPLYALEDYYLPTATRIEEGIREAVEF"
     gene            149326..150945
                     /locus_tag="Hlac_0141"
     CDS             149326..150945
                     /locus_tag="Hlac_0141"
                     /inference="protein motif:PFAM:PF00198"
                     /note="PFAM: biotin/lipoyl attachment domain-containing
                     protein; catalytic domain of components of various
                     dehydrogenase complexes; E3 binding domain protein;
                     KEGG: hsl:OE4115F dihydrolipoamide S-acyltransferase (E2
                     component of branched-chain amino acid dehydrogenase)"
                     /codon_start=1
                     /transl_table=11
                     /product="catalytic domain of components of various
                     dehydrogenase complexes"
                     /protein_id="ACM55747.1"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR001078"
                     /db_xref="InterPro:IPR004167"
                     /translation="MPVKEFKLPDVGEGVAEGELVTWLVAPGDRVEEDQPVAEVETDK
                     ALVEVPSRYDGTVEELFVEEGDIVPVGDVIISFRVGEDGEDVEAGGDDSAETGADATE
                     PEPETDIGAETDAESDAETEPDTPPGRTFAPPSARRLARELGVDIAVVDGSGPGGRIG
                     EADVRAHAEGGGDHAGADAGDSGSDKAPAPTPTDVGSSDRKSAVHKRGDDGSAESSAD
                     APSAAGAPESAGRETTLATPATRKVARELGVDIDDVPTDETRDGEAFVTGEIVRAYAE
                     ALESGASPAADAVDTSAPEPKSADASLSAPGSADETIPYRGVRRTIGKQMERSKYTAP
                     HVSHHDTAEVDGLVAAREELKRRAEEQGVKLTYMPFVMKAIVAGLKEYPSLNSELRED
                     DEEIVLKGDYNLGIAVATDAGLMVPVVENVDEKGLFELAEEVRDLASRARERKLTPAE
                     MKGGTFSITNFGAIGGEYATPIINYPETAILGLGAIEERPVVRDGEVVAAPTLPLSLS
                     IDHRVIDGAVAAEFANTVMEHLEHPLLLLTQ"
     gene            150945..152372
                     /locus_tag="Hlac_0142"
     CDS             150945..152372
                     /locus_tag="Hlac_0142"
                     /inference="protein motif:TFAM:TIGR01350"
                     /note="TIGRFAM: dihydrolipoamide dehydrogenase;
                     PFAM: FAD-dependent pyridine nucleotide-disulphide
                     oxidoreductase; pyridine nucleotide-disulphide
                     oxidoreductase dimerisation region;
                     KEGG: hsl:OE4116F dihydrolipoamide dehydrogenase (glycine
                     cleavage system protein L and E3 component of
                     branched-chain amino acid dehydrogenase)"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrolipoamide dehydrogenase"
                     /protein_id="ACM55748.1"
                     /db_xref="InterPro:IPR000103"
                     /db_xref="InterPro:IPR000815"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR004099"
                     /db_xref="InterPro:IPR006258"
                     /db_xref="InterPro:IPR012999"
                     /db_xref="InterPro:IPR013027"
                     /translation="MVVGDIATGTEVLVIGAGPGGYVAAIRAAQKGLDTTLVEKDAYG
                     GACLNRGCIPSKALITGSGLAHEAGNAESMGIHADPAVDMGKMVEWKDGVVDRLTGGV
                     EKLCKANGVNLVPGTASFVDEHTARVAHGGQGQGSESIEFEHAIIATGSRPIQIPGFE
                     FAEDHVWSSADALDADTVPDRLGIVGGGYIGMELATTYAKLGADVTVVEMLDDILDPY
                     EDDVKRIVRKRAEELGVEFHFGEGASEWSEGADGGYLLHTETEEGEESTYGADKILVA
                     VGRQPVTDGLDVDNAGIETDDRGFIETDDRTRTAVEHIHAVGDVAGDPMLAHVASKEG
                     IVAAEVIAGEPTALDQQAIPAAVFTDPEIGTVGMTEEEAEADGFDPVVGEMPFNASGR
                     AMTTGHTEGFVRLVADDETGFVLGAQIVGPEASELIAEAALAIEMGATLEDVAATVHT
                     HPTLAEAVMEAAENARGQAIHTLNR"
     gene            complement(152412..152609)
                     /locus_tag="Hlac_0143"
     CDS             complement(152412..152609)
                     /locus_tag="Hlac_0143"
                     /inference="protein motif:PFAM:PF00403"
                     /note="PFAM: Heavy metal transport/detoxification protein;
                     KEGG: hma:pNG6048 mercuric transport protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Heavy metal transport/detoxification protein"
                     /protein_id="ACM55749.1"
                     /db_xref="InterPro:IPR006121"
                     /translation="MSQTITVEGMSCEHCEQSVTEALEGVDGVESATADRESKSATVE
                     GDADSDALVSAVNDAGYDASA"
     gene            152741..153355
                     /locus_tag="Hlac_0144"
     CDS             152741..153355
                     /locus_tag="Hlac_0144"
                     /inference="protein motif:SMART:SM00344"
                     /note="SMART: regulatory protein AsnC/Lrp family; TRASH
                     domain protein;
                     KEGG: hma:pNG6047 putative metal-binding transcription
                     regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator, AsnC family"
                     /protein_id="ACM55750.1"
                     /db_xref="InterPro:IPR000485"
                     /db_xref="InterPro:IPR011017"
                     /db_xref="InterPro:IPR013838"
                     /translation="MRDLDETDLEILSLLAEDARRPFSEIGDRVGLSGPAVSDRVTRL
                     EETGVIKRFTVDVDRTKLRAGVPVLVDVELPVGAESTDGSNTLDAARERVRDADAVEH
                     QFVTAEGDLRVYARVEGRNVREWVVGLFEGVGVEDYTVTLVDEFEWTPSIEGVEFALT
                     CAECSNTVDSEGETARIDGEVYHFCCPSCLSQFRERYQRLEEGA"
     gene            153676..153771
                     /locus_tag="Hlac_0145"
                     /pseudo
     gene            complement(153791..154177)
                     /locus_tag="Hlac_0146"
     CDS             complement(153791..154177)
                     /locus_tag="Hlac_0146"
                     /inference="similar to AA sequence:KEGG:rrnAC3248"
                     /note="KEGG: hma:rrnAC3248 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55751.1"
                     /translation="MSNSAALVEFDAPPVSVAPTDNATSESDGTAVTVTADGWRAASN
                     GDDGERASLTLERAQTAGRMLIPEQVMRRRNRGYRNLLAFTDEAVERVVLRTDTRTAD
                     QTVGFDNETTRFRYADQAYRVARGEP"
     gene            154553..154882
                     /locus_tag="Hlac_0147"
     CDS             154553..154882
                     /locus_tag="Hlac_0147"
                     /inference="similar to AA sequence:KEGG:rrnAC3097"
                     /note="KEGG: hma:rrnAC3097 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55752.1"
                     /translation="MADEFDPEKFEDKYAHYFNELQRAYKNAFNQMNDRYDSELIHGI
                     DQTVLNESEPFYEDGEFRVELPENPRERIRGAVPVDDELFKEALNEYVDRIESELYRT
                     LGVDRPE"
     gene            154985..155362
                     /locus_tag="Hlac_0148"
     CDS             154985..155362
                     /locus_tag="Hlac_0148"
                     /inference="protein motif:PFAM:PF01106"
                     /note="PFAM: nitrogen-fixing NifU domain protein;
                     KEGG: hwa:HQ3465A NifU domain-containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogen-fixing NifU domain protein"
                     /protein_id="ACM55753.1"
                     /db_xref="InterPro:IPR001075"
                     /translation="MSTDTTDADNDLRERITNFLRRNFPQIQMHGGSAAISHLDRESG
                     EVTVQLGGACSGCGISPMTIQAIKSRMVKEIPEIETVHADTGAGAGADGDLGGTSSGG
                     MSPSFPGETTDDGGDDEGPQAPF"
     gene            155576..155995
                     /locus_tag="Hlac_0149"
     CDS             155576..155995
                     /locus_tag="Hlac_0149"
                     /inference="protein motif:PFAM:PF03479"
                     /note="PFAM: protein of unknown function DUF296;
                     KEGG: hwa:HQ3460A PolA operon protein (DNA-binding
                     protein)"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF296"
                     /protein_id="ACM55754.1"
                     /db_xref="InterPro:IPR005175"
                     /translation="MHHREVESTAEYVARFETGADWREEIEDLARAEDVEAGWFTALG
                     AVQDAEVWFYDQDETEYQSVTFDEPLEVAACVGNVSLLDGDVFAHTHVVLSRPSGQAL
                     AGHLDSATVWAGECHLRAFAEPLERSHDAATDLDLWL"
     gene            156012..160112
                     /locus_tag="Hlac_0150"
     CDS             156012..160112
                     /locus_tag="Hlac_0150"
                     /EC_number="2.7.7.7"
                     /inference="protein motif:TFAM:TIGR00354"
                     /note="KEGG: hsl:OE4293R DNA-directed DNA polymerase type
                     III subunit 2 (intein-containing);
                     TIGRFAM: DNA polymerase II, large subunit DP2;
                     PFAM: DNA polymerase II large subunit DP2-like;
                     SMART: Hedgehog/intein hint domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase II, large subunit DP2"
                     /protein_id="ACM55755.1"
                     /db_xref="InterPro:IPR003587"
                     /db_xref="InterPro:IPR004475"
                     /db_xref="InterPro:IPR006141"
                     /db_xref="InterPro:IPR016033"
                     /translation="MRPDDERYFAQIEDRLDEAWDVAEAAKEQGHDPKPKIEIPIARD
                     MADRVENILGIDGVAERVRELEGEMSREEAALELVTDFVEGTVGDYDSRAGKVEGAVR
                     TAVALLTEGVVAAPIEGIDRVELLENDDGTEFVNVYYAGPIRSAGGTAQALSVLVADY
                     ARSLLDIDEYKPRDVEVERYAEEISLYDKETGLQYSPKDKESKFIAQHMPVMLDGEAT
                     GDEEVSGFRDLERVDTNSARGGMCLVAAEGIALKAPKIQRYTRDLDEVDWPWLQDLID
                     GTIGKDGGGASDEAPENAGAEGDDDSEDTAGNESDGDDADDADSETDGPAGPLRPKSS
                     QKFLRDLIAGRPVFTHPSEAGGFRLRYGRARNHGFATGGVHPATMHLVDDFLAAGTQI
                     KTERPGKAHGVIPVDSIEGPTVRLANGEVRRIDDPEEAKEIRNGVEKVLDLGEYLVNY
                     GEFVENNHPLAPASYVYEWWVQEFETAGADVQAMRDDPHVDLEHPDVDEALAWAREYD
                     CPLHPEYTYLWHDVSVDAFEALADAVAAGDVVEGVLAIERTETTQHALESLLVQHVAT
                     PDALRIPTWRPLARSLGIDDGLRKTWSADDLSAAAREWDDGENAVKAINEVAPFEIRE
                     RAPTRIGNRMGRPEKSESRDLSPAVHTLFPINEAGGPQRDVAEAAGTMDDSGHRGRLD
                     LEVSDRVCPDCGEHTYRAQCPDCGVHTDLHYECGDCGTVCEPDEAGRVECPRCEWEVT
                     AATYQEVDLNDAYRSALETVGERESAFEILKGVQGLTSRNKTPEPIEKGVLRAKNGVT
                     SFKDGTVRYDMTDLPVTSVRAEELDITADHLREIGYETDIDGEPLRHDDQLVELRVQD
                     IVLSDGAAEHMLKTAGFVDDLLEQFYGLDRFYEFNERDDLVGELVFGMAPHTSAATVG
                     RVVGFTSAAVGYAHPYFHAAKRRNCFHPETEIEYRDDAGWHRETIEKFVEERLNDPQT
                     DDFGTLVNELDGNVEVPSIDEHGNKSTQPVTAVSKHLSQDHLVQVETQRGRSIRVTPD
                     HTMLRVADGGVQKVAANELEIGDSVPTTTLRHEMSVGATVDVTTDGGIEADTVASVDF
                     LESDIEHTYNLTVAETHTLAANDLLVAQCDGDEDCVMLLMDGLLNFSKTFLPDQRGGR
                     MDAPLVMSSRIDPSEIDDEAHNVDIAREYPREFYDATLEMADPESVEDLIQIGEDTLG
                     TDEEYHGFGHTHDTTDIAMGPDLSAYKTLGDMMEKMDAQLELARKLRAVDETDVAERV
                     IEYHFLPDIIGNLRAFSRQKTRCLDCGEKYRRMPLSGDCRECGGRVNLTVHEGSVSKY
                     VDTAIEVADRFGCRPYTKQRLKVLDQSLESIFEDDTNKQSGIADFM"
     gene            complement(160558..161202)
                     /locus_tag="Hlac_0151"
     CDS             complement(160558..161202)
                     /locus_tag="Hlac_0151"
                     /inference="protein motif:TFAM:TIGR01182"
                     /note="TIGRFAM: 2-dehydro-3-deoxyphosphogluconate
                     aldolase/4-hydroxy-2-oxoglutarate aldolase;
                     PFAM: KDPG and KHG aldolase;
                     KEGG: hwa:HQ1495A KHG/KDPG aldolase
                     (4-hydroxy-2-oxoglutarate aldolase;
                     2-dehydro-3-deoxy-phosphogluconate aldolase)"
                     /codon_start=1
                     /transl_table=11
                     /product="2-dehydro-3-deoxyphosphogluconate
                     aldolase/4-hydroxy-2-oxoglutarate aldolase"
                     /protein_id="ACM55756.1"
                     /db_xref="InterPro:IPR000887"
                     /translation="MNETLSRLVDSGVVAVLRGVEADQLIEITEALRDGGVTAVEITA
                     DTPNVAEKLSEVAGSFDDEVVVGTGTVLDSETARTTLMAGAEFVVSPSLHEDVIETCN
                     RYGAVSAPGVMTPTEAIRGYEAGADFVKVFPAKTVGPAHLGAMKGPLGQIPMMPTGGV
                     GPDNAADYIDAGAFAVGAGGALVDYDAAARGDYESITETARQFVQVVEDARGDD"
     gene            161417..163606
                     /locus_tag="Hlac_0152"
     CDS             161417..163606
                     /locus_tag="Hlac_0152"
                     /inference="protein motif:TFAM:TIGR00490"
                     /note="TIGRFAM: translation elongation factor aEF-2; small
                     GTP-binding protein;
                     PFAM: elongation factor G domain protein; protein
                     synthesis factor GTP-binding; elongation factor Tu domain
                     2 protein; elongation factor G domain IV;
                     KEGG: nph:NP0130A elongation factor EF-2"
                     /codon_start=1
                     /transl_table=11
                     /product="translation elongation factor aEF-2"
                     /protein_id="ACM55757.1"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR004543"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR005517"
                     /translation="MGRRKKIVQECERLMDEPDNIRNIAIAAHVDHGKTTLSDNLLAG
                     AGMISQDTAGEQLAMDTKEDEQERGITIDAANVSMTHEYEDTNHLINLIDTPGHVDFG
                     GDVTRAMRAVDGALVVVDAVEGAMPQTETVLRQALREGVKPALFINKVDRLISELQEG
                     PQEMQERLMSVIADVNELIRGMAENMDDIPEDWTVSVEDGTVGFGSALYKWGVSMPSM
                     QRTGMDFGDIMDLEQNDKRDELHERTPLSDVVLDMVCEHFPNPVDAQPRRVPRIWRGD
                     AESELADTMRMVNEDGEVVFMVTDISMDPHAGEIATGRVFSGTLEKGQELYVSGTAGK
                     NRIQSVGLFMGSEREEVDRVPAGNIASVTGLRDAIAGSTVSSVEMTPFESIEHISEPV
                     ITKSVEAQNMDDLPKLIETLQQVAKEDPTIQIEINEDTGEHLISGQGELHLEVITQRI
                     RDNQGIPVITGEPIVVFREQPQEASREVEGQSPNRHNKFYLTVEPMAQEIVDAIQLGE
                     VSMDMPELERREALQEAGMDKDTSQNVEDIHRTNILIDDTKGIQHLNETMELVLEGLQ
                     EALDDGPLAAEPVQGSLFRLHDAKLHEDTIHRGPAQVIPAVRNAVHRSLIDGEVRLLE
                     PIQDVRIDVPSEHMGAASGEIQGRRGRVDDMYQEGDLMVVEGIAPVEEMIGFSSDIRS
                     ATEGRASWNTENAGFRVLVDNLQREKIMEIRERKGMKLELPQSIDYF"
     gene            complement(163679..164173)
                     /locus_tag="Hlac_0153"
     CDS             complement(163679..164173)
                     /locus_tag="Hlac_0153"
                     /inference="similar to AA sequence:KEGG:pNG7166"
                     /note="KEGG: hma:pNG7166 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55758.1"
                     /translation="MGDDGLTISGPSTVRGAVLMLVIGLAATGYGAYDYTQQSNAVED
                     AVEVDATITDLDIESTSAGSSTDVSYRPTVRFTYEYEGTAYASTNVFPSTISTNYDTE
                     STARSVVEEYAVDESATAYVDPSDPDAGFLKHRTSSAPLLAITIGLFFVLVGGSSAVK
                     RTRG"
     gene            164607..165221
                     /locus_tag="Hlac_0154"
     CDS             164607..165221
                     /locus_tag="Hlac_0154"
                     /inference="protein motif:PFAM:PF01842"
                     /note="PFAM: amino acid-binding ACT domain protein;
                     KEGG: hwa:HQ3387A allosteric regulator of homoserine
                     dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid-binding ACT domain protein"
                     /protein_id="ACM55759.1"
                     /db_xref="InterPro:IPR002912"
                     /translation="MSDGRDGAPEERDDAGDGESVDGAASLDGGHASATPSTHTVRLE
                     LVDEPGQLLAALHPIADNGGNLLSIYHERGNKTPRGRIPVEVDFEATPERFEGIVEAL
                     RSEGVNVMQAGTERYAEEVTLLLFGHLIDTDLSDTLSRIEACESASVADVSLAAPQGT
                     EEVSSARLRLEARAGETETALAAVRELAAEKNLRLVEPLTGVEA"
     gene            165218..166204
                     /locus_tag="Hlac_0155"
     CDS             165218..166204
                     /locus_tag="Hlac_0155"
                     /EC_number="1.1.1.3"
                     /inference="protein motif:PFAM:PF00742"
                     /note="PFAM: dihydrodipicolinate reductase; homoserine
                     dehydrogenase; homoserine dehydrogenase NAD-binding;
                     KEGG: nph:NP0302A homoserine dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="homoserine dehydrogenase"
                     /protein_id="ACM55760.1"
                     /db_xref="InterPro:IPR000846"
                     /db_xref="InterPro:IPR001342"
                     /db_xref="InterPro:IPR005106"
                     /translation="MKLAVIGAGAVGRSVVDLAGEYGHEVVAVADSSSAVVADGSDGR
                     DAGVDSDAVVARKAERGIVGDDDPDDALAADYDALVEATPTTLGDAEPGFSHVRTALE
                     RDRHAVLANKGPVAERFGDLRALVADSAGDIRFEATVGGAIPAVSTVEDIEPGHVTAV
                     RGVLNGTANFILTRMAAEGLDYDHVLAEAQDLGVAEADPSFDVDGTDAALKCVILANV
                     LSFGAADDPDDAREFSLDDAAVEGIRDVPGSALRLAAEDGRTVRLIGEATEETVRVAP
                     RLVPENGTLAVSGTQNIVQIETTHAGRLNISGRGAGGPETASAVLGDVGRLQ"
     gene            166392..167657
                     /locus_tag="Hlac_0156"
     CDS             166392..167657
                     /locus_tag="Hlac_0156"
                     /EC_number="2.7.7.4"
                     /inference="protein motif:TFAM:TIGR00483"
                     /note="TIGRFAM: translation elongation factor EF-1,
                     subunit alpha; small GTP-binding protein;
                     PFAM: protein synthesis factor GTP-binding; elongation
                     factor Tu domain protein; elongation factor Tu domain 2
                     protein;
                     KEGG: nph:NP0304A elongation factor 1-alpha"
                     /codon_start=1
                     /transl_table=11
                     /product="translation elongation factor EF-1, subunit
                     alpha"
                     /protein_id="ACM55761.1"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004160"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR004539"
                     /db_xref="InterPro:IPR005225"
                     /translation="MSDKPHQNLAIIGHVDHGKSTLVGRLLFETGSVPEHVIEQHREE
                     AEEKGKGGFEFAYVMDNLAEERERGVTIDIAHQEFDTDNYYFTIVDCPGHRDFVKNMI
                     TGASQADNAVLVVAADDGVAPQTREHVFLARTLGINEIIIGVNKMDLVDYKESSYDQV
                     VEEVNDLLNQVRFATDDTTFVPISAFEGDNISEESENTPWYDGPTLLESLNDLPESEP
                     PTDAPLRLPIQDVYTISGIGTVPVGRVETGILNIGDNVSFQPSDVGGEVKTVEMHHEE
                     VPKAEPGDNVGFNVRGLGKDDIRRGDVCGPADDPPSVAETFKAQVVVMQHPSVITAGY
                     TPVFHAHTAQVACTIEEINQKIDPASGEVAEENPDFIKSGDAAVVTVRPQKPLSIEPS
                     GEIPELGSFAIRDMGQTIAAGKVLEVNER"
     gene            167661..167969
                     /locus_tag="Hlac_0157"
     CDS             167661..167969
                     /locus_tag="Hlac_0157"
                     /inference="protein motif:PFAM:PF00338"
                     /note="PFAM: ribosomal protein S10;
                     KEGG: nph:NP0306A 30S ribosomal protein S10P"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal protein S10"
                     /protein_id="ACM55762.1"
                     /db_xref="InterPro:IPR001848"
                     /db_xref="InterPro:IPR005729"
                     /translation="MQQARVRLAGTSPEDLDDICADVREIADSTGVALSGPIPLPTKT
                     LEIPSRKSPDGEGTATWEHWEMRVHKRLIDIDADERALRQLMRVQVPNDVSIEIVLED
                     "
     gene            complement(168080..168640)
                     /locus_tag="Hlac_0158"
     CDS             complement(168080..168640)
                     /locus_tag="Hlac_0158"
                     /inference="protein motif:PFAM:PF01694"
                     /note="PFAM: Rhomboid family protein;
                     KEGG: hma:rrnAC2647 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Rhomboid family protein"
                     /protein_id="ACM55763.1"
                     /db_xref="InterPro:IPR002610"
                     /translation="MRATLETLAIASLVGIAQGALRLVDLAAIFALSTPLSVAPWTVV
                     TSVYAHGSIGHLLANALALLLVGPLVERRTTRLRFHAFVIGTGALAGITQVTLGGLLG
                     PQTAVLGLSGAVFGLGGYLLASNVVSATLFDRLRLSTRAQFALFGLAALVLTATTAAP
                     GVALIAHATGAFCGLVTGRAGLLDVQ"
     gene            complement(168693..168989)
                     /locus_tag="Hlac_0159"
     CDS             complement(168693..168989)
                     /locus_tag="Hlac_0159"
                     /inference="similar to AA sequence:KEGG:pNG6132"
                     /note="KEGG: hma:pNG6132 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55764.1"
                     /translation="MTDAETDADAKPIRMWLVERTYSDDEQNMVILTYATTDGERYFR
                     KERALTSFTDIRDTTAAVDADPANVGAVNDPADRERYAVEAKRMAAAHAPDNVI"
     gene            169187..170362
                     /locus_tag="Hlac_0160"
     CDS             169187..170362
                     /locus_tag="Hlac_0160"
                     /inference="protein motif:PFAM:PF03706"
                     /note="PFAM: conserved hypothetical protein;
                     KEGG: nph:NP2244A glycosyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55765.1"
                     /db_xref="InterPro:IPR005242"
                     /translation="MTGGRVRGWIRGRLSRKRLTVVGTLAVLAVGVVVVVRALDADAV
                     VAAAGAADPTLLVVALGVYVLSWPVRGRRYADVLAAMGRRCRTGFLTATVFASQTANL
                     IVPARAGDGVRAYLLKDRRDVPYPTGVASLAVERAFDLVAIGVLGGVALAFLLLTGRS
                     PGSGDSVGTVAPSTALAAAAGIAAVAATVSVATVAVARSDRRFGPALRAQTEHPRLSR
                     AVDAVVRFGSSVRVVAANPRRLGAVFLWSAVVWTLDVLTAVLVLAALTGGIGVFVPTP
                     TLLVVGTLAVSVGNLAKVLPLSQGGIGLYEAAFTGLVVSTTGLPVETALAAAILDHAL
                     KNAVTLAGGGVAALALGLSPTAGPASDGDPRPEAVSGDGAANAAGESELSNSGPPDF"
     sig_peptide     169187..169303
                     /locus_tag="Hlac_0160"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.900) with cleavage site probability 0.826 at
                     residue 39"
     gene            170385..171566
                     /locus_tag="Hlac_0161"
     CDS             170385..171566
                     /locus_tag="Hlac_0161"
                     /inference="similar to AA sequence:KEGG:rrnAC0905"
                     /note="KEGG: hma:rrnAC0905 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55766.1"
                     /translation="MEERRPDAASGDICVIVPTIREYECLREYVANAREHGFDVSRLH
                     FVLVTEDFCDVDEMQSMLDDLGVSGKVFDGSRREEWYEANEVAEYGHVVPAASHAETS
                     FGLLYMWADESFEYGLFIDDDTLPHDDEDYFGRHMENLGFEGAIERVSSDKQWVNVLY
                     QNADEHGLYPRGYPYSAMNETVETGTVEVESGEVVASQGLWTNVPDLDAVRILMDGDL
                     EGQAQTRTTADDFGSDFVAARDNYLTVCSMNLAFRREVIPAFYQLPMDDNEWEVGRFD
                     DIWSGVFLKRACDVLGKRIYNGGPLCEHNKAARSTFDDLHNEVAGLELNEHLWELIDD
                     AGADADDYVAVYDAMADRLTDSEFDEYRNGAFFTHVGEHMRDWLDCLDALRRTPAVAD
                     D"
     gene            171606..172763
                     /locus_tag="Hlac_0162"
     CDS             171606..172763
                     /locus_tag="Hlac_0162"
                     /inference="similar to AA sequence:KEGG:HQ2545A"
                     /note="KEGG: hwa:HQ2545A ABC-type iron(III) transport
                     system,substrate-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC-type iron(III) transport
                     system,substrate-binding protein"
                     /protein_id="ACM55767.1"
                     /db_xref="InterPro:IPR006311"
                     /translation="MTNYLPDGVDRRQFLAATGALGVAGLAGCTGDDTDGGSGNSSDG
                     GDGGDGGDGSIGQIGSGREGRGAPGGIPMAEMPDLEGELTVYSGRGEFLVGELVEYIE
                     DQYDDFDLTVRYAGSTDLVNQILNEGDGSPADVFYSVNAGSLGTLAGEGRSQALSSEI
                     TDMVRSEFRTEQWIGTSGRARTVPYNTGEFSDDDLPDDIMAYPEEFAGSLGWAPSYGS
                     CQAFITAMRLIEGEEATLAWLESVVEAGISSYPDEFAACQAIADGEIDAAFTNHYYIQ
                     RVLDGNPDASIGTAFTSGDAGAVFNVAGAAVVDTASDATLAENFIRHLLSAEAQDYFA
                     RSTFEYPLIPDVEPIGDLPTIDELDVPDIDLTELSDLEPTIDLMREAGVEV"
     gene            172833..175013
                     /locus_tag="Hlac_0163"
     CDS             172833..175013
                     /locus_tag="Hlac_0163"
                     /inference="similar to AA sequence:KEGG:rrnAC0910"
                     /note="KEGG: hma:rrnAC0910 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55768.1"
                     /translation="MSRGRARLARADRLTLAAAFVAVATGAFTFVIAATLFRYHSVNH
                     DEGVYLMQAALLLSGQLEIHAGALADAVHPWFFIEDGGRLYPKYNPVPAAMYAVSMWL
                     FGEPRATLAVVAAGNAALVYVLGSTAFDRRVGLAAAVLFVASPLALATSSVFLPYAPT
                     TLLNLLFAVAYLRGVRDRSLALAGLAGVAIGLAFFARPFTAVLFAAPFILHAVVRVAV
                     AVREVEILSPSLPGTVRRHGFTALFGTVFVGVTLAYNFRLTGSPLTFPYEAFAPMDGP
                     GFGERRILGHSEEYTLELALRSNGYALWYLATRWVVAGPLGTLLAFAGGGLATRRWLS
                     GRRALAEGDSGVEPLTERRFERTAGLLLAGVVVSVVVGNLFFWGTNNLLATLSDPTNG
                     LVAGFGPFYHFDLLVPLSIFGGVAVVAGGRGLSRLRVWLASRVTPESAQAIVVAVAVL
                     ALFGGALGAAAVVEAPLDRHAAYADKYEAAYEPIESASFDDDLVFVPTPYGEWLQHPF
                     QSLRNDPGLDGEVVYALNRDPAEDFAVIDAYPDRELHRYAYRGVWTPNPNRHVAPKLE
                     SLDVREGARIDASTTVGVPDRVQRAVVRLETDRGDGHAEYDVSDPDDSLAVDWSVGPD
                     GARLAGDPNATVPIDPEGDEVIVTVTLVDPAGSTFTYRQEATVRSTDEGIDGDGVEVV
                     WPPERSVCRLVTECGTGGTYIPDDPDAHAEWVVFETNAEANEER"
     sig_peptide     172833..172934
                     /locus_tag="Hlac_0163"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.998) with cleavage site probability 0.950 at
                     residue 34"
     gene            complement(175429..176217)
                     /locus_tag="Hlac_0164"
     CDS             complement(175429..176217)
                     /locus_tag="Hlac_0164"
                     /inference="protein motif:PFAM:PF00535"
                     /note="PFAM: glycosyl transferase family 2;
                     KEGG: hma:rrnAC0912 glycosyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family 2"
                     /protein_id="ACM55769.1"
                     /db_xref="InterPro:IPR001173"
                     /translation="MSSLTAPGDEATADDSVDIDPTEQTDDSTARADDTEYTFDDVSV
                     VMGTYNEEEAIGTVLSDIDEVTGGRAEIVCVDGSSDRTPEIAREHGARVVEQEPQGYG
                     VAVREAILTPDRPVVVTTDCDDTYPMEQLPEFLEAINDGADVVSGDRLYHGAKAMPAF
                     NRLGNHAFAAIASVLMGERVHDTTTGMRAYRREVVEDIGWTENTGLSAELLIRPLMRG
                     HDVRERPIDYAERLGETKLDPIEGGVAIAKSIVTVCLEEQLRRL"
     gene            complement(176274..177869)
                     /locus_tag="Hlac_0165"
     CDS             complement(176274..177869)
                     /locus_tag="Hlac_0165"
                     /inference="protein motif:PFAM:PF00732"
                     /note="PFAM: glucose-methanol-choline oxidoreductase; GMC
                     oxidoreductase;
                     KEGG: hsl:OE2509R oxidoreductase-like protein"
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-methanol-choline oxidoreductase"
                     /protein_id="ACM55770.1"
                     /db_xref="InterPro:IPR000172"
                     /db_xref="InterPro:IPR000425"
                     /db_xref="InterPro:IPR007867"
                     /translation="MSAENTDRTPVANADVCVVGAGPAGALVADRLAADHEVIVLDAG
                     PRFDPADRLDRQERAIRPSYDRPDVWDVGGERDAHSNAGERFYPLNHARVKGIGGSTL
                     HWQGMVMRLHEDDFASGTERGVGPDWPIDYADLRPYYAAAERELGVAGASDNPYAPPR
                     EEPHPMPAFEPSYSDSLFAEACEELEIDMHSVPNARNSEAYDGRSACVGYGTCQPVCP
                     AGAKYDATVHIERAEEKGATVIDRAPVQRLEHDADRITAAVYATPDGEEYRQEADAFV
                     VACGGVETPRLLLLSESDAYPDGLANSSGAVGKFFMDHLFAGVGGTLDEPTRQNHVGF
                     YTSACDQFYDEADEEVGPFKLEFLNYAGPSPVEEALTGDDWGDTLVERLRDGYGTHVA
                     MGGLVEQLPQSDSYVGLDPDRTDDHGNPVPEIHWSVGDRALRTIERANEIQRSVLEEL
                     GAEIEWVAGPDATGPAYHHMGTTRMSADPDAGVVDADCRTHDLDNCWIASSSVFPTSG
                     AMNPTLTIAALALRVADDVRDRL"
     gene            complement(177866..178396)
                     /locus_tag="Hlac_0166"
     CDS             complement(177866..178396)
                     /locus_tag="Hlac_0166"
                     /inference="similar to AA sequence:KEGG:OE2510R"
                     /note="KEGG: hsl:OE2510R hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55771.1"
                     /translation="MELTRRDATAALAAVGATGGVALAALREGDRAEDEGTLDEESVR
                     ASMVAVATVVYPSAVDGVEAFVNRFLDGRLTGSTHADGLHTAVSELDDAARSWHGVPI
                     ADLSESDCDRLLREVGADIAEEDRDGTLAERVRYYVVNELLLALYASPTGGELVGLEN
                     PQGHPGGTESYQRGPR"
     sig_peptide     complement(178322..178396)
                     /locus_tag="Hlac_0166"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.998) with cleavage site probability 0.993 at
                     residue 25"
     gene            178511..180121
                     /locus_tag="Hlac_0167"
     CDS             178511..180121
                     /locus_tag="Hlac_0167"
                     /inference="protein motif:PFAM:PF00528"
                     /note="PFAM: binding-protein-dependent transport systems
                     inner membrane component;
                     KEGG: hwa:HQ2544A ABC-type iron(III) transport system,
                     permease protein"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport systems
                     inner membrane component"
                     /protein_id="ACM55772.1"
                     /db_xref="InterPro:IPR000276"
                     /db_xref="InterPro:IPR000515"
                     /translation="MSWTRRIRDILTDGDDRLPLGLTLLSAAIAGTVVFPLAWLVIEA
                     VTVERSRAMELLFSSGTVEVLLNSLLLMAGVTVFSILLGVPLAYLTARTDLPFRRFWS
                     VVAALPLVVPSYVGAFAFVSAFGPRGEFHDVLAPLGIDRVPEIYGLPGTILVITLYTY
                     PYVYLTTRAALLSFDTTLIEAARTLNHGRLEAFRRVTLPVIRPAIAAGSLLAALYAVS
                     DFGTPSIMRLPVFTRQIYVEYNAFGRDYAALLSLQLLAVVLVVLALEWLVRSNRDAHG
                     DDAGSTNRLVNLGRWRWPATLLPASVSAVALLVPIWILLLWLLRSEAGRRPSMAFEPI
                     QVINSVSVAAAAAVVAALAAIPIAYFAATSDSPLATLFERATYVGFAVPGIVLALALV
                     YFGSGYLPWIYQTLPLLVFAYVVRFLPQVVGSTRTAILGVDPKLVEAGRTLGESSMGA
                     FRRVTFPLTRSGIVAGAALVFLTTMKELPVTLILRPSGFETIVTQIWRAQETALYQYA
                     VVPTLILLVISGLSMVVILTQEGGEEGL"
     gene            180231..181163
                     /locus_tag="Hlac_0168"
     CDS             180231..181163
                     /locus_tag="Hlac_0168"
                     /inference="protein motif:PFAM:PF01370"
                     /note="PFAM: NAD-dependent epimerase/dehydratase;
                     short-chain dehydrogenase/reductase SDR; 3-beta
                     hydroxysteroid dehydrogenase/isomerase; polysaccharide
                     biosynthesis protein CapD; dTDP-4-dehydrorhamnose
                     reductase; Male sterility domain;
                     KEGG: hsl:OE2110R nucleoside-diphosphate-sugar epimerase
                     (UDP-glucose 4-epimerase)"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent epimerase/dehydratase"
                     /protein_id="ACM55773.1"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002225"
                     /db_xref="InterPro:IPR003869"
                     /db_xref="InterPro:IPR005913"
                     /db_xref="InterPro:IPR013120"
                     /translation="MDLTDSTALVTGGAGLVGSHLAAQLLDRGATVRVADDLSKGDRD
                     RVPDGAEFVEADLTDPDDVAEAVTDDLDIVFHFAAYTDTNYDDDRELFEANTAMTYNV
                     LERMHEVGVDRLAFTSSSTVYGEAPRPTPEDYGPLEPISIYGSSKLADEALISTHAHS
                     YGVQSWVFRFANIVGPHQRGNVIPDFIQKLDADPSELEILGDGRQEKSYMHVSECVDA
                     IQHVVEHADEDLNVYNLGTETTTSVTDIADIVSDELGVDPEYAYTGGDRGWTGDVPKM
                     RLSIERLADLGWEPSIESDEAVRRSARELIDEIV"
     gene            181632..183440
                     /locus_tag="Hlac_0169"
     CDS             181632..183440
                     /locus_tag="Hlac_0169"
                     /EC_number="6.1.1.19"
                     /inference="protein motif:TFAM:TIGR00456"
                     /note="TIGRFAM: arginyl-tRNA synthetase;
                     KEGG: nph:NP0066A arginine--tRNA ligase"
                     /codon_start=1
                     /transl_table=11
                     /product="arginyl-tRNA synthetase"
                     /protein_id="ACM55774.1"
                     /db_xref="InterPro:IPR001278"
                     /db_xref="InterPro:IPR005148"
                     /db_xref="InterPro:IPR008909"
                     /db_xref="InterPro:IPR015945"
                     /translation="MFRQFRSEVADALGDALASLDLPTDDLGIERPPDDMDATLASSV
                     AFRLAGEVGDAPPNVAATVADAVDVDGYDYLAAVDTAGPYVNFHPGERYFVDTLDASA
                     VDSGYGALPDRDTSVVVEHTSANPTGPVHVGRARNPIVGDAVANLLEYAGYDVDRHYY
                     VNDAGRQMAVFTWAYERFDESDLAGEPARARAEYDLVRYYRKGNAYLEEADPEAVEAA
                     EEEIAAILQGLEAGDEETYERVGEVVDTVLGGMKECLARLPAEFDEFVKETRFMRDGS
                     TDDIAARLKETDHAVYEEDAWQLELDDWGIDKNLVFLRSDDTSLYTTRDLAHHEWKFD
                     NYDRAVTVLGEDHKLQADQLDATLELLGNDIDRLGHVIYSYVNLPDGKMSTRRGTGVM
                     LDDLLDEAIDRAREAVETRMDDRIRDDDLTEEDVERIAHEVGIGAVRYDIVSKQPAKA
                     ITFEWEDALDFEGQSAPFVQYVHARCCGILDEAADAGIEVPGVTADSEGVVDVGALDV
                     DATVFETDAARDLLREVARFPAAIESAADDLEPHTIATFTREFADAYNAFYRECPVVT
                     SDDEELRAARVALVAAAKHTMANALDVLGVEAPESM"
     gene            183918..185168
                     /locus_tag="Hlac_0170"
     CDS             183918..185168
                     /locus_tag="Hlac_0170"
                     /inference="protein motif:PFAM:PF03464"
                     /note="PFAM: eRF1 domain 1 protein; eRF1 domain 2 protein;
                     eRF1 domain 3 protein;
                     KEGG: hwa:HQ3241A peptide chain release factor 1"
                     /codon_start=1
                     /transl_table=11
                     /product="eRF1 domain 2 protein"
                     /protein_id="ACM55775.1"
                     /db_xref="InterPro:IPR005140"
                     /db_xref="InterPro:IPR005141"
                     /db_xref="InterPro:IPR005142"
                     /translation="MSSDAQEASDDRRKYEFRKVIEELRDFEGSGTQLVTIYIPEDRQ
                     VSDVVAHVTQEHSEASNIKSKQTRTAVQDALTSIKDRLRYYDTFPPENGMVIFSGAID
                     AGGGQTDMVTRTLESPPQPVESFRYHCDSAFLTEPLEHMLEDSGLFGLIVLDRREANV
                     GWLKGKRVEPVKSASSLVPGKQRKGGQSAQRFARLRLEAIDNFYQEVAGMADDLFVDK
                     RHELDGILVGGPSPTKDEFLDGDYLHHELQDKVLGKFDVAYTDESGLKDLVDNASEAL
                     ADQEIVEDKRHMDEFFENLHTGEEATYGFDQTRRNLIMGSVDRLLISEDLRSDVVVYE
                     CPNGHEEYEVVDSRHSTPSHECSECGEEADVDEREDVIEHLMSIAEQRGTDTKFISTD
                     FEKGEQLLDAFGGIAGILRYSTGV"
     gene            complement(185202..185642)
                     /locus_tag="Hlac_0171"
     CDS             complement(185202..185642)
                     /locus_tag="Hlac_0171"
                     /inference="protein motif:PFAM:PF01325"
                     /note="PFAM: iron dependent repressor;
                     KEGG: nph:NP1496A transcription regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="iron (metal) dependent repressor, DtxR family"
                     /protein_id="ACM55776.1"
                     /db_xref="InterPro:IPR001367"
                     /translation="MNTADQYLKTIYVVQKQEDGPASTGSVADALGVSPASANEMIGK
                     LEDLGLAEHEKYKGVQLTDDGIVRARDALQTYCIIERFLANVLAVEDFREEAHELEAV
                     IDDTVAERLDTIIDRQPECPDCFDPETDACACLEIAATPIEPEQ"
     gene            complement(185686..186171)
                     /locus_tag="Hlac_0172"
     CDS             complement(185686..186171)
                     /locus_tag="Hlac_0172"
                     /inference="similar to AA sequence:KEGG:OE1785F"
                     /note="KEGG: hsl:OE1785F hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55777.1"
                     /translation="MSVSQRIASDDQLARLLQIGIVLEEVVEARAHHHYQSLDAELDD
                     EIEALLADAAEESAEHRQRLESLIEGLGVDSVPFDEIESLVDARYGRTRPEDFDGVLY
                     DQLCNEETAYKFYDDLIDAIEDSDAEFTIDRAELLDELHAIREDEAEGVSEVTAVMER
                     R"
     gene            complement(186309..186908)
                     /locus_tag="Hlac_0173"
     CDS             complement(186309..186908)
                     /locus_tag="Hlac_0173"
                     /inference="similar to AA sequence:KEGG:rrnAC3443"
                     /note="KEGG: hma:rrnAC3443 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55778.1"
                     /translation="MADDKDGREKQARDDDDRQRRRDIATELERGDEPEPEIDAADLG
                     DVEAELESLEFPATGAEIIAAIGDRDIGPSAERYTVEQLVPETDKVQFDSPDRVRVRI
                     RRPTVATAMKRIVEASETLPNEELGGSQHDAYEKTFVELARVSPDDYDESIGVVRDWV
                     VDRIRDKEKLPTSRQIRRQAAKVCRESGHEIRNDDWLGI"
     gene            complement(187023..188237)
                     /locus_tag="Hlac_0174"
     CDS             complement(187023..188237)
                     /locus_tag="Hlac_0174"
                     /inference="protein motif:PFAM:PF01458"
                     /note="PFAM: SufBD protein;
                     KEGG: hwa:HQ1708A ABC-type transport system involved in
                     Fe-S cluster assembly, permease protein II"
                     /codon_start=1
                     /transl_table=11
                     /product="SufBD protein"
                     /protein_id="ACM55779.1"
                     /db_xref="InterPro:IPR000825"
                     /translation="MSTKAIESLSEDTVRRIAEERDEPEWLLETRLNALSALETADLP
                     DVIQTPGRRWTDLEALDFEALVDPLNQSDTTERSAGDDDVVILPFSEAFDEYGDIIEA
                     NFGSVLDPEHNYLTALSVALFTTGTFVYVPEGVDVEDVTVRAEMNSRSLFSQTLVVAE
                     ESSSVTILESIESGDDGVDGDRYFSNLVEIVAGENANVQFGSLQNLDDDSYTYSLKRG
                     VTDTYATVDWIESNFGSKLTRSDVETELNGDGSESQIVGTFFGTEDQHFDINARVWHQ
                     AEHTTADLVTRGVLDDVSRSVYEGVQDVGEDAWNTSSYQRENTLMLSDDAEADASPKL
                     IIHNHDTEASHSATVGQVDAEDLFYLESRTIDPLTARNMLVEGFFVPVLEEIAVDEFR
                     DDVQELVLQRLQ"
     gene            complement(188239..189669)
                     /locus_tag="Hlac_0175"
     CDS             complement(188239..189669)
                     /locus_tag="Hlac_0175"
                     /inference="protein motif:TFAM:TIGR01980"
                     /note="TIGRFAM: FeS assembly protein SufB;
                     PFAM: SufBD protein;
                     KEGG: hwa:HQ1707A ABC-type transport system involved in
                     Fe-S cluster assembly, permease protein I"
                     /codon_start=1
                     /transl_table=11
                     /product="FeS assembly protein SufB"
                     /protein_id="ACM55780.1"
                     /db_xref="InterPro:IPR000825"
                     /db_xref="InterPro:IPR010231"
                     /translation="MSSQQDELKETDTEARFEFKKEEKSAFQTEKGLTEETVRVISED
                     KDEPEWMLERRLRALEQFQEMPMPTDWPGQPDLSEVDIDEIIPYIRPDVDVRAGVDDW
                     TELPDEIKDTFDKLGIPEAEKNALSGVGAQYESEVVYQNMQEQWEEKGVIFCNMDEAV
                     REHEEIVREHFMTKCVPPSDNKFAALHGAIWSGGSFVYVPENTTVDMPIQAYFRMNSK
                     GMGQFEHTLIIAEEGSEVHYIEGCSAPKYSAFNLHSGGVEVFVGEDAHVQYSTVQNWS
                     KNTYNLNTKRAIAEKGGRMEWISGSMGSKATMLYPSTILKGRGASDNHITIAFAGEGQ
                     DIDTGAKVYHNAPNTKSTVESKSIAKDGGRTNYRGLVHIADGAENSSTAVECDALMFD
                     NKSTSDTMPYMEINESKVDVAHEATVGKIGDEDIFYLQSRGLDDDDAKQMIVSGFIEP
                     ITEELPIEYAVELNRLVELEMEGSLG"
     gene            complement(189722..190639)
                     /locus_tag="Hlac_0176"
     CDS             complement(189722..190639)
                     /locus_tag="Hlac_0176"
                     /inference="protein motif:TFAM:TIGR01978"
                     /note="KEGG: hwa:HQ1706A ABC-type transport system
                     involved in Fe-S cluster assembly, ATP-binding protein;
                     TIGRFAM: FeS assembly ATPase SufC;
                     PFAM: ABC transporter related;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="FeS assembly ATPase SufC"
                     /protein_id="ACM55781.1"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010230"
                     /translation="MATLEINDLHARVAEEDGERILRGVDLTVESGDIHALMGPNGSG
                     KSTLAKVIAGHPAYEVTGGEILLHLDEEDVADIDAELDDEDYHWKLLELEPNERAALG
                     IFLGFQYPAEIEGVTMTNFLRQALNAKADEREELFEDEEAEADADEDDEGYDTSPMEG
                     PADDGEIGVAEFQQILSEKMELLDMDEKFMQRYLNAGFSGGEKKQNEVLQAAMLEPAV
                     AVLDEIDSGLDIDRLQDVSKGINALRDEQGTGVLQITHYQRILDYVEPDHVHVMLDGE
                     VVKSGGAELAEKLEDKGYDWVREDAFEAA"
     gene            complement(190774..193563)
                     /locus_tag="Hlac_0177"
     CDS             complement(190774..193563)
                     /locus_tag="Hlac_0177"
                     /inference="protein motif:PFAM:PF00136"
                     /note="PFAM: DNA polymerase B exonuclease; DNA polymerase
                     B region;
                     SMART: DNA-directed DNA polymerase B;
                     KEGG: hsl:OE1777F DNA-directed DNA polymerase type II"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase B region"
                     /protein_id="ACM55782.1"
                     /db_xref="InterPro:IPR006133"
                     /db_xref="InterPro:IPR006134"
                     /db_xref="InterPro:IPR006172"
                     /translation="MTQSGLSDFSSPGDADDGTRDSMETEREDMAAQEAAVVAGGGRG
                     HVSDVVDVDEAKFPESTGTVELMITQIDYAVEGYGSDEYPVVHVFGRRPVDDGDDAVE
                     HLRVLGVEPYFYVPTADLNGDPTEEYDVVIGTREENVEGEPYESIRGEPLTRIVTRTP
                     RDVGNIRDDFATTFEADILFPNRLLIDNGLNGGVRVQERRLDDGSDAIQVHEGHLEPA
                     EIDAEMRVNTFDIEVDDRRGFPEDGEEPIICLTSHDSYDDEYVVWLYDAPEAEIPPPE
                     DLPDYEGIVGDGGGEIDFEVRTFETEAAMLDAFIEYIDDTDPDLLTGWNFEDFDAPYV
                     LDRLEVLDDGSQYDLSIDRLSRIGEVWRSGWGGPDIKGRVVFDLLYAYKRTMFTELES
                     YRLDAVGERELGVGKERYTGDIGDLWEQDPERLLEYSIRDVELCVEIDRKQDVIAFWD
                     EVRTFVGCKIEDAPTPGDTVDMYVLHKAFGKFALPTKGQQESEEFEGGAVFDPITGVK
                     EMVTVQDLKSLYPMCMVTINAGPETKVDPGKYDGEMYVAPNGTHFQKEPDGIMREMVD
                     ELLSEREEKKGLRNDHDPGTEPYEQYDRQQGAVKVIMNSLYGVTGWDRFRLYDKEGAA
                     AVTATGREVIDFTEEAANELNYQVSYGDTDSVMLSLSNMSKEEAIETSFEIEDHINER
                     YDDFARDELNADVHRFQIEFEKLYRRFFQAGKKKRYAGHIIWKEGKDVDDIDITGFEY
                     KRSDIAQITKEVQQNVIETIVTGDDIDEDLEEIKSYLVDVIARVLGGDMDLDEIGIPG
                     GIGKKLDAYDTPTAQVRGAKYANLMLGTNFGSGSKPKRLYIEKVHPDFWQRMEDEEGL
                     DPQRDHLYGEFKRDPDVICFEYADQVPDEFKVDWEKMLDKTLQGPIERVIEALGLSWE
                     EVKTGQEQTGLGSFM"
     gene            193665..193838
                     /locus_tag="Hlac_0178"
     CDS             193665..193838
                     /locus_tag="Hlac_0178"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACM55783.1"
                     /translation="MSSDPRSEPQVARPADRDPGAAEVEVYEDGGNVVLFDAANPLAW
                     VEASRTVRLADAT"
     gene            193935..194345
                     /locus_tag="Hlac_0179"
     CDS             193935..194345
                     /locus_tag="Hlac_0179"
                     /inference="similar to AA sequence:KEGG:NP4602A"
                     /note="KEGG: nph:NP4602A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55784.1"
                     /translation="MFSLDEDDEGEVSFGESSDAEREMTPDIPKAPSVKTFDDSGDFE
                     GASDVDSRTLRAFVVAVIYANAAVLLVALGPMLWFFEGWSRIGPVLFFLGLLAGVRTY
                     QTYRAWERARDATESDSEGDGDDEGDADHSPPEA"
     gene            194373..194810
                     /locus_tag="Hlac_0180"
     CDS             194373..194810
                     /locus_tag="Hlac_0180"
                     /inference="similar to AA sequence:KEGG:rrnAC1838"
                     /note="KEGG: hma:rrnAC1838 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55785.1"
                     /translation="MQTVRDAAGETYLLVKRSAESSRVRDPATGEERYVDNDELRIVD
                     GESPLATAASGVPAPVRRTLRAVRDDRSLGLLAVVVDEGPIAAIDLLDAADMCESDLH
                     GTITEFRAAGLIDEAEVAGQRGYEATPVAVEAIELLRGGSEDE"
     gene            complement(195108..197816)
                     /locus_tag="Hlac_0181"
     CDS             complement(195108..197816)
                     /locus_tag="Hlac_0181"
                     /inference="protein motif:PFAM:PF02463"
                     /note="PFAM: SMC domain protein;
                     KEGG: hma:rrnAC1840 chromosome segregation protein"
                     /codon_start=1
                     /transl_table=11
                     /product="SMC domain protein"
                     /protein_id="ACM55786.1"
                     /db_xref="InterPro:IPR003395"
                     /db_xref="InterPro:IPR013134"
                     /translation="MNFDRVRLSNFKPYGDADLRLTEGVTVIHGLNGSGKSSLLEACF
                     FALYGSKALDGTLGDVITNGEEETEVDLWFTHDGASYHIERRLKEYDGRIDHQCTLET
                     TDGSDVTRDGARAVREFVTELLRMDAEAFVNCAYVRQGEVNKLINATPRERQDTIDDL
                     LQLGKLEEYRERAGDARLGVEDVLENRRGRLDQLDDQIAEKKEKDLHDRLNGLESDLS
                     EVTDEIDRYETQREQAKETREAAAETLSTHAEKRETLESVAAEIDEIEATIREAERER
                     DEHRDAVREARERVEEIEAAIDGRLDGAGLDAASDETIAERRAELDGREETVREELDD
                     ERVSAEAFRNQATNLTGKADDRAERAAEIESEADDLGDEAEAAADEADERESSVEELR
                     EEAETLRERFAAADADIDRDGVADEREALRERRGEVRERIAELSAELKNARDRVEEAE
                     ELLAAGKCPECGQPVEDSPHASGIDEDREQVAELEAELEEARERESDLDDRLAELSEL
                     ASAADRLDEIDETVETLEDRVEEKHAEADRKREAAAEKRERVEDLREEAEETHDVATE
                     KREEAEAAAERVAELEDALAAVDDAREAVAAIEEQLSAIADAEDEIERRREKRENLNE
                     VNDERRDRLADKRERRDELAEAVDEAAVDEARERKETAEEYLEKVDGELDRLAERRTE
                     LENAIGGVNSEIQELENLREERESLAERVDALEDLHEETSELEAMYGDLRAELRQRNV
                     AELERTLNETFELVYGNDAYSHIELDGEYVLTVYQKDGEPLDPEQLSGGERALFNLSL
                     RCAIYRLLSEGIEGAAPTPPLILDEPTVFLDSGHVSRLVRLVEEMRGFGVRQILIVSH
                     DDELVGAADELVTVEKDPRTNRSTVRREDAADLDAAELDIAELADD"
     gene            complement(197813..199123)
                     /locus_tag="Hlac_0182"
     CDS             complement(197813..199123)
                     /locus_tag="Hlac_0182"
                     /inference="protein motif:PFAM:PF00149"
                     /note="PFAM: metallophosphoesterase;
                     KEGG: hma:rrnAC1841 phosphoesterase"
                     /codon_start=1
                     /transl_table=11
                     /product="metallophosphoesterase"
                     /protein_id="ACM55787.1"
                     /db_xref="InterPro:IPR004843"
                     /translation="MTRVIHTGDTHMGYTQYHSPVRRQDFLDAFAAVIDDAIEGEVDA
                     VVHAGDLFHDRRPELTDLMGTISILRRLDDAGVPFLAVVGNHESTRGGQWLDLFERLG
                     LATRLGDDPTVVGDTSFYGLDHVPVSRRDDLDYAFDDHDADYAALVAHGLFEPFGYAD
                     WDTETVLTESDVDFDAMLLGDNHTPDVAKVDGTWVTYPGSTERASASEREGRGYNLVT
                     FDADAAGGDDRVEIRRRALDTRPFVFVEVDLREGEGAARVREKVRQHDLGDAVVLVDV
                     TGEGDPVTPAAIEEFATDEGALIARVTDRREVETDAEIDVSFADPEDAVRERVEEMGL
                     SEAAFDVEEAVRADTIPDTNVRETVKRRVEERIDDLDDLDAFDRGETVDGDAEAEDNE
                     AELADDEAELADDETDGEPIGGKDDTATASAADIDEQVSMEDYL"
     gene            complement(199189..199524)
                     /locus_tag="Hlac_0183"
     CDS             complement(199189..199524)
                     /locus_tag="Hlac_0183"
                     /inference="similar to AA sequence:KEGG:NP1520A"
                     /note="KEGG: nph:NP1520A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55788.1"
                     /translation="MVSTAAVKQALSALASRTDTATRPSVAVIDEADAARSDLRRAAG
                     FVDSGGLDRLDEAIAAAERAGDEAAAERGREARAAFRRFREAAADSDNRGGDDRAGDD
                     RACDDERGR"
     gene            complement(199643..199906)
                     /locus_tag="Hlac_0184"
     CDS             complement(199643..199906)
                     /locus_tag="Hlac_0184"
                     /inference="similar to AA sequence:KEGG:HQ1541A"
                     /note="KEGG: hwa:HQ1541A ArsR family transcriptional
                     regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="ArsR family transcriptional regulator"
                     /protein_id="ACM55789.1"
                     /translation="MSATDAVAAEEDVTDRWSAVRDLPPSAKLVAKVLDYNDTLTQSE
                     LAEETLLPPRTVRYALSRLEEEDVVDSRFSFADARKRLYTLSV"
     gene            200047..201264
                     /locus_tag="Hlac_0185"
     CDS             200047..201264
                     /locus_tag="Hlac_0185"
                     /EC_number="5.6.1.1"
                     /inference="protein motif:TFAM:TIGR01242"
                     /note="KEGG: hwa:HQ1544A proteasome-activating
                     nucleotidase;
                     TIGRFAM: 26S proteasome subunit P45 family;
                     PFAM: AAA ATPase central domain protein; ATPase associated
                     with various cellular activities AAA_5;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="26S proteasome subunit P45 family"
                     /protein_id="ACM55790.1"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005937"
                     /db_xref="InterPro:IPR011704"
                     /translation="MTDTVDDVELPYDEGSASRQEKIESLQEELDVLESQNEEMRDKL
                     LDANAENNKYQQKLERLTHENKKLKQSPLFVATVQEITPDGAVIKQHGNNQEALTEIT
                     AEMREKLNPDDRVAVNNSLSVVKKLEKETDVRARVMQVEHSPDVTYADIGGLEEQMQE
                     VRETVEMPLEHPDMFEDVGITPPSGVLLYGPPGTGKTMLAKAVANETDATFIKMAGSE
                     LVHKFIGEGAKLVRDLFEVARENQPAVLFIDEIDAIASKRTDSKTSGDAEVQRTMMQL
                     LSEMDGFDERGEVRIIAATNRFDMLDPAILRPGRFDRLIEVPKPNTEGREIIFQIHTR
                     KMNLASDINFDELAEMTPDASGADIKAICTEAGMFAIRDDRTEVTLDDFLGAHEKLQQ
                     DDETGADDSLAFA"
     gene            complement(201320..201466)
                     /locus_tag="Hlac_0186"
     CDS             complement(201320..201466)
                     /locus_tag="Hlac_0186"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACM55791.1"
                     /translation="MDLDLSTRGLPTDDGWRALAGVGVGYAIATGLIFALFFIVPYVV
                     LRAL"
     gene            complement(201550..202725)
                     /locus_tag="Hlac_0187"
     CDS             complement(201550..202725)
                     /locus_tag="Hlac_0187"
                     /inference="protein motif:PFAM:PF01368"
                     /note="PFAM: phosphoesterase RecJ domain protein;
                     phosphoesterase DHHA1;
                     KEGG: hma:rrnAC1856 putative RNA binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoesterase RecJ domain protein"
                     /protein_id="ACM55792.1"
                     /db_xref="InterPro:IPR001667"
                     /db_xref="InterPro:IPR003156"
                     /translation="MWSLSVTDDRLSQAEAMARESPEFVVAAAVVAIVAIVGAYVLFR
                     VRRTPGVKFHRLLAERDEIAVLMHPNPDPDAMSAALGVASLAEQLDVDATVQYPGQIR
                     HQENRAFRTVLDLELDPIEHVSDLAAESIVLVDHNEPRGFAGADGVLPLAVVDHHPGD
                     GAGEAFTDVRTDYGATASVVAEYFQQNDATPVPPDKHASETDSDLTLPTDTATGLLYG
                     ILTDTKHLTVGASESDFAAAAYVYPGVDQDRLDRIANPAVDAEVLEVKARAIAGRQIE
                     GSFAVADVGGVNNVDAIPQAADELIQLEGVSAVVVIGERDGTVHLSGRSRDDRVHMGN
                     AIGSVLSDLDNGNGGGHSRMGGGTVAPTIDPAGDEEPETVDRDALTDDLFRALAGDV"
     gene            complement(202816..203745)
                     /locus_tag="Hlac_0188"
     CDS             complement(202816..203745)
                     /locus_tag="Hlac_0188"
                     /inference="protein motif:PFAM:PF01370"
                     /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
                     hydroxysteroid dehydrogenase/isomerase; TrkA-N domain
                     protein; dTDP-4-dehydrorhamnose reductase;
                     KEGG: nph:NP5218A sugar epimerase/dehydratase-like
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent epimerase/dehydratase"
                     /protein_id="ACM55793.1"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR002225"
                     /db_xref="InterPro:IPR003148"
                     /db_xref="InterPro:IPR005913"
                     /translation="MRVVVVGCGYVGLELARQLAERGHAVTGVRRSDAGLDAIESVGE
                     AVDGGRDLGEVDAVRADATDPASLDALPEADTVVFAASSGGRGAAAAREVYVDGLRNV
                     IEAYGSRVETPDRLIYTSSTGVYGDHDGAWVDEETPIEPTTDKTRVLAAAERIALETA
                     AEFGIDGTVARFAGLYGPNRYRLERYLDGPVTAGYLNMVHRDDAAGAVRYLLEADCAR
                     GDAVLVVDDEPIDKHAFADWLADACGVPRPAKRSKADQIANGDLSAAAERRIRTSKRC
                     SNDRLRALGYEFTYPTFREGYRDAVRTFRAASE"
     gene            complement(203742..204239)
                     /locus_tag="Hlac_0189"
     CDS             complement(203742..204239)
                     /locus_tag="Hlac_0189"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: hwa:HQ1184A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACM55794.1"
                     /translation="MFHEVVADGATGVESGAGETQSGETEDGESTDTDEVTAAALLAS
                     FETLLSEAAAEVGRDRLVDETGLDGGVIDAAVDGDATEIRLEDGAAIVAVSTDRDGDA
                     VVAEVRDHLLMGMATAVLDVDTIAAAIDADLTGQEVQQALEGRAPMTLGQLAEIMAVI
                     ERRKS"
     gene            complement(204282..207578)
                     /locus_tag="Hlac_0190"
     CDS             complement(204282..207578)
                     /locus_tag="Hlac_0190"
                     /inference="similar to AA sequence:KEGG:HQ1185A"
                     /note="KEGG: hwa:HQ1185A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55795.1"
                     /translation="MGKLSPGTNASCSGTRCRSFTVDERARVPFALIGVLLLVTSSTY
                     AAGIADQGLIGEDRSVERAVERVDADSTAALRAAARQAAHDAAAEPVTRAPDGSAAGS
                     EDGHGSTAVRNGSAFEDAFRIRLAIAGSEALAAVDAEVGDVTATASLPAVDGPSELAA
                     ARDRIRVEPAANGTATRVTFEGVETTATRSGRTVVERTEDRTVVVAVPTLAAHERTER
                     FEERLNRGPVEGPGLGRQITASLYAMTWARGYGQYAGAPVENVLANRHVELSTNAGIV
                     RTQRDVFGTSDPNARGGVARATARTGVTDLLKPTGVDEGSWTEAVLSAPTPGVRDGPG
                     ERDGSGENDTPGDQPSEDAAFEFGEERTDERTSVPVGRAADEGATRVYDDLDAIIESA
                     YRVEARVETSTTQVVDGGRPTPPTPSPSEFTTTGDWERVDLTRTERSPIISGSGVPEG
                     VPSGIVDPGERVSFGLETREATVKRVAVAEWERVTVERGPNGSVVDERVHRATTRDAV
                     TDHYRVRVSVSGEHAPTDGAPDRATATFGAGDASDGPDLRDTPPIARVDLDVDTENGV
                     DRITEDAISGGEVTRSTTVVGSRSEADRNAVAADVAALASDVRDIETEASMEDAAVGE
                     AEPYADLADAIRDRRAELVDAPVTYDGAADRAGTAARTAYLDAVIDELESAASDRERA
                     TDGFLDRVNSAFDGPDVGDALASREAARDSGTYAIGEDGPGGAVTFEPNGSPGYLPRT
                     TVDGEAVDGVDGTTTRPLAVRNVNYVTVPYGEVSSGVVDRILGTEDTVRVGTAGRSLL
                     LANDALAADDDPDLRADRDALARQIDGSLDEVDGALGSTLRVRTSLSRDERRRALDEA
                     AASYGSPGERAVAVGDGSYPDRVAAEAASVGSLSRAAEEALAANLRVATRTAAGRDAV
                     RVPTRFVDETTSGARVLLRDRMEKAVENQAARAGKAATGKVSEKAVKELGEKWSMKPA
                     RTVGAGLPVAPVPGYWVTTVNAWRVQIRGEYPRFALRANVGTPDKRFTYVRSEGDVTV
                     DVGGETVQLGKTEPIAFEAETVVAVAVPAGPPGVGDVDGTRDERSGGWPCPGAMGESP
                     SGGEGKCSKP"
     gene            complement(207581..208255)
                     /locus_tag="Hlac_0191"
     CDS             complement(207581..208255)
                     /locus_tag="Hlac_0191"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: nph:NP5212A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACM55796.1"
                     /translation="MTSTVLDVTVLLLCVSASVVALGAADSDRRAAGPEVAEVADLIV
                     TETVTVTYASAEAPNGTRTVHATRAELLALVAAENEGGGGKRAAREAFESEALAAIDR
                     GIGPRTRVDAEVRTLDETEDEAEGETGAPSPGIVVRTPRWASNGSVAPTTGGTGIPWR
                     IDRRHGEAGSPETEDPTAGSESPDPVTVGSEPPRGADVTVAVITHPAPNAADAAKSVR
                     IVIRRW"
     sig_peptide     complement(208184..208255)
                     /locus_tag="Hlac_0191"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.994) with cleavage site probability 0.652 at
                     residue 24"
     gene            complement(208252..208692)
                     /locus_tag="Hlac_0192"
     CDS             complement(208252..208692)
                     /locus_tag="Hlac_0192"
                     /inference="similar to AA sequence:KEGG:rrnAC1851"
                     /note="KEGG: hma:rrnAC1851 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55797.1"
                     /translation="MSRSSDERFLRGEGTESRAAVEPIAALVAVLAVGAALGLYVGAL
                     DDAAPDRERPTAEATLDRVEPAVTTGGVVDPERLRGVGEFRFGATVEIQADGETWTVR
                     SGDEAPVAEAARGTDAVAVAERPVTVSVEPGRNIRGTLRAVVYR"
     gene            complement(208673..209161)
                     /locus_tag="Hlac_0193"
     CDS             complement(208673..209161)
                     /locus_tag="Hlac_0193"
                     /inference="similar to AA sequence:KEGG:NP5208A"
                     /note="KEGG: nph:NP5208A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55798.1"
                     /translation="MFETNLDATYAWIGLAMVSVATAGVVGAFPASPPPDASGVAHTI
                     DSIADDEYPARAEHGLAANRIRLTTGSVALDGGGGTARASLRAPRITPVPTERRETTE
                     GDGLRRVLSGVPPDAAFDDPEEFAAAAERARRGDHEWRPAPDRLTVRRVHYGEVHVTL
                     VG"
     sig_peptide     complement(209090..209161)
                     /locus_tag="Hlac_0193"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.623) with cleavage site probability 0.322 at
                     residue 24"
     gene            complement(209219..211045)
                     /locus_tag="Hlac_0194"
     CDS             complement(209219..211045)
                     /locus_tag="Hlac_0194"
                     /inference="similar to AA sequence:KEGG:HQ1189A"
                     /note="KEGG: hwa:HQ1189A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55799.1"
                     /translation="MTGPDSDLDGAARRSATDDGEGSAELRRAIAFLGWEATSARVIE
                     TGYWAGVGVGLTCAVVVAFVSGPVPGLLSGLAGGLGATHIAHRGPVWLASLRRTRALG
                     AAPGLVGRLVLRMRLDPSTERAVRFAARTGDGPLADGLARHERANTDGPTSGLRAFAR
                     EWQPWFPAIDRAAALVRTAASAPPERRGRCLDRALDATISGTTDRLAAFVGEVRSPVS
                     ALYAFGVLLPLALIALLPAAAATGVPIGPGVVAALYLGVLPAGLLAASAWLLSRRPVA
                     FAPPSIDEDHPDVPERGTHAAVAGLGTGAIAAVVTARFVSGWAAPVAGVGVGAGVALF
                     VAVHRRRAVLSNVRAVERSLPDAMTVIGGDVAEGVAVETAIANAGERLDGATGELFER
                     AGRRSDTLRVDVREAFLGRGGPAVPVPSPRVQGAVALLAVAGREGRPAGDVLLELADQ
                     LEELRELENDARRQLATVTGTLTNTAAVFAPLVGGATVALATGIDAVDAGGLGAGATA
                     GADALGGAGGVGDPGTVGAEASGTTSGAGAKSDSASALSVPVLGQIVGAYVLILAALL
                     TALATGLERGFDRTLVAYRVGIALPTAAATYLVAFLGAGLLL"
     gene            complement(211042..212994)
                     /locus_tag="Hlac_0195"
     CDS             complement(211042..212994)
                     /locus_tag="Hlac_0195"
                     /inference="protein motif:PFAM:PF00437"
                     /note="PFAM: type II secretion system protein E;
                     KEGG: hwa:HQ1190A type II/IV secretion system proteins
                     VirB11/TadA (ATPase)"
                     /codon_start=1
                     /transl_table=11
                     /product="type II secretion system protein E"
                     /protein_id="ACM55800.1"
                     /db_xref="InterPro:IPR001482"
                     /translation="MSFDLPSLSRLGGDDTSLRSLPWLDGDTDSCQCDPSFREPVGTG
                     VDDRVVLSVDADDCPGRGDLAASPACLATVVETLTERDADVIRTHHAGRERTYAGRAA
                     ACLIAAGRFREQIEFHETRLAERVTREPIEAAREASGREGPPKRIAAETGLAETVASA
                     EETGDVLRAHAGPTIAATRIASAPPPDAALVDRWEIDTGATVRLYEGAGPLRTYHLTP
                     PSARLDDEAVERLADAKDRLLDDPTGGDRAPGRAVRSIASAGDPVSTLVDVLRRHTRG
                     YGAFEHVFADDRVSDATLSAPVAENPLRVVVDGERCRTNVRLPPEGAATLASRLRRTS
                     GRGFSRASPTLDATIEAEAGRVRVAATTAPASDGLSFTFRRGDPDAWTLARLVDGGTI
                     TPAAAGLLSVAVKRGVTGLVAGGRGAGKTTALGSLLWELPAETRSILIEDTPELPAAA
                     VTAAGRDTQRLRVGDGAEPSPSEAVRTALRLGGGAIVVGEVRGEEAAALYEAMRVGAA
                     GEAVLGTIHGEDPAAVRERVVTDLGVSPSSFAATDLIVVLDDHRVETIAEVVGHDGEA
                     SFEPLFERTGSGLVSTGRIDRGESRLVESLAETDESYASVRDAVDRRGERIGEAARTG
                     RITPERYVGRDGDGWQRTDSLGGGNQ"
     gene            complement(213028..213498)
                     /locus_tag="Hlac_0196"
     CDS             complement(213028..213498)
                     /locus_tag="Hlac_0196"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: hwa:HQ1191A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACM55801.1"
                     /translation="MIRVVLTVLVAVALLAASMPALEDARVSTTDDRLGTESDRVERA
                     IGGLVSGSMSVSDPSLAARTTVTIRAPAGVTAARIGRLALVETEQSGNESGAALRYRI
                     DGGRDRTVPIVSDAVTATVEVVDGPIALRTRGESRLDLRLVDDGGPIVRITRIE"
     sig_peptide     complement(213427..213498)
                     /locus_tag="Hlac_0196"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.997) with cleavage site probability 0.784 at
                     residue 24"
     gene            complement(213526..214317)
                     /locus_tag="Hlac_0197"
     CDS             complement(213526..214317)
                     /locus_tag="Hlac_0197"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: nph:NP5200A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACM55802.1"
                     /translation="MTDDTHDRDRAFADAGEPPETTGDGRRGVSAARGGTERSGPDQT
                     SLAGKNRSTVAGSDTEPSAEPSVDPNTESSDDRVEERLRAVERALTGTDDAVADIGDG
                     AAATAEREELSTRLDDLEARVEELEAATQAIRGYVGSIRAVNQAVERRADLALARASE
                     NHGAGEKAVENEGTLTDDDTTAGDDSIAGSGTTADDNTGANDDTLDGVVPSETALDAA
                     VPSERQRENGTGAASTSAVDPGEADGDRADDSWRAGALDRLRDSL"
     gene            214393..215472
                     /locus_tag="Hlac_0198"
     CDS             214393..215472
                     /locus_tag="Hlac_0198"
                     /inference="protein motif:PFAM:PF00091"
                     /note="PFAM: Tubulin/FtsZ GTPase;
                     KEGG: hma:rrnAC3326 cell division protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Tubulin/FtsZ GTPase"
                     /protein_id="ACM55803.1"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR003008"
                     /translation="MKAVLLGVGQAGGKLTTALAEFDADAGYGAVLDALAVNTASADL
                     EPLPLDTVLVGQSRVNGHGVGGDNELGAEVMEEDSVEVLDALASKVNADAEALFVVAG
                     LGGGTGSGGAPVLVRELSRVYDVPVYALGVLPGRDEGEMYQVNAGRSLKTLVREADAT
                     ILLDNDAWRSSGESVEGGYAAINASMAKRVGLLLAAGESVDGVAESVIDTSEVINTLR
                     AGGMAAVGFSSAPAAEDAEENVTTVMSAVRSAVMTGMSLPNATDADAALVAIAGDPDR
                     ISRKGAEKARKWLQEETGSMQVRGGDFPLDSDRVAALVLLGGVERSRRVEKFLERARQ
                     AVRDEPEEQPDPAEAFQNDELDDLL"
     gene            215547..216263
                     /locus_tag="Hlac_0199"
     CDS             215547..216263
                     /locus_tag="Hlac_0199"
                     /inference="protein motif:TFAM:TIGR01768"
                     /note="TIGRFAM: geranylgeranylglyceryl phosphate synthase
                     family protein;
                     PFAM: PcrB family protein;
                     KEGG: hwa:HQ1269A geranylgeranylglyceryl phosphate
                     synthase-like protein"
                     /codon_start=1
                     /transl_table=11
                     /product="geranylgeranylglyceryl phosphate synthase family
                     protein"
                     /protein_id="ACM55804.1"
                     /db_xref="InterPro:IPR008205"
                     /translation="MNNPWDDWDHVLKVDPDKELHGNETFEDVCRTGTDAIEIGGTLD
                     VTAEKMSRVVDAAAEYDVPLYQEPSNPGVVIDSPALDGYLIPTVFNAGGPFWITGAHK
                     EWVRIDDLDWDRTNTEAYIVMNPEASVAQLTEANCDLSADDVEAYAKVAERMFGQEIV
                     YVEYSGMFGDTEKVAAAHDALDEAALFYGGGIHGYESANEMAAHSDVIVVGDLLHDEG
                     VDAVRETVKGAKDAKDAKDA"
     gene            complement(216297..216908)
                     /locus_tag="Hlac_0200"
     CDS             complement(216297..216908)
                     /locus_tag="Hlac_0200"
                     /inference="protein motif:TFAM:TIGR00187"
                     /note="TIGRFAM: riboflavin synthase, alpha subunit;
                     PFAM: Lumazine-binding protein;
                     KEGG: hma:rrnAC2367 riboflavin synthase subunit alpha"
                     /codon_start=1
                     /transl_table=11
                     /product="riboflavin synthase, alpha subunit"
                     /protein_id="ACM55805.1"
                     /db_xref="InterPro:IPR001783"
                     /translation="MFTGIVEDTGTVRDRTETEDGLRLRIAVDGFDDLHHGQSISVSG
                     VCLTVEEYDTGTDNADGDDWFEVFLASETVAKTYLGEIGAGDAVNVERAMPADGRFDG
                     HVVQGHVDTVAEVTAIERVGEDWRFTFSIPEGHGDYLVDKGSVTLDGISLTVAEKRTD
                     EFDVAIIPTTYELTTLSEKSVGDPIHLEVDVIAKYVENMVDGY"
     gene            217023..217367
                     /locus_tag="Hlac_0201"
     CDS             217023..217367
                     /locus_tag="Hlac_0201"
                     /inference="similar to AA sequence:KEGG:HQ1362A"
                     /note="KEGG: hwa:HQ1362A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55806.1"
                     /translation="MRLGLTDMIGLAASLIFALPLANYAIVRLFAGEVALGVGLLAVA
                     AAMVVLPQYFLDPGRILRGLLTGLLPRQLRELIMPDTVETGPDNAGSVEGSSTEDEAT
                     DATHEDATAVEK"
     sig_peptide     217023..217100
                     /locus_tag="Hlac_0201"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.652) with cleavage site probability 0.311 at
                     residue 26"
     gene            complement(217406..218704)
                     /locus_tag="Hlac_0202"
     CDS             complement(217406..218704)
                     /locus_tag="Hlac_0202"
                     /inference="protein motif:PFAM:PF00557"
                     /note="PFAM: peptidase M24;
                     KEGG: hwa:HQ1363A Xaa-Pro aminopeptidase"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M24"
                     /protein_id="ACM55807.1"
                     /db_xref="InterPro:IPR000994"
                     /translation="MNDGSDDADSRDRLPLRTDLTPIVEAVAAADADAFVTVGDRFDD
                     DLRYLTRFSGPDRAYALVIVPADDAGGRAVCCAPSLFREQAEREFVASARSRSADDGG
                     FHDGVAREVRTERVGNHAGERAAAVIRDLLGGEDSEPTLLVPPSIPHDAAVYLERAGN
                     ALASTNAVARARARKTDAEIDRLRRVQCAAVAGMARAETMLAESEVVEVESVEDTDTE
                     RRPALRWEGAPLTTERLRRAVNATLADRGVRDAGDTAIGAGPSAADLHYVGDDPIRPG
                     ETVLIDISPRGPDGYRGDLTRTFVVDGDGGWERRAYLAVESAREAALAEIEPGVPTKT
                     VHGEAAAELAAYGFDPNAGEGEAGFTHGAGHGVGVSLHESPSLSGAGELRPGHVVTVE
                     PGVYDPDVGGVRLGDLVVVTEDGYEVLAEYPFGIVPNERE"
     gene            complement(218701..220545)
                     /locus_tag="Hlac_0203"
     CDS             complement(218701..220545)
                     /locus_tag="Hlac_0203"
                     /inference="protein motif:PFAM:PF00580"
                     /note="PFAM: UvrD/REP helicase;
                     KEGG: hwa:HQ1364A DNA helicase II"
                     /codon_start=1
                     /transl_table=11
                     /product="UvrD/REP helicase"
                     /protein_id="ACM55808.1"
                     /db_xref="InterPro:IPR000212"
                     /db_xref="InterPro:IPR014016"
                     /translation="MTDPTVTRLFGGPGSGKTTALLDRVEGILDDGDADVRDVLVVSY
                     TRAAAAEIRERLAERLDISPRSLQGNVCTMHAKAYELLDLSRGDVVGEDDKEEFCEEY
                     GIEFEDQHGGAGRRTARSTTIGNKIIATSQWLQRTERDVSDWYDVPFQWDVEEVRLPP
                     EEDPNAQEGNKYTPTWPSDDERIDIPETIRAWRGYKGDNDLVGFADMLERVAQRSLVP
                     NVDYLIIDEFQDITTLQYNVFEEWEPHMRKVLIAGDDDQVVYAWQGADPDLLLDTDVD
                     EDVVLPNSYRLPSEILNVVNAEIRHIDKRQEKDLHPRKEGGSVEAIQSPSMLELVRNV
                     RYTVDDDEGSVMCLFRARYQMFDFIDEFIDHGIPFTMLTDGRMWTDRVQDYVSAIEKS
                     DAGDPVNGLEARRLADMLQDSAFGTHERDEFYDFLDDREEAADADDISLIEVTTDELD
                     AHIPFMPDANSADDMVRKVTSFQRKSMGAYFGGDYEGADPTRVRVGTIHSAKGREADH
                     VFVATDLTEKVVEQMAASIDDPTDVDGIEEFTKTTSPVPVLTDNERRVFYVGMSRARE
                     RLVIMESLISGAPTLPISVLLFNELRDEPAQELVDEVQAELAVPEPEP"
     gene            complement(220700..220858)
                     /locus_tag="Hlac_0204"
     CDS             complement(220700..220858)
                     /locus_tag="Hlac_0204"
                     /inference="similar to AA sequence:KEGG:OE1789R"
                     /note="KEGG: hsl:OE1789R hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55809.1"
                     /translation="MPTCQNCGSFVTTDYVRVFTPNEVDRPRVCPACEDLVRDGADVR
                     EARATRSN"
     gene            complement(220947..221129)
                     /locus_tag="Hlac_0205"
     CDS             complement(220947..221129)
                     /locus_tag="Hlac_0205"
                     /inference="similar to AA sequence:KEGG:NP0928A"
                     /note="KEGG: nph:NP0928A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55810.1"
                     /translation="MSSSAPSADDDVFDEFLSDRGHETEIVRWDRSYNKLQCPECGAL
                     HPEGTARCDVCDWRPT"
     gene            221245..221781
                     /locus_tag="Hlac_0206"
     CDS             221245..221781
                     /locus_tag="Hlac_0206"
                     /inference="protein motif:PFAM:PF03061"
                     /note="PFAM: thioesterase superfamily protein;
                     KEGG: hsl:OE4410F acyl-CoA thioester hydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="thioesterase superfamily protein"
                     /protein_id="ACM55811.1"
                     /db_xref="InterPro:IPR003736"
                     /db_xref="InterPro:IPR006683"
                     /translation="MLSDTIDFVVDGSPFTADGPFSAGRVGTGMPTVSDTYIENRQRV
                     QPTHTNNYESAHGGNVVKWMDEIGAMSAMRAAGETCVTAKINGLDFKRPVPQGDTCIV
                     ESYVYAVGRTSLRTRIRAYRESPRTGERELTTESYFVFVSVDADGTPTPVPELTVEGD
                     RCRELRDAALAAEPDEER"
     gene            complement(221784..222014)
                     /locus_tag="Hlac_0207"
     CDS             complement(221784..222014)
                     /locus_tag="Hlac_0207"
                     /inference="similar to AA sequence:KEGG:NP4086A"
                     /note="KEGG: nph:NP4086A homolog 10 to
                     S-adenosylmethionine-dependent methyltransferase 3"
                     /codon_start=1
                     /transl_table=11
                     /product="S-adenosylmethionine-dependent methyltransferase
                     3-like protein"
                     /protein_id="ACM55812.1"
                     /translation="MDDVATTYVARHDPNGSDAAPIDDLLAGFPSDPAVLDVGCGDGA
                     RTLANLTAGSVGLDVSRRGLAPAGEIRGLEDY"
     gene            complement(222129..223901)
                     /locus_tag="Hlac_0208"
     CDS             complement(222129..223901)
                     /locus_tag="Hlac_0208"
                     /inference="protein motif:PFAM:PF02652"
                     /note="PFAM: L-lactate permease;
                     KEGG: hma:pNG7283 L-lactate permease"
                     /codon_start=1
                     /transl_table=11
                     /product="L-lactate permease"
                     /protein_id="ACM55813.1"
                     /db_xref="InterPro:IPR003804"
                     /translation="MLILLALLPLAAIAIIMVLLYQPATITMPIAWAIAAVAAYVGWQ
                     MSPTLIAAASIRGALTATRILVIVFGAILLLYTLKQSGAFEVINAGFSSISDDRRVQV
                     ILLVFLMGSFIEGAAGFGTPAAIVGPLLVGLGFPPLAAVVVALTGNILAITFGAVGTP
                     LIIGFEDVVFGQDPTETGTAAYAVVQNGGYESVGAYVAQIGVWAAVIHAIVGIAIPFI
                     GVAMMTRFFGEERSLKPAIEVIPLTLFAWASFVIPYLLTAYFLGPTFPGLLGAMVGLL
                     VVGSTLRAGYFLPEEEWDFGPQEQWPDHWIGKIEPGTGMGTSDTGQKVAADGGTSRFE
                     EMHSQDMSLGMAWAPYILVAALLIVTRVIGPVQGFLSSTGVITWNNILGTPFSEGIEI
                     FYLPGSLFVLVAVVTYGLHGMDSEGIRDSWAEAITNIIPAVIALWFAVATVMVMQKTG
                     ADIVINNAAAVDLGMLQLLSQSTANLTGQLFPFFSPFIGAFGAFIAGSNTVSDILFGL
                     FQFEAAQQIGAPTQIVVAAQAVGGAIGNLIAIHNVVAALTVVGLIGEEGRVIRLELIP
                     VLYYGVATGLLTLILAYVVVPGTF"
     sig_peptide     complement(223800..223901)
                     /locus_tag="Hlac_0208"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.911) with cleavage site probability 0.464 at
                     residue 34"
     gene            224168..224356
                     /locus_tag="Hlac_0209"
     CDS             224168..224356
                     /locus_tag="Hlac_0209"
                     /inference="similar to AA sequence:KEGG:HQ2551A"
                     /note="KEGG: hwa:HQ2551A L-lactate permease"
                     /codon_start=1
                     /transl_table=11
                     /product="L-lactate permease"
                     /protein_id="ACM55814.1"
                     /translation="MFDREDNGCVNDASTLATVGLLGQEGRVMRLNMIPLLYYSTGVG
                     LLCLLCLLFGYVLFSGVF"
     gene            complement(224479..227577)
                     /locus_tag="Hlac_0210"
     CDS             complement(224479..227577)
                     /locus_tag="Hlac_0210"
                     /EC_number="1.1.2.4"
                     /inference="protein motif:PFAM:PF02913"
                     /note="PFAM: protein of unknown function DUF224
                     cysteine-rich region domain protein; FAD linked oxidase
                     domain protein;
                     KEGG: hma:rrnAC1967 glycolate oxidase subunit GlcD"
                     /codon_start=1
                     /transl_table=11
                     /product="FAD linked oxidase domain protein"
                     /protein_id="ACM55815.1"
                     /db_xref="InterPro:IPR004017"
                     /db_xref="InterPro:IPR004113"
                     /db_xref="InterPro:IPR006094"
                     /db_xref="InterPro:IPR017900"
                     /translation="MASEPTRGDNTPGLDTSAAALGHERPDVPAYRALAEDLRERVDG
                     EVQFDEYAQVLYATDGSIYQARPAGVVTPRSVADVQATMRVAADHGVPVIPRGAGSSL
                     GGQTVGPGCVVLDFSTHMDEIQEVRPDDRRAVVQPGVVQDQLDDRLTEDGLKFAPDPA
                     SSARATVVGGIGNNSTGAHSVRYGITDAYTEELQVVLADGSLIHTREVVLDSPEYEEI
                     VSKNDREAALYETTRKLVEENEAEIDEKYPNLKRSVSGYNLHKVIYENDDGEDVINLS
                     KLFVGAEGTLGTIVEAEVSLVSRPEETALALYTFDSLVDAMKAVPEALEFPVSAVELM
                     DDEVFDLAAGSQEFAQYAEPIPDRATAALMLEWDSELVDDFEAAIADTNAHFVEEGDA
                     FDVLEAYTPEDQEDLWKLRKAAIPLLMSMQGDPKPYPFIEDATVPPEELAEYVGQFEE
                     VLTDHDTSAAYFAHAGSGTLHIRPILSLKEEEGVEKMHSISEDVTDLVLEHHGAFSGE
                     HGDGLARTEFNPKMYGEALWSAFQELKSTFDSEWRMNPGKVVYVDGETADERGYPDTA
                     ADTDMRENLRYGPAYQSIEPQTTLDFSEEGGFSHLVELCNGCGTCREVDSGVMCPTYR
                     ASEEEIQATRGRANMLRAAISGELDDDEIHSDRFQEEVLGLCVGCKGCKSDCPTGVDL
                     AKLKAEVKHEHHEEEGSGLRERIFRDIDRFSAIGSALAPVSNAATKIPGARAVMDAVA
                     GIAPDRELPTFRSESFEEWFASRGGSTIDPAEAVDTVALFPDTYTNYSYPAAGKAAVE
                     VLEAAGVRVEVPDDLAPSGRAAFSTGFLNDARERAATNVAALAPRVRDGQSVVFVEPS
                     DAVMFQDEYLDLLDGDDVEAVSAAAYGVLEYLDAGRVDEQLAFDAPAESLTYHGHCNQ
                     KATNKDHHAVGVLRRAGYDVDPLDSSCCGMAGSFGYESEHYDISKAIGRILFDQVEES
                     GGETVTAPGASCRSQLGDRDGAENPPHPIEKVAEAVTGAASDAVADAGAAEAASPSPA
                     DD"
     gene            227690..228058
                     /locus_tag="Hlac_0211"
     CDS             227690..228058
                     /locus_tag="Hlac_0211"
                     /inference="protein motif:PFAM:PF00903"
                     /note="PFAM: Glyoxalase/bleomycin resistance
                     protein/dioxygenase;
                     KEGG: nph:NP2650A homolog 1 to lyase/dioxygenase"
                     /codon_start=1
                     /transl_table=11
                     /product="Glyoxalase/bleomycin resistance
                     protein/dioxygenase"
                     /protein_id="ACM55816.1"
                     /db_xref="InterPro:IPR004360"
                     /translation="MEILHTCLNVADADRTADWYVDQLGFERSWEFTTADGDTRNVYV
                     ADDAGVEFQLSDTDGEEPSDDGDRYDHVAVGVDDVDAAFEAIDHHGVVKEPGDQPEAG
                     ARTAFVKDPDGHAVELIEPL"
     gene            complement(228263..228520)
                     /locus_tag="Hlac_0212"
     CDS             complement(228263..228520)
                     /locus_tag="Hlac_0212"
                     /inference="similar to AA sequence:KEGG:Noca_4891"
                     /note="KEGG: nca:Noca_4891 putative gualylate cyclase
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="putative gualylate cyclase protein"
                     /protein_id="ACM55817.1"
                     /translation="MCTMPLYMDVHRDVDASVEEVVEAHKKDLETQEKHGVKYLNYWV
                     DDDEGAVFCLFEGPSKEAGEKVHKEAHGLAADEIFEVEQGE"
     gene            complement(228904..229815)
                     /locus_tag="Hlac_0213"
     CDS             complement(228904..229815)
                     /locus_tag="Hlac_0213"
                     /EC_number="4.1.3.6"
                     /inference="protein motif:PFAM:PF03328"
                     /note="PFAM: HpcH/HpaI aldolase;
                     KEGG: rxy:Rxyl_2830 citryl-CoA lyase"
                     /codon_start=1
                     /transl_table=11
                     /product="HpcH/HpaI aldolase"
                     /protein_id="ACM55818.1"
                     /db_xref="InterPro:IPR005000"
                     /translation="MTDVTLRRTQLATPASDEKMMHSAADSDADEVFLDLEDSVAPNA
                     KPDARAPLIKAAREEDWSDKVLSFRMNGIDTKWWYDDLITVVGEAGEFIDDIIVPKVK
                     SASDVHTVENLLAQVEENNGLEVGGIGLEPQIEDGEGIHNVHDIAHASDRLSSIIFGP
                     GDYSAAMGTPGLDIGQFPEYPGHYWHHALSECNSAAKSAGVPCLDGPYADIEDSDGFR
                     ESAENANMIGCDGKWAIHPSQIEIGNEVFAPDPETAERAKRIVDAYAEAMEEGKGAVS
                     VDGQMVDEATNKMAQDIVETAEAAGIL"
     gene            complement(230045..230239)
                     /locus_tag="Hlac_0214"
     CDS             complement(230045..230239)
                     /locus_tag="Hlac_0214"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACM55819.1"
                     /translation="MTQSRFRTAFFAAIMALPTVASTEAAGAAPIEEPNLFSLTTLGA
                     VIGAFLIALLIVAAVRHADR"
     sig_peptide     complement(230153..230239)
                     /locus_tag="Hlac_0214"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.332 at
                     residue 29"
     gene            complement(230762..231802)
                     /locus_tag="Hlac_0215"
     CDS             complement(230762..231802)
                     /locus_tag="Hlac_0215"
                     /inference="protein motif:PFAM:PF08240"
                     /note="PFAM: Alcohol dehydrogenase zinc-binding domain
                     protein; Alcohol dehydrogenase GroES domain protein;
                     KEGG: hma:pNG7278 alcohol dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="Alcohol dehydrogenase GroES domain protein"
                     /protein_id="ACM55820.1"
                     /db_xref="InterPro:IPR002328"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /translation="MRAAIFNGPGDIGVEERPRPEIEAPTDAIVRVTHTAICGSDLWF
                     YRGDSDRDEGSPVGHEPMGIVEEVGNEVTSVAPGDRVLAPFAISCGECEFCRKGLHTS
                     CENGDSWGGDNGGGQGEYVRSTHADGTLVRVPDRFADDEETLRSLLPLTDVMGTGHHA
                     AVNAGVEAGSTVVVIGDGAVGLCGVLAARRLGAERIIAVGHHEDRLELAEEFGATETV
                     SERGEAAVERIQELTHGGPNHVMECVGAASAMNTAIDVVRPGGTIGYVGVPYGVEEEG
                     LNVFGMFGDNVTLAGGVAPVRAYAEELMADVLQGTLDPAPVFTETVGLDEVDEGYRMM
                     DEREAIKVLVKL"
     gene            232217..233482
                     /locus_tag="Hlac_0216"
     CDS             232217..233482
                     /locus_tag="Hlac_0216"
                     /inference="protein motif:PFAM:PF00375"
                     /note="PFAM: sodium:dicarboxylate symporter;
                     KEGG: hma:pNG7331 proton/sodium-glutamate symport protein"
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:dicarboxylate symporter"
                     /protein_id="ACM55821.1"
                     /db_xref="InterPro:IPR001991"
                     /db_xref="InterPro:IPR002202"
                     /translation="MASFIGSLWRRYRSVPLIYRIAVAFLLGSLAGAVFGERMTVVKP
                     FGDLFLRLLNMLAVPIIVFTLLTGIRQLSPAKLGRIGGATVGLYAVTTTFAGLIGLAV
                     ANLLRPGRGVEFTGGEAQSQAPPSLTEVVLGIVPNNPVAAMAEGNLLATVFFVIVFGI
                     ALTYVRAQKPELAGRVDGVFGAFKIGAEAMFVVVRGVLEYGVIGVFALMAVGIGTEGV
                     GVFSSLGALVLAVGVAVVVHIAFTYLFVLMRVVAGVSPVAFLRGAKDAMLTAFATRSS
                     SGTLPVTMTNAEEDLRIEERVYSFALPVGATANMDGAAIRQAITVMFAANAVGQPLAL
                     TEQFLVLVVAVLISIGTAGVPGAGLVMLTVVLSQVGLPLAVVGFVAGVDPILGRIATM
                     NNVTGDLAVATVVGKWNDAVDFGDGVWAR"
     sig_peptide     232217..232327
                     /locus_tag="Hlac_0216"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.902) with cleavage site probability 0.890 at
                     residue 37"
     gene            233676..235979
                     /locus_tag="Hlac_0217"
     CDS             233676..235979
                     /locus_tag="Hlac_0217"
                     /inference="protein motif:PFAM:PF00437"
                     /note="PFAM: type II secretion system protein E;
                     KEGG: nph:NP0160A ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="type II secretion system protein E"
                     /protein_id="ACM55822.1"
                     /db_xref="InterPro:IPR001482"
                     /translation="MSDGPTLRIVDEDDDDPGGAVPAPVPPDDPEAWYAPDVRAQYES
                     EPGVVATVRERDGGRFGYDVREPPLSGADDRALDRVRDHFSGVRHRRPLTRVGVIERA
                     ESGFEPKYERALDRLLDASRAARRRIDYHALRDLRLLGDVTPLALDGRIEVADVGDER
                     ELVVHTETFAPLETGIDADAEYVERVAAERLARYAVGFAGLSVEVVVARERLLGSDAF
                     ETKYAVREPDLLPGDEALIEECKQRIWETTVNGVVDDREAFVAEHARRFLSRRLTARN
                     TRAWLGAAAHRARSALADRGLAVPPVDSRYAHDRLDDLAYYVLRDFVGEGILTVPIRD
                     PNLEDVEANRVGERVKVVPRTSILQGAGAGDENSRDAGRRVPTNLAFDDESTFVNVVT
                     GLAARDGTELNASTPSAKVNLDVDGVDETIRCAVALPVISEGGPHVSIRKQSADALTP
                     VDLIDRGTLSPDLVTLLWLLYEHRGVVLFAGPTGVGKTTLLNAHTPFIPFDDRPVSID
                     EGSREVRLPHETGVSLTTRDHEDAYKAVSMSELMAEANYLNPDVEVIAEINTPASFET
                     FAETLNTGHGVIGTTHAEDVEALVNRVIERGLPAYLLREVDLVVFPRQVDGERYVSRA
                     VELLSEAEYEALDPEATRSPTGNPKHGGAGVVDKGTEAVYYNTVAWRDADGEFRFPGA
                     PESDAPTASREGRRLHALARIADHTDRDVDAVESEFASKRRYVEYLVREGVDDFDALF
                     EFLADLRTDEAATVERAARTMGGEGRS"
     gene            235976..237970
                     /locus_tag="Hlac_0218"
     CDS             235976..237970
                     /locus_tag="Hlac_0218"
                     /inference="protein motif:PFAM:PF00482"
                     /note="PFAM: type II secretion system protein;
                     KEGG: nph:NP0158A transmembrane protein (homolog 4 to type
                     II secretion system proteins TadC)"
                     /codon_start=1
                     /transl_table=11
                     /product="type II secretion system protein"
                     /protein_id="ACM55823.1"
                     /db_xref="InterPro:IPR001992"
                     /db_xref="InterPro:IPR017871"
                     /translation="MSGEPQRGADAAGGGRALDAAEADGFTRTSGSSVVDRVLYALFA
                     RHASDRRHDADRKRYRGTALDTGFETHLARVYGLSWLVCVAVIVPALLVAASTVPGLL
                     AAADAWIGARSPVPIGSLSPERVAVVAAGLTGFLAKRATVRLGGLHLRWLTATRRTDI
                     ERTLPPAVRYLELLAAGSDGPRKMVEKAAANDAYGGTATSLRKALNAARLAGSLDEGL
                     RRVARDTPSRELLAPFLLKFRKHAATGDAALAEYLRTESRMLAHRQDRARKRARRFLE
                     LLTELFVVVLVLPALLVIAATALTVVVPELLPPVDTPVGVVPTRAVVLYGAVVFLVAI
                     GLVGAVAVGTLRPPNQRASYDLPAFPRKILASAGRNPSSAAVVCAPPAALLAVGLAFA
                     GYTLVNVALLSYAAFAVPVGAVAGRRTRIDDAKDRELADFVHAVSGHVAQGRPFPAAV
                     EAVARDVDLGVLDDDVADLAFALRSTTATGGAGSTERARDTGSTGASAQSPGVRAAAI
                     DRFVQRVGTPLAEGTLGLVTDALNAGSDADAVFETLRIEVGRLYSEQRALRSSMHPYV
                     AVGWAAAALVAAVVAVVNTQVIDAAHLADLAGATDFVAEPETVLPELERFRLYVVTQA
                     TMLASGWFAGTASRGRYAALFHSGLLVAICYAVFTAGGLV"
     gene            238054..238284
                     /locus_tag="Hlac_0219"
     CDS             238054..238284
                     /locus_tag="Hlac_0219"
                     /inference="similar to AA sequence:KEGG:rrnAC3418"
                     /note="KEGG: hma:rrnAC3418 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55824.1"
                     /translation="MAGRYGNIDYPKITKRGVLFGLGLFLIGAVGEAYIHMTGTQVPG
                     WEERLLLDLEFLGTAIALVTPFVFGIFLPLTE"
     gene            238418..238948
                     /locus_tag="Hlac_0220"
     CDS             238418..238948
                     /locus_tag="Hlac_0220"
                     /inference="similar to AA sequence:KEGG:NP1460A"
                     /note="KEGG: nph:NP1460A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator, AsnC family"
                     /protein_id="ACM55825.1"
                     /translation="MPEKQPIPDWNLSERDTIILQELARDPQLTSRGLRDLLAEEHDI
                     DVSHVTVNESIRRMRADGVFREALVPNEEHLFFSLFEFQFNPEGFDEHWEDALEHIRS
                     SRHTFMYFLSDGDYQWKTIMMFEDREQESKWIHEFYKEYGVLVNNLRNSVVTNVLKFG
                     TDPELFEVFQEDGNDE"
     gene            complement(238970..240190)
                     /locus_tag="Hlac_0221"
     CDS             complement(238970..240190)
                     /locus_tag="Hlac_0221"
                     /inference="protein motif:PFAM:PF00441"
                     /note="PFAM: acyl-CoA dehydrogenase domain protein;
                     Acyl-CoA dehydrogenase type 2 domain;
                     KEGG: nph:NP1754A acyl-CoA dehydrogenase 11"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase domain protein"
                     /protein_id="ACM55826.1"
                     /db_xref="InterPro:IPR006089"
                     /db_xref="InterPro:IPR006090"
                     /db_xref="InterPro:IPR006091"
                     /db_xref="InterPro:IPR006092"
                     /db_xref="InterPro:IPR013107"
                     /translation="MEYDDIGRGPEIAEAVREFVDETVLPVEREWLGRGPIPPADIEA
                     LRDAARDEGIYAPQVAEEYGGLGLGFREMLPVFEEAGRSLLGPTALRCAAPDEGNMHT
                     LEIAATDAQKERWLRPLAAAEIDSGFAMTEPMQGGGSDPKMLATTAEKDGDEWVIDGH
                     KWWTTGGVEANLLLVFARTDQEAHPYAGCSVILVPADADGVEVVRNIPHLGEGLVGTT
                     HAEIRFDDVRVPVENTLGEENEGFTLVQQRLGPARLTHCMRYAGMADRALDIATAYLS
                     EREGFGEPLSEKQGPRFRIADRRTELHAARTMVRHAAGRIADGHEARIEVAMAKTFAA
                     NVTQEAIDDALQFCGGNGIAYDLPIARFHENVRQFRLVDGADEVHRRSIARDAFEDPP
                     AEELETVTRFGEFD"
     gene            240372..241439
                     /locus_tag="Hlac_0222"
     CDS             240372..241439
                     /locus_tag="Hlac_0222"
                     /inference="protein motif:PFAM:PF01636"
                     /note="PFAM: aminoglycoside phosphotransferase;
                     KEGG: nph:NP2224A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="aminoglycoside phosphotransferase"
                     /protein_id="ACM55827.1"
                     /db_xref="InterPro:IPR002575"
                     /db_xref="InterPro:IPR008271"
                     /translation="MSDPDYLDRLVDDDALGAYLTAEFGSADTFAVERHAEGHSNETL
                     FVTWGDRELVVRRPPPGETADTAHDVLREYRVVDALGDTDVPVPRTLRACDDHGVLGS
                     DFYLMERAEGDVLRETEPERFANPAARERVGTGLVDTLAAIHGVDYEAVGLGDFGRPA
                     GYTARQVERWTGQLEWAFETTTEVREVPDLIAVGEWLADNAPDEHPETLVHGDFKLDN
                     VMYGPGTPPAVVAVFDWELSTLGDPLADLGWLLLFWYDEGDPDPAMPELMSTFTAREG
                     YPTRAELIARYETTTGREFAHERFYRALAAYKMAGLGEMFLARHLNDDSDDPLYPKME
                     AQVPTLAARTLAYVEGETERL"
     gene            complement(241440..242231)
                     /locus_tag="Hlac_0223"
     CDS             complement(241440..242231)
                     /locus_tag="Hlac_0223"
                     /inference="protein motif:PFAM:PF00106"
                     /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
                     domain protein;
                     KEGG: nph:NP4166A dehydrogenase/reductase 6"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase SDR"
                     /protein_id="ACM55828.1"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR013968"
                     /translation="MTEDTTLTPDDSLPDLTGRVAVVTGGGRGIGRAITLGMAAAGAT
                     VVPSARTAAEVEAVADEARDFGVEARGITADVTDDDDVEALVEEIVDAFGSLDILVNN
                     AGFNPGDALGDPAEIESDAVDSVLDVNLRGAFRTLRAAGPHLKEAGGSVVNVASVAGE
                     VGLPKQHPYVASKHGLVGLTKSAAMDWAPEVRVNAVAPGYVATDLTETLQENERLRQS
                     ILDRTPLDRFADPMEIAGPAVFLASDAASFVTGETLAADGGWTAR"
     gene            complement(242228..243877)
                     /locus_tag="Hlac_0224"
     CDS             complement(242228..243877)
                     /locus_tag="Hlac_0224"
                     /inference="protein motif:PFAM:PF00501"
                     /note="PFAM: AMP-dependent synthetase and ligase;
                     KEGG: nph:NP4150A long-chain-fatty-acid--CoA ligase"
                     /codon_start=1
                     /transl_table=11
                     /product="AMP-dependent synthetase and ligase"
                     /protein_id="ACM55829.1"
                     /db_xref="InterPro:IPR000873"
                     /translation="MPEELTLRPFFWRATRLFPETEVVSRTHDGVDRYTYADFGDRVR
                     RLAAALAELGVEPGDRVGTLGWNTHRHFEAYYAVPLSGAQLHTVNLLLQDDHVEYIIN
                     DAADDVLIVDRDAVATLDRLWDRIDGVREVVVMGDSVPETESDLPLSAFEELIADADP
                     VESWPPLSEDDPAGMCYTSGTTGKPKGVEYTHKMIYAHAMMVMTPAALDIAEDDVVMP
                     VVPMFHVNSWEFPYAVTMAGAKQVYPGPSPDPADLVELIESEGVTLTAGVPTVWIDVL
                     DHLDEHGGDLSSLERIVVGGSAAPREVMRRYEDEHDVTIEHAWGMTETMSIGSVSRPT
                     SAMAGADREAKLDKRAKQGLLSPGLEMRVVDDDDKPVAWDGEAFGELLVRGPSVVEEY
                     YDRPEADATDFVAADDGGARWLRTGDIATVDEDGYMEVVDRVKDVIKSGGEWISSIEL
                     ENALMAHEDVAEAVVIAASHERWQERPLAFVVPKAGRELDVEGIRTFLADEFPRWWLP
                     DDVRFREEIPKTATGKFDKKTLRETVDDPALPYAPGEEGGE"
     gene            complement(243870..244583)
                     /locus_tag="Hlac_0225"
     CDS             complement(243870..244583)
                     /locus_tag="Hlac_0225"
                     /inference="protein motif:PFAM:PF00005"
                     /note="PFAM: ABC transporter related;
                     SMART: AAA ATPase;
                     KEGG: rpd:RPD_0050 ABC transporter related"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter related"
                     /protein_id="ACM55830.1"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /translation="MTILDVDNINTYYGNSHVLHGISLEINEGEVVTLLGRNGAGKTT
                     TMRSIVGASPPRTGSITYRGEEISGLSPDEINELGISLVPEDRRVFPTLTVHENLRLA
                     HNLASDPRPVEEMYELFPALDPLRKNDGQNLSGGEQQMVSVARALVQAPDVLLLDEPT
                     EGLAPVIVDDLREIVQTVVDENVTVLLTEQNVDFAFDLAERGYIMDTGQIVFDGTVEE
                     IRDRDDLLETYLSVGTADA"
     gene            complement(244580..245353)
                     /locus_tag="Hlac_0226"
     CDS             complement(244580..245353)
                     /locus_tag="Hlac_0226"
                     /inference="protein motif:PFAM:PF00005"
                     /note="PFAM: ABC transporter related;
                     SMART: AAA ATPase;
                     KEGG: hma:rrnAC3128 branched-chain amino acid ABC
                     transporter ATP-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter related"
                     /protein_id="ACM55831.1"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /translation="MTTVLKTEDLRKQFGELTAVDDVSIEIDDSEITSIIGPNGAGKT
                     TFYNLLTGVLRPTSGSIWLRDDGEGGLADITDAEPHEVAQAGLSRSYQITNIFEGLTV
                     RENVRVARISHEGTRLDFRSRAAGDEALEVDIEELLELTGLTDIADTPCDTLSHGEKR
                     TVEIALALAIEPDVFLMDEPTAGMNPTEVTEIVSLIRELDADLDATFVVTEHNMDVVT
                     DISDRIVVLAEGAILADGTPEDVLTDDRVTEAYLGSDSV"
     gene            complement(245350..246537)
                     /locus_tag="Hlac_0227"
     CDS             complement(245350..246537)
                     /locus_tag="Hlac_0227"
                     /inference="protein motif:PFAM:PF02653"
                     /note="PFAM: inner-membrane translocator;
                     KEGG: hma:rrnAC3129 branched-chain amino acid ABC
                     transporter permease protein"
                     /codon_start=1
                     /transl_table=11
                     /product="inner-membrane translocator"
                     /protein_id="ACM55832.1"
                     /db_xref="InterPro:IPR001851"
                     /translation="MSASTDTGGRVSEFGSAVADGWTRERFGLLGALGLILLAFGPSF
                     QIYLFTDFLVVALFALGFNLLYGYTGLLSFGHGLFYAGGAYGVAIVLRDLGPVFADLV
                     GSGISPLVTFVVGGVVGLALVVVVAVPVGWLSVRLEEIYFALITLAFGMLGYSLIIQD
                     PAGLTNGTDGIIVLLGSVDIGGGSFRIGARRTYYALTVVVVLAATYGTWRVVNSPFGT
                     VCKAIRESPDRASALGIDVRHHRWMTFIISAAIVGIAGVLRAGLASVASPGLTHWSTS
                     AIAVIATVIGGATYFSGPIVGAFVFLYIRWGISRFPTLEAYWELFFGALLIGVVLYFK
                     QGAVGGLLLLRDRLLGDGGGDADGGGDADGGETASSDERSRGTGATAPADDEARTDRG
                     DNS"
     gene            complement(246534..247427)
                     /locus_tag="Hlac_0228"
     CDS             complement(246534..247427)
                     /locus_tag="Hlac_0228"
                     /inference="protein motif:PFAM:PF02653"
                     /note="PFAM: inner-membrane translocator;
                     KEGG: afw:Anae109_1174 inner-membrane translocator"
                     /codon_start=1
                     /transl_table=11
                     /product="inner-membrane translocator"
                     /protein_id="ACM55833.1"
                     /db_xref="InterPro:IPR001851"
                     /translation="MSLPSLVPLIGIADVIIGLSLGSRLFLIAVGLSLIFGVLGVLNF
                     AHGGFYMLGAYVTLAVVTNVVDNFWLAVVAGALAVGVVGAAIEFAAIRPLYDRVDADL
                     DQLIVTFGFVLVIHEAVRFIWGSGSYSIDPPDVFNFSVALGGSTFSAYRLVVIGLAVA
                     VLVSLWLFITRTYFGSLVRGTSSDREMASMLGVDVPRLYTGVFFLGSVLAGLGGALSS
                     PLQSTSPALGDQVIIDAFIVVVIGGLGSMSGAFVGAMLIGMMQSLGPQFISAGSIAIP
                     FLAMVIVLLFRPEGLFGGIGE"
     gene            complement(247443..248768)
                     /locus_tag="Hlac_0229"
     CDS             complement(247443..248768)
                     /locus_tag="Hlac_0229"
                     /inference="protein motif:PFAM:PF01094"
                     /note="PFAM: Extracellular ligand-binding receptor;
                     KEGG: afw:Anae109_1173 extracellular ligand-binding
                     receptor"
                     /codon_start=1
                     /transl_table=11
                     /product="Extracellular ligand-binding receptor"
                     /protein_id="ACM55834.1"
                     /db_xref="InterPro:IPR001828"
                     /translation="MVTASPDEENKRNRTRDIETNSESRSPVGRRRFLQAAGAGATVA
                     LAGCSGGSGDDDVVRLGATYILSGFASLYGEAAERGLEMAQSEINDNGGIDGRDVEVT
                     VRDTEASADTAIQQMRSLVEEDNVHGLFGLDSSGVAQAVAPQAAQLQMPYMITHAATP
                     FVTSPEGEHEDSVGNDYVFRDSNSLSQDIYGAALTAAELDATEWATIGPDYAFGYETW
                     DYFQDFCAGLGVDAEFTAEQFPPLETGDYTPYISSILDAEPDAVLTPLWGADLTTFIG
                     QAEDAGWFDQIDHTLFSVGMGTDLASDGNPLPEGEYASTRYDPFVPDTEANNTFRDTY
                     YEEYDALPTYNAEGAYRAVYLYKEAIESAGSTEASALVEEFTGMEHAGPVGDYQFSET
                     NQATVSSIWGTVSYDEEWESNVLDPVNRYEAGPDELSEALADSDLPTGI"
     gene            249038..250108
                     /locus_tag="Hlac_0230"
     CDS             249038..250108
                     /locus_tag="Hlac_0230"
                     /inference="protein motif:PFAM:PF02277"
                     /note="PFAM: Nicotinate-nucleotide-dimethylbenzimidazole
                     phosphoribosyltransferase;
                     KEGG: hsl:OE3242F
                     nicotinate-nucleotide-dimethylbenzimidazole
                     phosphoribosyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="Nicotinate-nucleotide-dimethylbenzimidazole
                     phosphoribosyltransferase"
                     /protein_id="ACM55835.1"
                     /db_xref="InterPro:IPR003200"
                     /translation="MTDVTLAVVAGTTATAAIDGISAAGADPELRKHTPSADIEIVAD
                     GRPAPDSVVPVSPSGCPTPAVVTRAVRELVGFEFVGVDAGLAVPTAPTGAQVLDAGAA
                     PGGDVRDPEPVPDAAAIFEAARGLVPEIVESRTNASDGDDVDADDDRELLVAETIPGG
                     TTTALGVLTALGERPAVSSSLPANPLGTKRAVVDEGLAASEIAAGDAADDPLDALRLM
                     GDPVLAAAAGLVVGAVERGVPVTLAGGTQMATVAALARHAGVEGRLPLATTSFVADDP
                     SADVGALADDLGLTLAATDPAFGESDHPAMAAYARGEAKEGVGMGGALALSERAGVPA
                     GDVRDRVAALTDRLLAERESPS"
     sig_peptide     249038..249088
                     /locus_tag="Hlac_0230"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.683) with cleavage site probability 0.259 at
                     residue 17"
     gene            250105..251415
                     /locus_tag="Hlac_0231"
     CDS             250105..251415
                     /locus_tag="Hlac_0231"
                     /inference="protein motif:TFAM:TIGR00379"
                     /note="TIGRFAM: cobyrinic acid a,c-diamide synthase;
                     PFAM: Cobyrinic acid ac-diamide synthase; CobB/CobQ domain
                     protein glutamine amidotransferase;
                     KEGG: hsl:OE3243F cobyrinic acid a,c-diamide synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="cobyrinic acid a,c-diamide synthase"
                     /protein_id="ACM55836.1"
                     /db_xref="InterPro:IPR002586"
                     /db_xref="InterPro:IPR004484"
                     /db_xref="InterPro:IPR006162"
                     /db_xref="InterPro:IPR011698"
                     /translation="MKGLVLGGTASGVGKTVATLATIRALEDAGHAVQPAKAGPDFID
                     PSHHERVTGRPSRTLDLWLQGEDGLRRNYARGEGDVCVVEGAMGLYDGDGSSTAAVAE
                     TLGLPVVLVVDASAGMESVAATALGFRAYADRIGRGIDVVGVIAQRAHGGRHADGIRE
                     ALPDDLTYFGRIPPNDDLAVPDRHLGLHMGDESPVPDDALDAAAEGLRTERLVDISRE
                     PAGALEPATAVESTDGDRPRVAVARDDAFRFMYPATIERLRERATVEPFAPIAGDSLP
                     PCDGVYLPGGYPELHAAELAMSPALDEVASAAAEGTPVLGECGGLMALAESLTTVDGE
                     THAMAGVLPADVRMCDRYQALDHVELRATRDAPTASAGSTLRGHEFHYSTAEIGTDAR
                     FAFDVERGTGIDGDNDGLIEHQTLGTYCHVHPESGAFDAFLDGL"
     gene            251421..252425
                     /locus_tag="Hlac_0232"
     CDS             251421..252425
                     /locus_tag="Hlac_0232"
                     /inference="protein motif:TFAM:TIGR00380"
                     /note="TIGRFAM: cobalamin biosynthesis protein CobD;
                     PFAM: cobalamin biosynthesis protein CbiB;
                     KEGG: hsl:OE3253F cobalamin biosynthesis protein
                     (adenosylcobinamide biosynthesis protein)"
                     /codon_start=1
                     /transl_table=11
                     /product="cobalamin biosynthesis protein CobD"
                     /protein_id="ACM55837.1"
                     /db_xref="InterPro:IPR004485"
                     /translation="MATAPLLTPVLASLATLAIAVALDLALAEPPARVHPVALFGSVV
                     GRFDRSWSRPRLVGVAVAVGLPIGVAAFAGGIVAAASFALPAFSALPVLVAGTILFTT
                     VSLRMLLATTAEVVELTETDPDAARESVRALAGRDATDLSPADLRSAAVESAAENLAD
                     GFVAPLGGFALGATVGLAVGGSEVALPLAAGVAAAVWVKAVNTLDSMLGYRSKPVGWA
                     SARLDDAVMFLPARVTAGCLSVAAGSIEALRWAASWAGKPGSPNSGWPMATAAAALDV
                     RLEKPGHYVLNPDASPPSVVDAERAVRLVGVSGGVAVALAAGWLLATRWLPAPAGVIG
                     "
     sig_peptide     251421..251483
                     /locus_tag="Hlac_0232"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.987) with cleavage site probability 0.489 at
                     residue 21"
     gene            252422..253195
                     /locus_tag="Hlac_0233"
     CDS             252422..253195
                     /locus_tag="Hlac_0233"
                     /inference="protein motif:TFAM:TIGR00317"
                     /note="TIGRFAM: cobalamin 5'-phosphate synthase;
                     PFAM: cobalamin-5-phosphate synthase CobS;
                     KEGG: hsl:OE3255F cobalamin (5'-phosphate) synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="cobalamin 5'-phosphate synthase"
                     /protein_id="ACM55838.1"
                     /db_xref="InterPro:IPR003805"
                     /db_xref="InterPro:IPR006311"
                     /translation="MILTALRGALGFLTRIPVGRDEAAWAAFARSPWTFPVVGYLVGG
                     LVALSLFVPAPAPTVALAFVLAVYAVTGIGHLDGVADIGDAAAVHGDREERRRVLKDS
                     ALGVGGTVALALVVLGLATAALGLVEVAATAGDGGPLPPVIGIVVAAEVGAKAATATL
                     VCVGDAPHEGLGSALTGESSPGATLSVFALAAPAALLTWPQVLPGLAALLVALATAAL
                     VARWSRRRLGGVSGDVLGATTELARVAALHAGVIAWTRF"
     gene            253195..253848
                     /locus_tag="Hlac_0234"
     CDS             253195..253848
                     /locus_tag="Hlac_0234"
                     /inference="similar to AA sequence:KEGG:OE3257F"
                     /note="KEGG: hsl:OE3257F GTP:adenosylcobinamide-phosphate
                     guanylyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="GTP:adenosylcobinamide-phosphate
                     guanylyltransferase"
                     /protein_id="ACM55839.1"
                     /translation="MCGGRGTRLGGETEKPLREITGRPMVDRVLDALVESRIETTHTI
                     VSPHATRTRERLAARANDSPSLSIVDAPGNGYVADLQYAMGTVGAGGAPLLTVAADLP
                     LLDGAAVNAVLDAARTADGDSLTVCVPAARKRELGVSADATTEIDGREVVPAGINVVG
                     GSDTSERDDGEDSTADHGGAVHLTDDARLAVNVNYPSDVRTAERLLNSDSTGYHTDQ"
     gene            253845..254906
                     /locus_tag="Hlac_0235"
     CDS             253845..254906
                     /locus_tag="Hlac_0235"
                     /inference="protein motif:PFAM:PF00155"
                     /note="PFAM: aminotransferase class I and II;
                     KEGG: hsl:OE3259F L-threonine-O-3-phosphate decarboxylase"
                     /codon_start=1
                     /transl_table=11
                     /product="aminotransferase class I and II"
                     /protein_id="ACM55840.1"
                     /db_xref="InterPro:IPR004838"
                     /db_xref="InterPro:IPR004839"
                     /translation="MNLDTALDLEREPHGSSDDPDPLDFSANINPEVPPGVEEAYREA
                     FAAARSYPVEPPESFREAAAEYVDCDPDAVVPTPGGLAAIRAAIALAVDPGDTALIPA
                     PSFGEYAREVRLQGGEPAFVAADAVLDADPADHALAVVCAPNNPTGTDYERAELEGFA
                     ARCRAADTLLLVDEAFRGFTDRPSLAGEEGVVVARSLTKLFGLPGIRAGFAVATGKFG
                     AALERARRPWNVSVPALATGAHCMRQGGFIRRTRERIRSERSRMAATLAERYDVAPSE
                     APFLLLDVGEGERGRSVEQAVADARDRGVAIRDATTFRGLDSHVRVAVRRPAENDRLL
                     AALGVGDGTATDPSEADDV"
     gene            254899..255645
                     /locus_tag="Hlac_0236"
     CDS             254899..255645
                     /locus_tag="Hlac_0236"
                     /EC_number="3.5.1.90"
                     /inference="protein motif:PFAM:PF01955"
                     /note="PFAM: protein of unknown function DUF105;
                     KEGG: hma:rrnAC1935 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF105"
                     /protein_id="ACM55841.1"
                     /db_xref="InterPro:IPR002808"
                     /translation="MFEAAVRDGVLRLRRPETRWLSTGWNGGRLRADAAYNVSVPEGF
                     DRTDLGAYRDERLARAGFKSEEDPPTLFTGVSMVHAYGARLGSVVAYATVGLSNPAML
                     PMDPTGVTGATDDAGDSEPGAAASTGEPPRRPGTVNLVVGTTRRLADGAAANLVAVAA
                     EAKAATLLATAGVPGTTSDAVVVGDDPTGEPAAFSGSATPVGAAARVCVRDAVRASLR
                     SRYPDGDLPGPAADAEHGVVADERAEVFEL"
     gene            255642..256400
                     /locus_tag="Hlac_0237"
     CDS             255642..256400
                     /locus_tag="Hlac_0237"
                     /inference="protein motif:PFAM:PF02572"
                     /note="PFAM: ATP:corrinoid adenosyltransferase
                     BtuR/CobO/CobP;
                     KEGG: hwa:HQ1405A cob(I)alamin adenosyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP:corrinoid adenosyltransferase
                     BtuR/CobO/CobP"
                     /protein_id="ACM55842.1"
                     /db_xref="InterPro:IPR003724"
                     /translation="MTTDNNDTDSTTDDDADAPTDGEPTESDESSDPAARTPGGGSAP
                     EPEPIEPAAPEEFGLVQAWWGDGKGKTTAAMGMGFRAAGHGYRVHMLQFMKGGADSVE
                     GVRGEYNAIAAMPGFSYENAGHYGWHGLLDGSGDDEHEAKASAAFERAEDLVAGAADA
                     DLAAPIPLDGDPDDGVHMLILDEVLYAADRGLVDPEEVVALAESKPETLELVLTGSHG
                     EPDYLDGVADLITNVRKDAHPFDAGHRARRGTEY"
     gene            256422..257978
                     /locus_tag="Hlac_0238"
     CDS             256422..257978
                     /locus_tag="Hlac_0238"
                     /inference="protein motif:TFAM:TIGR00313"
                     /note="TIGRFAM: cobyric acid synthase CobQ;
                     PFAM: Cobyrinic acid ac-diamide synthase; CobB/CobQ domain
                     protein glutamine amidotransferase;
                     KEGG: hsl:OE3246F cobyric acid synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="cobyric acid synthase CobQ"
                     /protein_id="ACM55843.1"
                     /db_xref="InterPro:IPR002586"
                     /db_xref="InterPro:IPR004459"
                     /db_xref="InterPro:IPR011698"
                     /translation="MTDHNLDTETILVAGTASHAGKSTLVAGLCRLLARRGVSVAPFK
                     AQNMSNNARVALTPDGEWGEIGVSQHVQARAAQIPATTDMNPVLLKPRGDGESQLVIN
                     GGAVGHFAAGEYYESHWDQARDAAVAAHRRLAADHDVIVAEGAGSIAEINLHDRDLAN
                     VECARFADAAIVIAVDIERGGAFASLYGTLELLPDDVRERVAGAVITKFRGDPALLEP
                     GIEEIEARTEVPIVGVVPHDDPGLPAEDSLSLPDADGEGGPGVSGTDDGVPEEETVRI
                     AVPRLPRISNFTDLTPLAREPGVRVAYVPLDATLDAPLADADAVVLPGSKNTVDDLLA
                     LREAGLDEAIRRFEGPIVGICGGYQLLGERITGADIEGTGSESTVEGVGVLPVETHFS
                     PDKRVERVTRTVAGVGPLAGATGTAAGYEIHMGRSSPTGETARPLGPESAATGRALGT
                     YLHGLFENGAVRDAFVSTVFEMADESRPTEPSRSAGDPDDTDRSSYDRAADLVAENVD
                     LAAAGLGELE"
     gene            258099..258578
                     /locus_tag="Hlac_0239"
     CDS             258099..258578
                     /locus_tag="Hlac_0239"
                     /inference="protein motif:TFAM:TIGR01068"
                     /note="TIGRFAM: thioredoxin;
                     PFAM: Thioredoxin domain;
                     KEGG: hwa:HQ1629A thioredoxin"
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin"
                     /protein_id="ACM55844.1"
                     /db_xref="InterPro:IPR005746"
                     /db_xref="InterPro:IPR006662"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="InterPro:IPR017937"
                     /translation="MSDTADATDGGESTKSERERIRERKLRELQEELEREGEIGGEPA
                     EKLGEESTATPDEPIDVAGPEEFRRVVDEHDVVVVDCYADWCGPCQMMEPTIEAIASD
                     TDAAVAKVDVDANPEIAQQLGARSIPTLLVYADGEAVDRFTGAQDRTTLESAIERAA"
     gene            258693..259361
                     /locus_tag="Hlac_0240"
     CDS             258693..259361
                     /locus_tag="Hlac_0240"
                     /inference="protein motif:TFAM:TIGR01915"
                     /note="TIGRFAM: NADPH-dependent F420 reductase;
                     PFAM: NADP oxidoreductase coenzyme F420-dependent;
                     NAD-dependent glycerol-3-phosphate dehydrogenase domain
                     protein;
                     KEGG: hma:rrnAC2108 F420-dependent NADP reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="NADPH-dependent F420 reductase"
                     /protein_id="ACM55845.1"
                     /db_xref="InterPro:IPR004455"
                     /db_xref="InterPro:IPR010185"
                     /db_xref="InterPro:IPR011128"
                     /translation="MKIAILGGTGDIGQGLALRLAADTHHEVTIGSRDAERAETKAEE
                     YTTELDSRGLDATVAGAENETAAAAARVIVLAVPPYHVGDTVEAIADTLDEGDVLVSP
                     ATGMKRDDEGFHYHRPGAGSVTRIAADAAPDGVDVVGAFHNLAAARLANLDADLGIDT
                     LVIGDDEDAKGTVIDVAEGIEGLRALDAGGIANAPEIEGLTPLLINVAENNDGLNDLG
                     IKFT"
     gene            259420..260262
                     /locus_tag="Hlac_0241"
     CDS             259420..260262
                     /locus_tag="Hlac_0241"
                     /inference="protein motif:PFAM:PF00348"
                     /note="PFAM: Polyprenyl synthetase;
                     KEGG: nph:NP0604A multifunctional long-chain (E)-prenyl
                     diphosphate synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="Polyprenyl synthetase"
                     /protein_id="ACM55846.1"
                     /db_xref="InterPro:IPR000092"
                     /translation="MEYLERRVALAEDRLEAVIDEVEPDELSEEVGHVVLAGGKRVRP
                     AVTILACEAFDGDPDAAVDFAAGIEFVHNASLVIDDIIDRSEVRRGTPSAWAEYGYGP
                     AIIASDGLLGEAFALFSADPRAMRTVAEALVELGEGEATELAARPTTEAEYMELARRK
                     TGALFRAAAELGAIAGGADSHAVDSFGEYAERVGVAFQMRDDVLDATADADDLGKPTG
                     QDAEMDRPSVLQVTSLSPEEIDERAREQSELALAALDDADPPETEAIEYLRDLAEFVV
                     VRER"
     gene            complement(260285..260785)
                     /locus_tag="Hlac_0242"
     CDS             complement(260285..260785)
                     /locus_tag="Hlac_0242"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: hwa:HQ2479A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACM55847.1"
                     /translation="MDVEDHPLADDDDTWTTVIEECRATAEEYRDRGWTAFAAVPGDV
                     VPVPAPGDSADEKVGLDVLLSSEEFDRLTELVEADGFDEFEAFRAHENGIVYLTLVFR
                     ATATETALCLPLYYRVAEADRMLGRVRAGDAMTTYVHALSGDERIEFDHEDPTPLFPP
                     QDTGGA"
     gene            260893..263604
                     /locus_tag="Hlac_0243"
     CDS             260893..263604
                     /locus_tag="Hlac_0243"
                     /inference="protein motif:TFAM:TIGR01727"
                     /note="KEGG: hma:rrnAC2227 dipeptide ABC transporter
                     ATP-binding;
                     TIGRFAM: oligopeptide/dipeptide ABC transporter, ATPase
                     subunit;
                     PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
                     transporter domain protein;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="oligopeptide/dipeptide ABC transporter, ATPase
                     subunit"
                     /protein_id="ACM55848.1"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010066"
                     /db_xref="InterPro:IPR013563"
                     /db_xref="InterPro:IPR017871"
                     /translation="MPPLLSLSDVRTQFSTERGQVKAVDGIDLEIREGETVGLVGESG
                     SGKSVTALSTMGLVDDPGEIVGGTVELTDARVADELRDRYDAAEFVDGDTIDLTAAPE
                     EALRFVRGREISMIFQDPMTSLNPSVTVGEQVAESLKLHQYGGRRKDSWFNAVREILP
                     KISRDVDDEVREETIEVLEEVGIPEPGARIDEYPHEFSGGMRQRVLIAIALACQPGLL
                     VADEPTTALDVTIQAQILDLIDDLQADLGMSVLMITHDLGVVAETCDRVAVMYAGEIV
                     EEGPVEEIFGNPSHPYTYTLLESLPSEEKERLTPIEGNVPDLIDMPSGCHFAPRCPWA
                     TEECTSGEIPYLQHGAEDVDHRSKCIMESFDKNEYGDDAVGPGRDRSIGEPLVEIDGL
                     RKYYEQTDSVLDRVLGADDRSVKAVDGIDFTINRGETLGLVGESGCGKSTAGRALLHL
                     TKPTDGRVVFAGTDLTELDGSALREQRKNLQMIFQDPLSSLDPRQTVGQTIREPLSIH
                     DLPESDPSVATEAEVTVSGIARDRVGVTVDDEIDAVVGSGSGVATAHVDVTVADGEVD
                     VDVREHLGVEGTVERTDAGDVERVSVTVSAGDTDRLRRRRRVRQLLEAVGLEVGQYDR
                     YPHELSGGQRQRVGIARALAVDPEFIVADEPVSALDVSVQAQILNLMEDLQDRFDLTY
                     LFIAHDLSVVRHISDRVAVMYLGEIVEVAATDELFADPQHPYTKALLSAIPAPDPTVD
                     TDDRVILEGDVPSPIDPPSGCHFRTRCPSVIPPADLDIKQETYREVMNYRQRVDRQAI
                     DVETILEAADESPGQVAADGGTASAAPSGGDAIPPGAVEAVRDVQFDQYPDGRAGEVV
                     DRSLRLVIAGEWEEAADILEETFASVCEREEPTLPDGDHPAACHLID"
     gene            263745..265472
                     /locus_tag="Hlac_0244"
     CDS             263745..265472
                     /locus_tag="Hlac_0244"
                     /inference="protein motif:PFAM:PF00496"
                     /note="PFAM: extracellular solute-binding protein family
                     5;
                     KEGG: hma:rrnAC2228 dipeptide ABC transporter ATP-binding"
                     /codon_start=1
                     /transl_table=11
                     /product="extracellular solute-binding protein family 5"
                     /protein_id="ACM55849.1"
                     /db_xref="InterPro:IPR000914"
                     /db_xref="InterPro:IPR006311"
                     /translation="MSSRDESVSRRKFLGAAGGAAVTVGLAGCSDNDGEDSDGSDGSD
                     GSDGSNGSDGSDGSDGGDDTSLLRYGRGSHSATLDFQNSTSGEVAKVTEQIYDTLINF
                     EPGESTLTDGLASDYSLDGETASLTLKEGVTFHNGEEFTAQDFEATYRRFVDSEYEYY
                     AGDDYVSAYGPFTLGNWIDEIQVDGDYEMTIQLTQTYAPFLRNLAMFAAAVHSEAAIE
                     EYGTDLSENAVGTGPFELNTLDDSNEQIRLDAYDDYWGDGPQVDEAVFVTVGENSTRA
                     QSLASGELDIIDGLGAQSSQQVESADSAELVRTEGINIGYMAFNIAAVEEFQDRRVRQ
                     AVSHAINTEAIVNQIYAGFATEASQPLPPNVLGHNDDIEPYPYDPEQAQSLLEEAGYG
                     DGFSFELATFQNPRGYNPSPLQTAETVASNLGEVGIEVEINQQSFAPFLEYTAQGRHD
                     ACFLGWYTDNADPDNFAYVLLHPQVEESELTEGQDWVSFDTEGYNTSNRSAWANQEYM
                     DLVEEGQQTTTESDRAELYNEAMQIAHDEAPWVYLDYAEELRGVANRVNGFQIAAISG
                     PYLNLVSLE"
     gene            265497..266516
                     /locus_tag="Hlac_0245"
     CDS             265497..266516
                     /locus_tag="Hlac_0245"
                     /inference="protein motif:PFAM:PF00528"
                     /note="PFAM: binding-protein-dependent transport systems
                     inner membrane component;
                     KEGG: hwa:HQ2476A ABC-type dipeptide/oligopeptide/nickel
                     transport systems, permease protein"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport systems
                     inner membrane component"
                     /protein_id="ACM55850.1"
                     /db_xref="InterPro:IPR000515"
                     /translation="MFPKRFVLKRLLLLVPVLIGVATLVFSILHLSPGDPALTIAGER
                     ASQEFVERIRADLGLNDPIWVQYLDFLGNVARFDFGESYVINRNTSVREVLSDTLPVT
                     LELALYGQLFGILFGIPLGVLSAVKQDTLTDHTTRVGALAGISVPIFWSGPLLILLFA
                     QVLGVLPTSGRISSVYNVGAIRVTGMVTIDTLLAGDWDMFWSAVRHMLLPSLVIGVYS
                     MALISRMMRSSMLEVVRQDYMRTARAKGQGAKITVLKHGFRNALIPVVTIIGIQFGGL
                     LGGAVLTETVFAIGGIGTLLVEAIEVGDYPIVQGTVLTFAFLFTLVNLVVDVTYSYLD
                     PRIQQ"
     sig_peptide     265497..265592
                     /locus_tag="Hlac_0245"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.929) with cleavage site probability 0.638 at
                     residue 32"
     gene            266513..267442
                     /locus_tag="Hlac_0246"
     CDS             266513..267442
                     /locus_tag="Hlac_0246"
                     /inference="protein motif:PFAM:PF00528"
                     /note="PFAM: binding-protein-dependent transport systems
                     inner membrane component;
                     KEGG: hma:rrnAC2230 oligopeptide transport system permease
                     protein OppC"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport systems
                     inner membrane component"
                     /protein_id="ACM55851.1"
                     /db_xref="InterPro:IPR000515"
                     /translation="MSTETLRDGETETTSRGLVDRVRASPFLSQLLSNRLALAGIAII
                     VAMLVIAVYARLTLDLEIISRSQLGTNPNRAAPSLEYPFGTDGQARDLLPRVGYGAWY
                     AMLFGTVTVGASTVLGVGLGIIAAYYGDITDNVIMRTMDVLLAFPSLLLALALVSIFP
                     DELGLWRAVAALTLVYTPRFARVVRGAALTVLENEYIDATVALGATDPRVLVRHVLPN
                     CLAPITVQSTLNFGLAIIDLAALSFLGFGASAGTPSWGLMLSNGVSQGLLTGVWWWSF
                     FPGLFLALTVLGFNLLGDGMRDALDPRMREAVD"
     gene            267446..267796
                     /locus_tag="Hlac_0247"
     CDS             267446..267796
                     /locus_tag="Hlac_0247"
                     /inference="similar to AA sequence:KEGG:rrnAC2231"
                     /note="KEGG: hma:rrnAC2231 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55852.1"
                     /db_xref="InterPro:IPR002345"
                     /translation="MPLSPVVRERGRLVAGGVAVGSVATPILVIGLVVVGGFAPLAAA
                     ETAFAFGGLWFGLALLGWAGSVASGRAIEAAQERLGADTDWTERRSRRAMARIVGFGA
                     GMMLVAPVIGTVVG"
     gene            complement(267904..269235)
                     /locus_tag="Hlac_0248"
     CDS             complement(267904..269235)
                     /locus_tag="Hlac_0248"
                     /inference="protein motif:TFAM:TIGR01727"
                     /note="KEGG: hwa:HQ1306A ABC-type
                     dipeptide/oligopeptide/nickel transport system, ATPase
                     protein II;
                     TIGRFAM: oligopeptide/dipeptide ABC transporter, ATPase
                     subunit;
                     PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
                     transporter domain protein;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="oligopeptide/dipeptide ABC transporter, ATPase
                     subunit"
                     /protein_id="ACM55853.1"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010066"
                     /db_xref="InterPro:IPR013563"
                     /db_xref="InterPro:IPR017871"
                     /translation="MTDPLVTVDGLEKYYYENDTLLDRLTGAEPEAVQAVDGVSFEVR
                     EGETLGVVGESGCGKSTLAETLMRLRDPTGGSVTFDGEPVFELSGGDLDAFRRRAQVM
                     FQDPFSSLDPRMTAGEIITEPLAIHDVGTSAERRERAESLLEEVGLSADQIDRYPHEF
                     SGGQRQRIGFARALAIDPEFIVLDEPVSALDVSVQAQVLNLLADMQAERDLTYLFIAH
                     DLSVVRHISDRVAVMYLGKVVEIGPTEEIFEDPQHPYTKALLESVPRADTEERSRTVE
                     TIRGDVPSPRNPPSGCSFRTRCPELIQPPGLDVPQAAFREISEFRTRIENGNIDVDLR
                     WEQVDDPDREDRTAFVDSLRSEAFDEELPAADEDVILEAIRALADGDREAAAATLRER
                     YRSPCEAIEPALPAGDHPSACLLNEQPDEVETAHEEWEASHDAPGVGASSE"
     gene            complement(269228..270454)
                     /locus_tag="Hlac_0249"
     CDS             complement(269228..270454)
                     /locus_tag="Hlac_0249"
                     /inference="protein motif:TFAM:TIGR01727"
                     /note="KEGG: nph:NP0764A dipeptide/oligopeptide/nickel ABC
                     transporter ATP-binding protein;
                     TIGRFAM: oligopeptide/dipeptide ABC transporter, ATPase
                     subunit;
                     PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
                     transporter domain protein;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="oligopeptide/dipeptide ABC transporter, ATPase
                     subunit"
                     /protein_id="ACM55854.1"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010066"
                     /db_xref="InterPro:IPR013563"
                     /db_xref="InterPro:IPR017871"
                     /translation="MTDLLRVRDLSTRFFTEEGQINAVENVSFTVEAGSVLGVVGESG
                     SGKSVTGLSLIDLVESPGQITSGEIWYNNADLADRIGEEDPEAVDGDFVDLRRLSEAE
                     RRSLRGSAFSMIFQDPMSSFNPSITVGEQIAEAAEVQRRASANPRSTRSRTQGYGLGQ
                     MFLDGVLPNRSYTSEESWDRAIELLERVGIPDPAERAEEYPHQFSGGMLQRAMIAQAL
                     AGDPDLLVADEPTTALDVTIQAQILDLLADLQETMEMSVVLITHNLGVIARIADRVSV
                     MYAGEVVERGTLQDVFDDPVHPYTKGLLGSVPDIDRPDDRLEPIAGNVPDLVDANMPD
                     RCYFADRCPKAMTDCLTRLPEYEVTDSHRARCVLAEREYSEADAVSAERLAGPTDDRA
                     ATDDDSAAHDAQVSND"
     gene            complement(270451..271470)
                     /locus_tag="Hlac_0250"
     CDS             complement(270451..271470)
                     /locus_tag="Hlac_0250"
                     /inference="protein motif:PFAM:PF00528"
                     /note="PFAM: binding-protein-dependent transport systems
                     inner membrane component;
                     KEGG: hwa:HQ1308A ABC-type dipeptide/oligopeptide/nickel
                     transport system, permease protein II"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport systems
                     inner membrane component"
                     /protein_id="ACM55855.1"
                     /db_xref="InterPro:IPR000515"
                     /translation="MISPRTLRNLRSELSRSLLAKLGIAIIAVILFTAMFAPLLAPHD
                     PTDQNLDNTNIPPLGFMATENQTSTQMVDGEVQIVEEEVVVNTTAAHPLGTDSLGRDV
                     LSRTMFGARTSLLVGLFGTSIAVVLGVTVGITAGYYGGRIDDALMRFADVMLAFPSLV
                     LAIALIGLWGQASLRIPDPLVELGIASAEMPENIVLPGTVIVVVALVNWVWFARVARG
                     EALSVRDQEYVKAARSMGGSDLHLILRHVLPNSLTPILVLATIQIAAIILLESSLSFL
                     GFSGAQLSWGFDIAQGRQYLSSSWWIATMPGLAIVAAVVGINLIGDWLRDALDPGIEG
                     QGGAP"
     gene            complement(271562..272581)
                     /locus_tag="Hlac_0251"
     CDS             complement(271562..272581)
                     /locus_tag="Hlac_0251"
                     /inference="protein motif:PFAM:PF00528"
                     /note="PFAM: binding-protein-dependent transport systems
                     inner membrane component;
                     KEGG: nph:NP0760A dipeptide/oligopeptide/nickel ABC
                     transporter permease"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport systems
                     inner membrane component"
                     /protein_id="ACM55856.1"
                     /db_xref="InterPro:IPR000515"
                     /translation="MALGRFLLKRGIQGVLVVWGVVTAVFLLRFITPGNPVTFVAPLD
                     ASAELRAQIAADLGLDQPLYIQYVDYIGGLLQGDMGYSYLRGTEASTIVFARVPATVE
                     LAVAATIVAIVIAIPLGVISATRRREPADYGATLFSLVGISTPNFWLGIMLILVLSVQ
                     FDLFPTSRRPIGFFETFTFLVTVENGLSVPMNVGAFLDGLRTWLWHITLPAVTLGTYF
                     TALVTRLTRSGMIEELGQPYVRAARAKGLPESLIQYKHALQNTLIPIVTVLGLQLGTL
                     IGGAVITEAVFSWPGLGTLVIDAINVRDWPLIQGSLIVIGTGFVLINIFVDSLYAYLN
                     PRVVH"
     gene            complement(272588..274228)
                     /locus_tag="Hlac_0252"
     CDS             complement(272588..274228)
                     /locus_tag="Hlac_0252"
                     /inference="protein motif:PFAM:PF00496"
                     /note="PFAM: extracellular solute-binding protein family
                     5;
                     KEGG: hwa:HQ1310A ABC-type dipeptide/oligopeptide/nickel
                     transport system, substrate binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="extracellular solute-binding protein family 5"
                     /protein_id="ACM55857.1"
                     /db_xref="InterPro:IPR000914"
                     /translation="MSRDHSNVNRRTYLTYVGGTAATVGLAGCSDNGGSGEDNENGSD
                     GSDGSDGSDGGDEEQLPEPETREEHLQRANLRLNQRAPWIFLNRQYSVYGIASRLGWD
                     ARRDERIEAQAISVTEGEPSVAITQSSMDSGLDPHDHRETPTDNIVVQAYDGVLGRNA
                     DGDIIDALATDYERLEDGRVRFEIRDGVTFHNGDELQPSDIAYSVNRVVDPEVGISSP
                     QNDQLAGVTGAEVVDGGVEVTSDGINPIVFSLFASYCKVVQQDWIESRDTSAINSDMN
                     GTGPFQVVEYEQDVEIVYEPYEGYWGDAPEIEELTIRSASEASTRVSQLLAGETDLIV
                     NVPPQEVSRVRDEDTTEVTAVPSTRVVFNAMRYDVEPFSSVEFRQAMNYAIDLDSIIE
                     NILQGFADATGQPTLEGFVGYNEEIDPYPQDIEQAEQLVEDSGHAGAEITLETPVGRY
                     LRDVEIAQAVASQIDELSNVSCEVEQRDFASLAGEVTSGDIENMPHFYLLGWGNTTFD
                     ASQTIIPLLTSDGALSSYQGDDEVDELMSESQNLPGGN"
     gene            274413..274868
                     /locus_tag="Hlac_0253"
     CDS             274413..274868
                     /locus_tag="Hlac_0253"
                     /inference="similar to AA sequence:KEGG:NP0768A"
                     /note="KEGG: nph:NP0768A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55858.1"
                     /translation="MSRADLGERWQRVFDDTEATAAEYRDRGWEALALHPGDVNPIAD
                     EAQLHVLLPGSEFDAVNELLSGVPIESIRVYAAGSETASYRLVVAENATAEVAVCVPT
                     FVLDSDNEALEAAATDAGELVIRLRPLDDRDHVEFAVDDPSLFFQDPAE"
     gene            274969..275682
                     /locus_tag="Hlac_0254"
     CDS             274969..275682
                     /locus_tag="Hlac_0254"
                     /inference="protein motif:PFAM:PF00156"
                     /note="PFAM: phosphoribosyltransferase;
                     KEGG: hwa:HQ3228A adenine phosphoribosyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosyltransferase"
                     /protein_id="ACM55859.1"
                     /db_xref="InterPro:IPR000836"
                     /translation="MNRAEKAALQLQAVAVLRMLKETRTYEELSEVTGLPAGDLNRYV
                     NGHVLPGTDRASEVVEAVGRDALADELLARVEFDDEGYVDNSGVVFDQSFLDLVAPVA
                     AETFEFESPDVVLTAATDGITLGAAMASFFDARLAYAKKSKETAVEEFIESRQRLASG
                     IELTYYLPASAINAGDTVLVVDDLIRSGETQELLLDIALQADADVTGVFTLIAVGDKG
                     MKRAREITDAPVGALTTFE"
     gene            275851..277230
                     /locus_tag="Hlac_0255"
     CDS             275851..277230
                     /locus_tag="Hlac_0255"
                     /inference="protein motif:PFAM:PF00860"
                     /note="PFAM: Xanthine/uracil/vitamin C permease;
                     KEGG: nph:NP1252A transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="Xanthine/uracil/vitamin C permease"
                     /protein_id="ACM55860.1"
                     /db_xref="InterPro:IPR006043"
                     /translation="MGLSDTLAARFDVESHGSDVRTELVAGLTTFLAMSYIIVVNPAI
                     LSDAIQIEGYGQGEVFQMIAIATILSAAIGTVVMALYANRPFGLAPGLGLNAFFAYTV
                     VLGLGIPWQTALAAVFVEGVAFMLLTLVGARKYVIQLFPEPVKRSVGAGIGLFLLFIG
                     FQELQIVVPDDATLVTLGGIFGNPWAILGLLGLAFTFGLWARGITGSIVIGILTTAAV
                     GWGLTLAGVFERGVITPETLPSAQYDITPLAGAFVDGLGQIEPLTFVLVVFTFFFVDF
                     FDTAGTLIGVSQFGDFLDEDGDLPDMDKPLMADAVGTTAGAMLGTSTVTTFIESSTGV
                     EEGGRTGLTALAVAGLFVASLAVIPIVAAIPSYASFIALIVVGVMMLQGLVEVDWDDP
                     AWAVSAGLTVTVMPFAYSIADGLAAGIIAYPLIKVAVGEYDDVAPGQYVIAALLVVYY
                     VLQTRGVIL"
     gene            277330..277590
                     /locus_tag="Hlac_0256"
     CDS             277330..277590
                     /locus_tag="Hlac_0256"
                     /inference="protein motif:PFAM:PF00462"
                     /note="PFAM: glutaredoxin; Glutathione S-transferase
                     domain;
                     KEGG: hma:rrnAC2520 glutathione S-transferase
                     domain-containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="glutaredoxin"
                     /protein_id="ACM55861.1"
                     /db_xref="InterPro:IPR002109"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="InterPro:IPR011767"
                     /db_xref="InterPro:IPR017937"
                     /translation="MVMTDLTLYELEGCPYCAKVKAKLADLDLEYESVMVPRSHGKRT
                     EVEEISGQTGVPVLVDEEHGIDAMPESDDIVEYLEETYGDAS"
     gene            277651..278019
                     /locus_tag="Hlac_0257"
     CDS             277651..278019
                     /locus_tag="Hlac_0257"
                     /inference="protein motif:PFAM:PF02643"
                     /note="PFAM: protein of unknown function DUF192;
                     KEGG: nph:NP0628A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF192"
                     /protein_id="ACM55862.1"
                     /db_xref="InterPro:IPR003795"
                     /translation="MPSVRLVHRSGPSDDRESQLLASDVDVARSTLEQGRGLMFRRSI
                     PDDYALVFPFDAPDIQWLHMLFVPFAIDALWLVDGEVQKTKRLAPFVGLGRGRADTVV
                     ELPAGAADGVAVGDEVRLVE"
     gene            complement(278039..279457)
                     /locus_tag="Hlac_0258"
     CDS             complement(278039..279457)
                     /locus_tag="Hlac_0258"
                     /inference="protein motif:TFAM:TIGR00229"
                     /note="KEGG: nph:NP1912A signal-transducing histidine
                     kinase;
                     TIGRFAM: PAS sensor protein;
                     PFAM: ATP-binding region ATPase domain protein; PAS fold-4
                     domain protein; PAS fold domain protein;
                     SMART: PAS domain containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="PAS/PAC sensor signal transduction histidine
                     kinase"
                     /protein_id="ACM55863.1"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR013656"
                     /db_xref="InterPro:IPR013767"
                     /translation="MDRDGESTPRVVQSFVEAVPTPAVACDPETHAIRAANAAAAALL
                     GQDRRTLTLMGLTDLGEADETVDGEPVAAAVDEAIDREGVTELEWETGGEWERRRLSL
                     SLHTTTIADERWLIVGLTDVTDRVTAEEELRSQQHVVDAIASTMPAALFQCSADGTLA
                     RWNDQLAADTERDGEELSGTDLTALFDDETRDTVAEALRRVYREREPAECEATLFTRS
                     GERVPYQLALGPVVDGDELVGAIGVGEDRTEASLREERLAVLARVLRHNFRNDLNVVT
                     GFTERAIDTVDDPELASELERVVDTAERLLRVGETSRRVERLLADRPAPSRIDLDNAV
                     DEALVSLPSELREGADIEVDVPEGITVSAIGYLAEAIAELVENAIRHSDTERSRVEIT
                     AAELPSESWTSLVVADDGPGIPPTERSVLTGEETPLEHASGLGLWYVNWIVSAGGGSF
                     DISSASAGGTRIEMELRTLDDG"
     gene            complement(279524..282118)
                     /locus_tag="Hlac_0259"
     CDS             complement(279524..282118)
                     /locus_tag="Hlac_0259"
                     /inference="protein motif:PFAM:PF01131"
                     /note="PFAM: TOPRIM domain protein; DNA topoisomerase type
                     IA central domain protein; DNA topoisomerase type IA zn
                     finger domain protein;
                     SMART: Helix-hairpin-helix DNA-binding class 1; DNA
                     topoisomerase I ATP-binding; DNA topoisomerase I
                     DNA-binding; Toprim sub domain protein;
                     KEGG: hwa:HQ1267A DNA topoisomerase I"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA topoisomerase type IA central domain
                     protein"
                     /protein_id="ACM55864.1"
                     /db_xref="InterPro:IPR000380"
                     /db_xref="InterPro:IPR003583"
                     /db_xref="InterPro:IPR003601"
                     /db_xref="InterPro:IPR003602"
                     /db_xref="InterPro:IPR006154"
                     /db_xref="InterPro:IPR006171"
                     /db_xref="InterPro:IPR013497"
                     /db_xref="InterPro:IPR013498"
                     /translation="MSRGPELIITEKDNAARRIADILSGESATAERENDVNVYKWGGK
                     RCIGLSGHVVGVDFPAEYNDWRDVEPVELIDAPITKEPTQEGIVAALRKLARNASRVV
                     IATDYDREGELIGKEAYELVREVNEDAPIDRVRFSSITDNEVNEAFANPDELDFDLAA
                     AGEARQVIDLTWGAALTRFLSLSARQLGEDFISVGRVQGPTLKLIVDREREIKAFDPE
                     AYWELYGNLTKSGGDPFEARYFYLNDEGNEAERVWNGDVAEVLTEAFDAADEAVVDDV
                     RRRTRTDDPPTPFNTTAFIRAAGSLGHSAQRAMSLAEDLYTAGYVTYPRTDNTVYPED
                     LDPRELIEELSVASTFGKDAKSLLEQEEIEPTEGDEETTDHPPIHPTGELPSASDLSE
                     DEWEVYELIVRRFLATCAEPATWERLRVVALANDEATAIAERADGLAALRNPEEASGP
                     GDLVADGGLRLKANGKRLLEAGYHDVYPYRSSDERIVPDVEVGETLALTDRRTDAKET
                     QPPRRYGQSRLIEEMEKRGVGTKATRHRTLEKLYDRNYIESDPPRPTRLAEAVVEAAE
                     EFAEHVVSEEMTAQLERDMQAIAAGEKGYDEVTEASRELLNRVFDDLTESREAVGDHL
                     QKSLKADKTLGPCPECGSDLLVRKSRQGSYFVGCDGYPDCEYTLPLPSSGKPLLLDET
                     CEEHELRHVKMLAGRKTFVHGCPQCKADEADEQEDEVIGACPECGEEHGGELAIKRLR
                     SGSRLVGCTRYPDCDYSLPLPRRGEIEVTDEICEEHGLPHLRVHSGDEPWELGCPICN
                     YREFTARQEGSELQTVEGIGEKTAEKLKDAGVDGVDDLKSIDPDELAADVDGVGADTV
                     RDWQAKAD"
     gene            282430..283242
                     /locus_tag="Hlac_0260"
     CDS             282430..283242
                     /locus_tag="Hlac_0260"
                     /inference="protein motif:PFAM:PF03631"
                     /note="PFAM: ribonuclease BN;
                     KEGG: nph:NP0192A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease BN"
                     /protein_id="ACM55865.1"
                     /db_xref="InterPro:IPR004664"
                     /translation="MKRLGHAVEVALTVGQMAREHDIKYPAAALAYYAFVSQVPLLIL
                     VLAVVSDQLVGQIQTTTPDFLTPGAQQLLSEALVTASGRTWAALLAVGVLVWSGANIV
                     IGFQTVVNRVENTPRESFRTQLHDAGSIIGSFGLVILAVILTNVIFALLPVGRVLSYS
                     KPFVQFGTLTIAFLPLYYAPSRLVSSLTEALPGALTAAVGWTVLLTAVSFYAANATQY
                     ALYGVLSGIIIILTSFYLGAIILMIGAIVNAVIADADDTEGVSRRYRRQESL"
     gene            complement(283292..284497)
                     /locus_tag="Hlac_0261"
     CDS             complement(283292..284497)
                     /locus_tag="Hlac_0261"
                     /inference="similar to AA sequence:KEGG:rrnAC1285"
                     /note="KEGG: hma:rrnAC1285 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55866.1"
                     /translation="MSDATAVAADEPEVPDIDLPSDAFDAVLDALADREPGDSLHFEG
                     FSVARGAGSDRDDESDEDAPDEYVLANGDRQTGLSERDLHEALDDRAAAVTDWYAFER
                     VVGEFGPRRAFLRWLEDADGATVATRYAALDEGIERAWGELKITATVTDRGERRYDVR
                     HADDAGVQIDELDAYDDPLDARELVTLDEKGRYRPLKTAPSLAGGWVFPDLGPRDAYE
                     AVETIYPATVANWHREREGELDVTHWRETMARQSGIYGVVKTWDRGEGHEHVDWVEEA
                     CCDDSQCLKRREWQYDDETELDVDGGDGVFPCREPCSVVVSAARKWTRLESEQPRTYE
                     FELTPSEKEQVEEIIDAVADGRIDEIREADTKEGANRYRTRFLRAKRFDDEGNLGGVP
                     TGPDEEDEE"
     gene            complement(284500..285369)
                     /locus_tag="Hlac_0262"
     CDS             complement(284500..285369)
                     /locus_tag="Hlac_0262"
                     /inference="protein motif:PFAM:PF01903"
                     /note="PFAM: cobalamin (vitamin B12) biosynthesis CbiX
                     protein;
                     KEGG: nph:NP1588A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="cobalamin (vitamin B12) biosynthesis CbiX
                     protein"
                     /protein_id="ACM55867.1"
                     /db_xref="InterPro:IPR002762"
                     /translation="MQSLVIVAHGSHLNPGSSAPTYDHADTIRATGAFDEVKTGFWKE
                     EPHFREVLRTVEGDEIYVVPLFISEGYFTEQVIPRELRLDGWDVSEWNSDGLSADQAT
                     LIAEDIDREVHYCGPVGTHRAMTDVIVRRAESVTGNSDVGEGFGLAVVGHGTERNENS
                     AKAVQYHADRIAERDRFDEVKALYMDEDPEVDDLPEFFESDDVVLVPLFIADGYHTQE
                     DIPEDVGLCEDHTEGYDVPTEVDGTRIWYAGAVGTEPLMADVILERAADAGADLGTAL
                     DDVRETTRVATGD"
     gene            285482..286024
                     /locus_tag="Hlac_0263"
     CDS             285482..286024
                     /locus_tag="Hlac_0263"
                     /inference="similar to AA sequence:KEGG:rrnAC1291"
                     /note="KEGG: hma:rrnAC1291 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55868.1"
                     /translation="MPPRAADPAMSLAAETREAARARPFVLDALRAGVLNHSAAAAWL
                     ADEAGLDGDPDAIATALRRFREELSDYATADRAASVSMRSGVGVVDGDSLEDADPLLR
                     VGGAAVVPEGRDTAILATGTVDAAALAAVLRRLAAADVAVEAAGVAGETLVVVVGRRD
                     GAIAVRIAEASLAVVPSQED"
     gene            286080..286886
                     /locus_tag="Hlac_0264"
     CDS             286080..286886
                     /locus_tag="Hlac_0264"
                     /EC_number="4.2.1.51"
                     /inference="protein motif:PFAM:PF00800"
                     /note="PFAM: prephenate dehydratase; amino acid-binding
                     ACT domain protein;
                     KEGG: hwa:HQ1385A prephenate dehydratase"
                     /codon_start=1
                     /transl_table=11
                     /product="prephenate dehydratase"
                     /protein_id="ACM55869.1"
                     /db_xref="InterPro:IPR001086"
                     /db_xref="InterPro:IPR002912"
                     /translation="MNAVTLGPAGTYSHRAARAVAAEVSFRESVTAIVDAVAAGEFER
                     GVVPIENSIEGSVTESLDALADYDVSVTREIVTPIRHALLAQGPEFEVVASHSQALAQ
                     CRNWLEEHYPNAGLEAVASTARGVERAREDARVAGIGHPDNAGDDLEILAEDIQDRTS
                     NATRFLVVAPESARSDAGGKTTLIVYPNANYPGLLLELLEAFADRNLNLSRIESRPSG
                     ERLGDYLFHFDVDAGLYEEHMAKAVEDVEAIADNGWVRVLGSYDTEHVLE"
     gene            complement(287160..290078)
                     /locus_tag="Hlac_0265"
     CDS             complement(287160..290078)
                     /locus_tag="Hlac_0265"
                     /inference="protein motif:PFAM:PF00270"
                     /note="PFAM: helicase domain protein; type III restriction
                     protein res subunit; DEAD/DEAH box helicase domain
                     protein; DEAD/H associated domain protein;
                     SMART: DEAD-like helicases;
                     KEGG: hwa:HQ2752A Lhr-like helicase"
                     /codon_start=1
                     /transl_table=11
                     /product="DEAD/DEAH box helicase domain protein"
                     /protein_id="ACM55870.1"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR006935"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR013701"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014021"
                     /db_xref="InterPro:IPR016160"
                     /translation="MAELSGMDAFAHLGSELRTALSEQGFSTPTEPQREAIPPLADGK
                     NALVLAPTGTGKTETAMLPVFDAIVDARDAPGDQPRSGISALYITPLRALNRDMMDRL
                     EWWGDRLGVEVAVRHGDTTRYERSKQADDPPDVLITTPESLQAILTGSKMRVALEDVA
                     HVVIDEVHELASAKRGAQLTVGLERLRRVAGPFQRIGLSATVGTPEEVGKFLVGSGKR
                     DPDHPGDREFEIVEVAAGTRTDVRVLDPPITDRDTTLAGELAVDETTASHVRTIREIV
                     ADHESTLIFVNTRQTAEALGSRFKTLAEREEKAGSIDDPTEIEVHHGSLSKDVRIDVE
                     DRFKSGELDGLVCTSSMELGIDVGRVDHVVQYGSPREVARLLQRVGRAGHRRDLVSEG
                     TVVTQGGDDTLEALAIARRAGAELVEPAAIHHGSLDTVANQIVGVVMDEGDVHAREAY
                     QIVTSAYPFRDLAEETFQEIVRELDGNHLLWLDEASDTLEKSGGTWQYFYANLSMIPD
                     ESTYEVYDMSSRRGIGTLDERFVVNFAGPGETFIQRGEMWRITEVDEEEERVNVTPIA
                     DPAGEVPSWIGREIPVPKPVAEEVGRIRGEAAEALAAGSTPEAVAGDLAERYPADERT
                     IATALKPVVDHVDADHPVPTDRRIVIEGSARTVAVNAAFGHEVNETLARLLAALVGQR
                     AGSSIGMDVDPYRIEFEVPHGVGPGTFREVLETTDPDRLEAYLELALKNSDALKFTLA
                     QVAAKFGSIKRYREGRGRFGGDRLLAALEGTPVYDEALREVFHADLAVGETAELLEDV
                     QDGSIDLAIARERTPLGIAGRSSGTEFLVPENADADVIETIRERIRNDRVILFCLHCA
                     DWKRTTKVRRVPDQPKCPDCGSTRVATLNPWDEETVTAVRATEKDEEQERRTKRAHRA
                     ASLVQTHGKRAVIALAARGVGPHNAARIINKLREDEDEFYRDVLRQEREYARTQSFWD
                     "
     gene            complement(290165..290611)
                     /locus_tag="Hlac_0266"
     CDS             complement(290165..290611)
                     /locus_tag="Hlac_0266"
                     /inference="protein motif:PFAM:PF03625"
                     /note="PFAM: protein of unknown function DUF302;
                     KEGG: hma:pNG7131 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF302"
                     /protein_id="ACM55871.1"
                     /db_xref="InterPro:IPR005180"
                     /translation="MSIPFDPHDLDPEEYGETQTTLETDHESAIERVRKVCLDAGFGI
                     PVEFSPSEMLNEKVDADRDPYYVLGACNPAMADRALDATDGRIGALFPCNMVIRQESP
                     NEQVVYHVSIMKIARLLGLPTDDEEMDAIIADTGEMVDTVFAELEQ"
     gene            complement(290734..291030)
                     /locus_tag="Hlac_0267"
     CDS             complement(290734..291030)
                     /locus_tag="Hlac_0267"
                     /inference="similar to AA sequence:KEGG:rrnAC0220"
                     /note="KEGG: hma:rrnAC0220 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55872.1"
                     /translation="MSDNDEAEAEEPEEPAVELGEGPDVAGEPIARVASRLTWPAKRS
                     DLRAQEGDATIRTPEGARELDDVLAESSVPLFESRSEFVAEVEELVGRGPVATE"
     gene            complement(291089..292255)
                     /locus_tag="Hlac_0268"
     CDS             complement(291089..292255)
                     /locus_tag="Hlac_0268"
                     /inference="protein motif:PFAM:PF00557"
                     /note="PFAM: creatinase; peptidase M24;
                     KEGG: hsl:OE2065R putative X-Pro dipeptidase"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M24"
                     /protein_id="ACM55873.1"
                     /db_xref="InterPro:IPR000587"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR001131"
                     /db_xref="InterPro:IPR001714"
                     /translation="MTEDVHAERRERAAARLRETGADGLVCFPSRNLQYLTGFAEEPG
                     ERHLLLVVPAADRSSDTPDGGDQTAAEPTLLVPALLVPALYETQVKEETTVGAVRTWA
                     DGDDPTAAVQDLLGDLGLSEGRLLVDDTMWATFTQDLRAAAPDAEWGLASEALADLRV
                     RKDEAELDAMRAAAAAADETVRDLRDLGADAVGMTERDLTDWIADRLAAHGGEGTSFE
                     TIVGSGPNGAKPHHGCGDREIRAGEPVVLDFGTRVDGYPSDQTRTLVFDGEPPAEYER
                     VHETVRAAQAAAVEAVEPGVAAEAIDRAARDVIEDAGYGDAFFHRTGHGVGLDVHEEP
                     YIVAGNDRELEPGMVFSVEPGIYLDGRFGCRIEDLVVVTEDGCERLNDTDRGWR"
     gene            292351..292494
                     /locus_tag="Hlac_0269"
     CDS             292351..292494
                     /locus_tag="Hlac_0269"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACM55874.1"
                     /translation="MSIQKGSTFDCPACDVTAPSASVPYDALGYAVCPVCSHTTAPGA
                     DGK"
     gene            292565..292795
                     /locus_tag="Hlac_0270"
     CDS             292565..292795
                     /locus_tag="Hlac_0270"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: hsl:OE2715R hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACM55875.1"
                     /translation="MPWSLGREDDVITEWERSDGYATVRVRERGDGGFVARLDVMEQA
                     ADESAYERERFDDREAALDRAAAWREERDIDA"
     gene            292880..294217
                     /locus_tag="Hlac_0271"
     CDS             292880..294217
                     /locus_tag="Hlac_0271"
                     /inference="protein motif:PFAM:PF01011"
                     /note="PFAM: Pyrrolo-quinoline quinone;
                     KEGG: hma:rrnAC3198 putative cell surface protein or
                     serine/threonine protein kinase-related protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Pyrrolo-quinoline quinone"
                     /protein_id="ACM55876.1"
                     /db_xref="InterPro:IPR002372"
                     /translation="MTEPTRRDWLRALGAASTAGAAGLAGCSAFDAGGPTGDDTPGNG
                     GPGNGTDDGGSDGGDRPTEASDDGVKTQFRQGLRNTGYIDATIPESVETAWEVPANSG
                     DHSASKGSPIEAPNGAIVLADDTGRVQSIAPDGSVNWATSISDDDRGSHGTPAIADGS
                     LYVGTYDGVVSAVALDDGEILWQTDAGDAAAASPTYLDGKLYVAIEHATPSGSVVKMD
                     AESGEIEWRDERPTNHPHSTVAIDREHGRLIFGSNDGHCYAWSFPELEREWAYDTGGD
                     VKLPLAISEGIAVVPSWAGTVTGLDVEDGSQLWEFETDGGETSRGDPSPGDTGGVMCA
                     PAVHDGEVYVGSHDSNAYAIDLQTGEKLWSTATGGWITGSAVATNDHVLVGSYDAKLY
                     ALDRDDGSVTWTAEGRGDVTSAPIVTDDGIYYAERAPQDSDEAGMCYKLVASE"
     sig_peptide     292880..292969
                     /locus_tag="Hlac_0271"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.946) with cleavage site probability 0.817 at
                     residue 30"
     gene            complement(294258..295703)
                     /locus_tag="Hlac_0272"
     CDS             complement(294258..295703)
                     /locus_tag="Hlac_0272"
                     /inference="protein motif:PFAM:PF08489"
                     /note="PFAM: domain of unknown function DUF1743;
                     KEGG: nph:NP1318A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="domain of unknown function DUF1743"
                     /protein_id="ACM55877.1"
                     /db_xref="InterPro:IPR013696"
                     /translation="MPIVAVDDTDSRERGMCTTYVGARLAERLDAAGGRVRRRLLVRL
                     NPAVKHKTRGNAAVALHVSGVEAEAAFDLAAETVREFAAADDPRTSPGVVVADIDVAG
                     DPSDPSASAPPFPPSAASTAPIPADVADFARRALRHRLSLDEALTLADDHGFRHAAFG
                     SGGETNTEAVAGRGRIGALAAVGAPAAFDDWTVERISYRELDRCGTPRDVDIESVFAA
                     ADRGYPTVWDTVDRGTGEAVCVPNAPGPILHGIRGDDANACREIAEEIASEPVERTAT
                     FLTNQGTDAHLAPGAIGDLRDGAGYRVAGVVASEPETKRGGHVHVDVAAPDDDRVPRL
                     RCVAFKPTGRFRDRVRALRPGDRVTVCGEHEVRLIGDSGGAEDDGNDGPDSGQSTATL
                     KLEKFAVRDLVETEPAVPTCPDCGRSMSSAGRGQGYRCRDCGTDAPGKVEESIDRELE
                     PGWYEVPPSARRHVAKPLVRGGFDGPIHPER"
     gene            295879..296850
                     /locus_tag="Hlac_0273"
     CDS             295879..296850
                     /locus_tag="Hlac_0273"
                     /inference="protein motif:PFAM:PF01381"
                     /note="PFAM: helix-turn-helix domain protein;
                     KEGG: hwa:HQ3058A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, XRE family"
                     /protein_id="ACM55878.1"
                     /db_xref="InterPro:IPR001387"
                     /translation="MSRTALIENITAMLEDADFLVSDRCAVRPKSFDVAARRDEDLVL
                     LKILGNVDALDAETGAEMRRLGEYLQATPMVIGIRTRDEELKPGVVYFRHGVPVINPD
                     TGYDLFVEGMPPLIYAAPGGLYVSLDGDLLADEREERGWSLGRLATELGVSRRTVSKY
                     EDGMNASIEVAIQLEDLFNEPFSSPVDVLDGAGEVRDADPTPSAPETDPDDEHVLHVL
                     TNAGFTVHPTARAPFKAVSEDEGSSPARVLTGHSTFTPAAEKRARIMSSIGEVARTRS
                     VYFTEENEDRESVDGTALVSCEELADISDPEGIRELIRDRAKAPSEA"
     gene            complement(296902..298563)
                     /locus_tag="Hlac_0274"
     CDS             complement(296902..298563)
                     /locus_tag="Hlac_0274"
                     /inference="protein motif:PFAM:PF01656"
                     /note="PFAM: Cobyrinic acid ac-diamide synthase;
                     KEGG: hsl:OE3971R ParA domain-containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Cobyrinic acid ac-diamide synthase"
                     /protein_id="ACM55879.1"
                     /db_xref="InterPro:IPR001969"
                     /db_xref="InterPro:IPR002586"
                     /translation="MATVYAVASAKGGVGKTTTTAAVATLLADSGADVVAIDADLGMA
                     NLAESVGVTPGGITLHDVLAGAADPPDAVHAGPAGLRVVPGAADLEAYAAADPSGLRE
                     VVAAFDDADYVFVDAGAGLSHDSTLPLGLADETLLVSTAERSALGDTEKTRQLTERLG
                     GSVAGVAITRLDPATAADDRPVDAVAETLDVPVLGRIPEDDAVLRAVEAAQPLPVFAP
                     DAPATRAYRDLTRALTGAAIDGLGLVDGSDAETEKTDVETENEDTAAGGAYSGADAER
                     TGKAEPLDEAGSGDADDSGDVTETSREDDSIPDAEASDESEKADESEEIGESEEVPDE
                     ADAQDDEDIIVADSEQAGLGEPGDEEDIIVAAESPVEDIEEAEATDAEKADTEKADTE
                     KADTEATDAESDPEATAVDAVDGKTETVGEDHVDGDDLEAMIEEDLEPETFDDEGDST
                     AEPTAGDEPAGSESSVESPPDEEPKSDGESVSVSESEPEPVPEAESGPNEETEPDPDD
                     ELAGSVPFRDDDTGTMNTAFSEDDDDDDDDDDDENGGFFSRLFGR"
     gene            298720..299076
                     /locus_tag="Hlac_0275"
     CDS             298720..299076
                     /locus_tag="Hlac_0275"
                     /inference="protein motif:TFAM:TIGR02926"
                     /note="TIGRFAM: ATP synthase H subunit;
                     KEGG: hma:rrnAC3152 vacuolar (H+)-ATPase G subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase H subunit"
                     /protein_id="ACM55880.1"
                     /db_xref="InterPro:IPR014275"
                     /translation="MARPEVLDRIKEAETEADEIIATAESDADERLAEARQRAEEIRA
                     EAEEEADSEADDRLVAAREEIEERREEILESGRADRDELEREARDRVDSAVDYAVERF
                     EEAVNQQAEEAVDAQA"
     gene            299063..301264
                     /locus_tag="Hlac_0276"
     CDS             299063..301264
                     /locus_tag="Hlac_0276"
                     /inference="protein motif:PFAM:PF01496"
                     /note="PFAM: V-type ATPase 116 kDa subunit;
                     KEGG: hwa:HQ3249A H(+)-transporting two-sector ATPase,
                     subunit I (A-type ATP synthase)"
                     /codon_start=1
                     /transl_table=11
                     /product="V-type ATPase 116 kDa subunit"
                     /protein_id="ACM55881.1"
                     /db_xref="InterPro:IPR002490"
                     /translation="MLRPERMSKVSVTGSKRVIDDVIEATYEHHSLHVTDYDERYEGF
                     SPGESLDGAESVNERLVTVRSLESILDVEDDEADKSRALDDEELEAELADVRDRVNDL
                     NDRRDDFKAEIRDREEEIDRMEPFADLGIELDLLGGYDSLEVVVGEAKPDAVEATLAD
                     ADGIDAFEVFAGSDIVAIFARPADGADEGVLQDSLVGVDIALLEVPDADASPSEYVAE
                     LEREREDLRNNLDEVESELAAVKEEAAGFLLRAEEQLTIEAEKKQAPLSFATTENAFI
                     AEGWVPTETFPDLQAAIANAVGDHAEVEELERASFTPDGDHHTEAVADGGSAGDAERE
                     AATDGGHATHGSDDPPVVQDNGGAAGPFEVLVQGFGRPKYSEFDPTLLVFLTFPLMFG
                     FMIGDVGYGVLYAAIGFFLYSRYDGTFRELGAVALWAGGFTILFGIYFGIDVFGYHAY
                     QLLPGEVHWPVDGKGLSPADIDWALSFLVASVLFGLAHLNVGHILSFVSNYQQHDLKH
                     AMYEGGSWLLILNGAWIWIFSQHVPGPKPDFLFEAFSILTFGAVSFTGFPVAVGYAAI
                     VAIVLGVVLLAIGEPPELAEVLAPIVNVISYARIMAVLLAKGGMALAVNLLAFGAYID
                     EGGEGSFHFIFSADYLEYVQNHPGDYELVFAGITTAFDPASIGAVGILALVGGIVVAV
                     VGHIVVLALGVTSAGIQAVRLEYVEFFGNFYEGGGDAYLPFGYDRQYTSDE"
     gene            301434..301685
                     /locus_tag="Hlac_0277"
     CDS             301434..301685
                     /locus_tag="Hlac_0277"
                     /inference="protein motif:PFAM:PF00137"
                     /note="PFAM: H+transporting two-sector ATPase C subunit;
                     KEGG: nph:NP1022A H(+)-transporting two-sector ATPase
                     subunit K.a (A-type ATP synthase)"
                     /codon_start=1
                     /transl_table=11
                     /product="H+transporting two-sector ATPase C subunit"
                     /protein_id="ACM55882.1"
                     /db_xref="InterPro:IPR000245"
                     /db_xref="InterPro:IPR002379"
                     /translation="MLEATNELGNVALQAGGTLTDPSAAAALAVGLAALGAGYAERGI
                     GSAAVGAMAEDDDLFVNGLILTVLPETIVILALVVVFIV"
     gene            301707..302285
                     /locus_tag="Hlac_0278"
     CDS             301707..302285
                     /locus_tag="Hlac_0278"
                     /inference="protein motif:PFAM:PF01991"
                     /note="PFAM: H+transporting two-sector ATPase E subunit;
                     KEGG: hma:rrnAC3156 V-type ATP synthase subunit E"
                     /codon_start=1
                     /transl_table=11
                     /product="H+transporting two-sector ATPase E subunit"
                     /protein_id="ACM55883.1"
                     /db_xref="InterPro:IPR002842"
                     /translation="MSLDTVVEDVRDEARARAEDIREAAESEADEIVAEAEADAERIR
                     EERLAEVDRQIDQEREQTLSSAKLEAKQERLGARRDVLEDVYDDVEAAIEGLDGDRRR
                     ELTETLLDATLAEFDDDEDVAVYTHTEDVDLVEELVEDRNAVVDGEIDCLGGVVAESD
                     TSRVRVNNTFDSILESVWDDELKNISERLFDQ"
     gene            302282..303328
                     /locus_tag="Hlac_0279"
     CDS             302282..303328
                     /locus_tag="Hlac_0279"
                     /EC_number="7.1.2.2"
                     /inference="protein motif:TFAM:TIGR02923"
                     /note="TIGRFAM: ATP synthase A1, C subunit;
                     PFAM: H+transporting two-sector ATPase C (AC39) subunit;
                     KEGG: hma:rrnAC3157 V-type ATP synthase subunit C"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase A1, C subunit"
                     /protein_id="ACM55884.1"
                     /db_xref="InterPro:IPR002843"
                     /db_xref="InterPro:IPR014272"
                     /translation="MSAVGSSNPEYVVARVRARRGSLYGDEEYRKLTRMGPAEIARFM
                     EESSYGTEINALGSLHGGVDLIEYALNRNLAGQFDDILDWSEGSLYGLIARYLRKFDA
                     WNVKTVIRGVYTDADQSEIEVDLIRAGEFDDRRIRRLLEADSIDAVVEVLEDTIYGDP
                     LREAYAEYEETGVLVPLENAVDRAFYERLLSGLGNDEPTRQYEAFLKAEVDFRNAANA
                     LRLARSGADIDPAAYFIEGGELFTRGSLARLARNLDELVEYIADSQYGDELGPALREL
                     EEANSLIAFEHATDAALLAYGDQLGTIHPVSVTPVISYILAKEREVENIRAIARGKEA
                     GLSADEIESELVIT"
     gene            303325..303654
                     /locus_tag="Hlac_0280"
     CDS             303325..303654
                     /locus_tag="Hlac_0280"
                     /inference="protein motif:PFAM:PF01990"
                     /note="PFAM: Vacuolar H+transporting two-sector ATPase F
                     subunit;
                     KEGG: hwa:HQ3245A V-type ATP synthase subunit F"
                     /codon_start=1
                     /transl_table=11
                     /product="Vacuolar H+transporting two-sector ATPase F
                     subunit"
                     /protein_id="ACM55885.1"
                     /db_xref="InterPro:IPR008218"
                     /translation="MSQEIAVVGSPEFTTGFRLAGVRKFENIPDDEKDERLDDAVERT
                     LDDEGTGIIVMHTDDLDHLSRGTREAVEGSIEPVLVTLGGSGAGSGGLRDQIKRAIGI
                     DLMEEDD"
     gene            303656..305431
                     /locus_tag="Hlac_0281"
     CDS             303656..305431
                     /locus_tag="Hlac_0281"
                     /inference="protein motif:TFAM:TIGR01043"
                     /note="TIGRFAM: ATP synthase, A subunit;
                     PFAM: H+transporting two-sector ATPase alpha/beta subunit
                     central region; H+transporting two-sector ATPase
                     alpha/beta subunit domain protein;
                     KEGG: hwa:HQ3244A V-type ATP synthase subunit A"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase, A subunit"
                     /protein_id="ACM55886.1"
                     /db_xref="InterPro:IPR000194"
                     /db_xref="InterPro:IPR000793"
                     /db_xref="InterPro:IPR004100"
                     /db_xref="InterPro:IPR005726"
                     /translation="MSKAESTDTTAENGVIQSVSGPVVSARDLDARMNDVVYVGDEGL
                     MGEVIEIEGDITTVQVYEETSGVAPGEPVENTGEPLSVDLGPGMLDSIYDGVQRPLDV
                     LEGKMGSPYLDRGVDAPGIDLEKKWEFEPTVEVGDEVGRGDVVGVVEETVTIDHKVMV
                     PPDALEEDETTEVTAIEAGSFDVTETVAELANGTNVSMHQEWPVREARPSENKKTPRT
                     PLVSGQRILDGLFPIAKGGTAAIPGPFGSGKTVTQHQLAKYADADIIVYVGCGERGNE
                     MTEVIEDFPELEDPANGNPLMARTSLIANTSNMPVAARESCIYTGITIAEYYRDMGYD
                     VALMADSTSRWAEAMREISSRLEEMPGEEGYPAYLAARLAQFYERAGYFENINGTEGS
                     VSAIGAVSPPGGDFSEPVTQNTLRIVKTFWALDADLAERRHFPSINWNESYSLYKDQL
                     DPWFENEVADDWAEKRQWAVDVLDEETELQEIVQLVGKDALPDDQQLTLEVARYLREA
                     YLQQNAFHPVDTFCPPEKTYLMLTTIETFNDEAFDALEAGVPVEDLVDTEAAPGINRI
                     GVQEDYEEYIEELKAEISEELRSLY"
     gene            305433..306857
                     /locus_tag="Hlac_0282"
     CDS             305433..306857
                     /locus_tag="Hlac_0282"
                     /inference="protein motif:PFAM:PF00006"
                     /note="PFAM: H+transporting two-sector ATPase alpha/beta
                     subunit central region; H+transporting two-sector ATPase
                     alpha/beta subunit domain protein;
                     KEGG: hwa:HQ3243A V-type ATP synthase subunit B"
                     /codon_start=1
                     /transl_table=11
                     /product="H+transporting two-sector ATPase alpha/beta
                     subunit central region"
                     /protein_id="ACM55887.1"
                     /db_xref="InterPro:IPR000194"
                     /db_xref="InterPro:IPR000793"
                     /db_xref="InterPro:IPR004100"
                     /translation="MKEYQTITEISGPLVYAEVDEAIGYDEIVEIETAQGETLRGQVL
                     ESSEGVVAIQVFEGTSGIDQNASVRFLGETMKMPVTEDLLGRVLDGSGRPIDDGPEIV
                     PEERQDIVGAAINPYSREYPEEFIETGVSAIDGMNTLVRGQKLPIFSSSGQPHSQLAM
                     QIARQASVPEEEEGGDDEEGSEFAVIFGAMGITAEEANEFMQDFERTGALERSVVFMN
                     LADDPAVERTVTPRMVLTTAEYLAFEKDYHVLVILTDMTNYCEALREIGAAREEVPGR
                     RGYPGYMYTDLAQLYERAGRIQGRDGSVTQIPILTMPGDDDTHPIPDLTGYITEGQIY
                     VDPDLNSQGLQPPINVLPSLSRLMDDGIGEGLTREDHADVKDQMFAAYAEGEDLRDLV
                     NIVGREALSELDNKYLDFADDFESEFVDQGFDQNRSIEETLEIGWDLLSMLPKDALNR
                     IDEEFIEKYYREDDSDRQVVEAAD"
     gene            306979..307665
                     /locus_tag="Hlac_0283"
     CDS             306979..307665
                     /locus_tag="Hlac_0283"
                     /inference="protein motif:TFAM:TIGR00309"
                     /note="TIGRFAM: V-type ATPase, D subunit;
                     PFAM: H+transporting two-sector ATPase D subunit;
                     KEGG: nph:NP0264A V-type ATP synthase subunit D"
                     /codon_start=1
                     /transl_table=11
                     /product="V-type ATPase, D subunit"
                     /protein_id="ACM55888.1"
                     /db_xref="InterPro:IPR002699"
                     /translation="MAKDVKPTRKNLMAIEDRIDLSERGHDTLEQKRDGLIMEFMDIL
                     DQAQDVRSDVSENYETAQRKIDMARAMEGDVAVRGAAAALKEHPEITTQSKNIMGVVV
                     PQIESSKVKKSLDERGYGLLGSSARIDEAADAYEELLEKVILAAEVETAMKKMLTEIE
                     TTKRRVNALEFTLLPRLYENQEYIEQKLEEQEREEIFRLKKIKAKKEEEEKAEAAAEA
                     AAVEDPEPAD"
     gene            308262..308426
                     /locus_tag="Hlac_0284"
     CDS             308262..308426
                     /locus_tag="Hlac_0284"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACM55889.1"
                     /translation="MSGLEIPTWDPETAILIGTILMEAVLLYVGYAGLERIVGPRLMK
                     LLVGGSTDAQ"
     gene            308416..309468
                     /locus_tag="Hlac_0285"
     CDS             308416..309468
                     /locus_tag="Hlac_0285"
                     /inference="protein motif:PFAM:PF01925"
                     /note="PFAM: protein of unknown function DUF81;
                     KEGG: hma:rrnB0294 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF81"
                     /protein_id="ACM55890.1"
                     /db_xref="InterPro:IPR002781"
                     /translation="MLSSLTGILDSSPEMLALFVGFGLVVGLLFGFFGMGGSFLVTPA
                     LLMLGYPATVAVGSGMAFVFGTAVIATLKHHDLGQVDYKLGAIMIAGTTVGIEVGRAS
                     VFYLEELGLADGIISVVYVFLLGGIGLMITRESLASDGGGGIDHDAAAAEDLSEYEIP
                     DIAKKIQQTVRIPPMVTLRGDIRVSVWVITAVAFSTGILSGFLGVGGGFIRMPAMIYA
                     IGVPTPVAVGTDLFEIVFSGGIGSYLYGQSGGVDLGIVVPLLFGSALGARIGSAATAV
                     VDADDIKVYFGGMLLAGSVAVGIGEIGTYLGNETLETLGLVLVIGAAVVVAAAIVFTT
                     LRSLRATRNHVSATAD"
     gene            309532..309987
                     /locus_tag="Hlac_0286"
     CDS             309532..309987
                     /locus_tag="Hlac_0286"
                     /inference="similar to AA sequence:KEGG:NP0268A"
                     /note="KEGG: nph:NP0268A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55891.1"
                     /translation="MTNSPTVRPTATFIPVTVVVPNMSCPRCDADVVAFAVPAAIRDH
                     APAAETAICTRCLRTFPAAEAGAVGAIEDAPDLSAIDPAFPAGEGGVALALACGHLES
                     LALNRASIEALVEHAERSGADAFAFFERLDVPDAAFDLERRRSALLDMV"
     gene            complement(310029..310406)
                     /locus_tag="Hlac_0287"
     CDS             complement(310029..310406)
                     /locus_tag="Hlac_0287"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACM55892.1"
                     /translation="MQPLVAVILVGVPLAWLVVFAAYAYLDAPNHGMDRRKWALICFF
                     VPLFGFFAYVFERGERDYDPSEDPYAQGSDARTAGFAVHERRRGEKGLGPAGTEADDA
                     DEGEDEAEDEWNDPDGIDIDDDG"
     sig_peptide     complement(310332..310406)
                     /locus_tag="Hlac_0287"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.959) with cleavage site probability 0.584 at
                     residue 25"
     gene            310553..311950
                     /locus_tag="Hlac_0288"
     CDS             310553..311950
                     /locus_tag="Hlac_0288"
                     /EC_number="4.1.99.3"
                     /inference="protein motif:PFAM:PF03441"
                     /note="PFAM: DNA photolyase FAD-binding; DNA photolyase
                     domain protein;
                     KEGG: hwa:HQ1298A deoxyribodipyrimidine photolyase"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA photolyase FAD-binding"
                     /protein_id="ACM55893.1"
                     /db_xref="InterPro:IPR002081"
                     /db_xref="InterPro:IPR005101"
                     /db_xref="InterPro:IPR006050"
                     /translation="MQLFWHRRDPRTRDNVGLAAAARTGTVVPVFVYDTDLFGTMGAR
                     QRAFFLRHVKRLKERYREFGSDLVVRAGDPEKVLVDLADEYDAEAVFYNEYYRPARRN
                     RQRAVEGALEGFGVETNARTDAVLVDPGRLEERYANHGRFHDEWETVPKPEPSPEPDA
                     DALVNMRDEKTVSEIDPDIDPDIDLPATGYRAARERFDGFLEHGIRSYADTRDDLARA
                     VEAPTHAVSRMSPYLATGAIGIREMWADATDAFEAATGDERRNVDKYRDELSWREQMY
                     HLLYYTPDLAVANYKSFPNEIAWREDDTAFEAWTRGETGYPLVDAGMRQLNAEGYVHN
                     RPRQVVASFLTKHLLIDWRRGARYFTTQLIDHDHASNHGAWQWTASTGTDSVDVRIFD
                     PVAQMAKYDADATFVKEYVPELRDVPAEEIVDWPTLSRVERETLAPEYPHPIVDRNEG
                     YERAQRVFEEALGKR"
     gene            311947..313275
                     /locus_tag="Hlac_0289"
     CDS             311947..313275
                     /locus_tag="Hlac_0289"
                     /inference="protein motif:TFAM:TIGR01127"
                     /note="TIGRFAM: threonine dehydratase;
                     PFAM: Pyridoxal-5'-phosphate-dependent protein beta
                     subunit; amino acid-binding ACT domain protein;
                     KEGG: hma:pNG7371 threonine dehydratase"
                     /codon_start=1
                     /transl_table=11
                     /product="threonine dehydratase"
                     /protein_id="ACM55894.1"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="InterPro:IPR002912"
                     /db_xref="InterPro:IPR005789"
                     /translation="MKPIRLRSATESFSGIPENTALMSSVTIADVEAAAARLEPAAIV
                     QRTPVERSRSLSERCGADVRLKMEHLQRTGSFKTRGAYNAISRAVEQAAERADESELD
                     RVVAASAGNHAQGVALAASGTGIDATIVMPESAPAAKIEATRGYGAEVVLRGSAFPEA
                     MAHAQTLIDDPGTRFVHAFDDPDVVAGQGTLGLEVLDQVPDVDTVLVPVGGGGLAGGV
                     ATAIKARSPETRVIGVQTEGASTLSESLAAGELVTREEPDTIADGIATGGLSELTFGL
                     LKEHLDDVVVVSDDDVAAAILLLLERAKQMIEGAGATAAATLLNDDALDELDLAGETV
                     VPLLCGGNIDVTTLKEVVTHALVERDQLIELAVRIDDTPGTMGEISTLIGAERANIRT
                     VRHERSRPDLPVGDADLVFEVETNGPAHVDRVLKAVREAGYEVEWTTQEG"
     gene            313749..314129
                     /locus_tag="Hlac_0290"
     CDS             313749..314129
                     /locus_tag="Hlac_0290"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACM55895.1"
                     /translation="MGNSSKTDLQRDILLTWWESPNATNQEIAGACDCSSSYVSQTKN
                     RFDDYNEFEAMMDRQDAELEQMFGENIFENSGTTSATVESEGPGIAEQWNEIPNNIPG
                     LLIKHIVVMVLGYAAIQVGITLFL"
     gene            314219..315712
                     /locus_tag="Hlac_0291"
     CDS             314219..315712
                     /locus_tag="Hlac_0291"
                     /EC_number="6.1.1.16"
                     /inference="protein motif:TFAM:TIGR00435"
                     /note="TIGRFAM: cysteinyl-tRNA synthetase;
                     PFAM: Cysteinyl-tRNA synthetase class Ia DALR; tRNA
                     synthetase class I (M); Cysteinyl-tRNA synthetase class
                     Ia;
                     KEGG: hwa:HQ1654A cysteine--tRNA ligase"
                     /codon_start=1
                     /transl_table=11
                     /product="cysteinyl-tRNA synthetase"
                     /protein_id="ACM55896.1"
                     /db_xref="InterPro:IPR002308"
                     /db_xref="InterPro:IPR015273"
                     /db_xref="InterPro:IPR015413"
                     /db_xref="InterPro:IPR015803"
                     /translation="MSLVVTDTLADERVEFTADGDVTLYVCGLTVSDDPHLGHARLWF
                     HADVLHRWLDHVGYDVRHVENVTDVNEKITARIGERDAWTDERDVAETFTATTFDAMR
                     GLNLLRAEVYPRVTEHVPEIVDLVETLIEKGYAYESNGSVYFDVTAFDDYGKLSNQNV
                     QDLEAQGEPDERSEKRNPSDFALWKADGVSETAAREHAKHDHGDETPSGEIWNSPWSE
                     GRPGWHVECSAMSTTHLGDTLDIHMGGRDLVFPHHENEIAQSEAATGETFARHWLHVG
                     LLAMEGEKMSSSIGNFWTVPDALDELGVNVIRTFYAGAAYRSEQALTEETIAEAEERW
                     ERLSRTYDRAVEALDSTEARAKAEDEELRGAVETARDDLATAMNDDLNLREATAALLD
                     LTDAVNRHVDDVEDGDTESAYDYRGLREAVEAFENLAGDVLGLQFESTTDGDVDLAGE
                     LVDLVLDVREAEREAGNYERADELRDALREVGVEIEDGPDGATYRFE"
     gene            complement(316093..316719)
                     /locus_tag="Hlac_0292"
     CDS             complement(316093..316719)
                     /locus_tag="Hlac_0292"
                     /inference="similar to AA sequence:KEGG:NP2992A"
                     /note="KEGG: nph:NP2992A homolog to dolichol kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="dolichol kinase-like protein"
                     /protein_id="ACM55897.1"
                     /translation="MPLPAAEWRAEVEFERRLVHSGGTLYPVPYLLGWFTWTETRYFL
                     VAALAVVLTLEFLRLVVGFDHALYQKLIREYETDSIAGYALYQVSMTGVVLLLNPTLA
                     IPAMWMLSLGDPVSGALGDNDATEAKRPAAWIAMFLVSLSLALLFTVPAFGTGVGIAV
                     ALAGAVLAAIADGLPPIIRGVAVDDNLTIPPAAAGGMLLAVTVLGVGV"
     gene            complement(316723..318507)
                     /locus_tag="Hlac_0293"
     CDS             complement(316723..318507)
                     /locus_tag="Hlac_0293"
                     /EC_number="6.1.1.14"
                     /inference="protein motif:TFAM:TIGR00389"
                     /note="TIGRFAM: glycyl-tRNA synthetase;
                     PFAM: tRNA synthetase class II (G H P and S);
                     Anticodon-binding domain protein;
                     KEGG: hwa:HQ3709A glycyl-tRNA synthetase"
                     /codon_start=1
                     /transl_table=11
                     /product="glycyl-tRNA synthetase"
                     /protein_id="ACM55898.1"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR002315"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR006195"
                     /translation="MASEEIGELAKRRGFFFGSNGAYGGTAGFYTFGPQGAALKKNVE
                     DAWRDRFTIREGNREIEAPTIMPEAVFEASGHLEGFDDMLVECPECGESHRADHLVEA
                     VTEIEDAEALPGSEVEELIADNDIACPSCGTPLAGVTVEDFNLMFATDIGPGDGQPGY
                     LRPETAQGIFVEFPRLKEYARGNLPFGITQIGPAYRNEISPRGGLLRLREFTQAELEQ
                     FIDPEEDEPPLDRVRDVSVRLYPATEQQAEDGEYVETTIGEAVDEEIIGSPWVGYYLG
                     VAKEWYDRIGVDLDRFRFRQHLAGERAHYASDCWDAESEVDGDWIEIAGFSYRADYDL
                     SKHDEYGDDAFTVFKRYDEPKTVERATVDPDMSVLGPEFGGDAAAVAEALETLAERDP
                     DAFDSETVSVEVNGDDQTVDTDVANFSVETVTENGEHLTPHVVEPSFGVGRTVQTLLA
                     HAYSEDEVDGEERTYLSLEPEVAPQDAAVFPLVTNDDRLTELADRVAADLREAGVAVA
                     YDDSGSIGRRYRRQDEIGTPFCVTIDRDGIEGDGPETVTVRERDSAVQVRVPAEELAT
                     ELTALRTGGEFDALVDRYETVATDVETN"
     gene            complement(318508..319356)
                     /locus_tag="Hlac_0294"
     CDS             complement(318508..319356)
                     /locus_tag="Hlac_0294"
                     /inference="protein motif:PFAM:PF00571"
                     /note="PFAM: CBS domain containing protein;
                     KEGG: hma:rrnAC2699 putative inosine monophosphate
                     dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="putative signal transduction protein with CBS
                     domains"
                     /protein_id="ACM55899.1"
                     /db_xref="InterPro:IPR000644"
                     /translation="MNVSDAMTPRSDLVVVEIPGSRNDVLEYIQEFGFSSVPVVKDVD
                     GDEVYRGLVSRNDLIEQPDEDQLALLMREVPTVDADDAIGDAAATMVAEDSRRLPVVD
                     GDRLVGILTVTDVVRAIARGEIDGDTEVGGLATRAVNATYTETPLSVAEREIGLANVP
                     YAVVLDDDAGLAGILTEVDVLAVARVVEGEASTGDSIAEQDSEWSWEGIKATGARYLP
                     TRNVELPVGPVHHFMTADLVTVSDTRTAKEVAKELISNDIEQVPLVNGTDLDGIVRDV
                     DLLEGL"
     gene            319657..319878
                     /locus_tag="Hlac_0295"
     CDS             319657..319878
                     /locus_tag="Hlac_0295"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: hsl:OE4295R hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACM55900.1"
                     /translation="MSRSSTPWDEPDPDHRRTALPTDPVLDATDSPDIMASIDSSSSR
                     SELVIADVSRENAWVSVDETDATVLEEWC"
     gene            complement(319930..320859)
                     /locus_tag="Hlac_0296"
     CDS             complement(319930..320859)
                     /locus_tag="Hlac_0296"
                     /EC_number="1.1.1.169"
                     /inference="protein motif:TFAM:TIGR00745"
                     /note="TIGRFAM: 2-dehydropantoate 2-reductase;
                     PFAM: Ketopantoate reductase ApbA/PanE domain protein;
                     KEGG: nph:NP0942A 2-dehydropantoate 2-reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="2-dehydropantoate 2-reductase"
                     /protein_id="ACM55901.1"
                     /db_xref="InterPro:IPR003710"
                     /db_xref="InterPro:IPR013332"
                     /db_xref="InterPro:IPR013752"
                     /translation="MEVLVYGAGALGSLVGGLLARVHEVTLVGRDPHMRRIREDGLRI
                     DGEIEAHVRPRALTDGTHRSADLAVVTTKAYDTDAAARALATGEYDAVCSLQNGFTEE
                     RLVAALDPTVLAGTASYGARFIEPGRVTCTGVGEVVVGALSGGDDPLAKRVGSAFDEA
                     EIETTVATDMPRRRYEKLAVNAGINGPSALARLSNGATLDGPGGEAAREAAREVARVA
                     RADGVTLDEDAAVDAVERVAADTAANRSSMCEDVAADRRTEVDAIYGAAIDRADRFGV
                     PVPTCRAIASLIRAWEVGIGVRPGEDTTKASEE"
     gene            complement(320923..322134)
                     /locus_tag="Hlac_0297"
                     /pseudo
     gene            complement(322134..323090)
                     /locus_tag="Hlac_0298"
     CDS             complement(322134..323090)
                     /locus_tag="Hlac_0298"
                     /inference="protein motif:PFAM:PF04952"
                     /note="PFAM: Succinylglutamate
                     desuccinylase/aspartoacylase;
                     KEGG: hwa:HQ1352A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Succinylglutamate desuccinylase/aspartoacylase"
                     /protein_id="ACM55902.1"
                     /db_xref="InterPro:IPR007036"
                     /translation="MITLGTARAPPGETDTGRLEVGETRDGSPVRLPVAVINGAEDGE
                     TLYLQAVSDGDELNGLGVVNRVVPRLDPAELSGTVLVVGVVNYFAFQVAEHRNPIDDR
                     KMNRGYPGNEGGTTSERIAHATFQAAKQADLILDLHQGSTSRMINETRVRCGVRHHLH
                     GDCLELAKAFGCGHVLDIKGPDGQLARAGPEHGIPTVDPELGGCVGWDEESIRYGVEG
                     VFNVLRHYGFLDGDIELERQVRARGFDQYGSPAGGLVRFERELGERVSTGDLLYEVTD
                     VFGELKARVTADDDGVFWRTRRLPQVAAGEYVCSVGTNVDKY"
     gene            323247..325379
                     /locus_tag="Hlac_0299"
     CDS             323247..325379
                     /locus_tag="Hlac_0299"
                     /inference="similar to AA sequence:KEGG:OE3178F"
                     /note="KEGG: hsl:OE3178F hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55903.1"
                     /db_xref="InterPro:IPR001130"
                     /translation="MSIDIDPLSDAAGLTVTDHIENTQFEVYTDRPVEPAASPEDAHY
                     FPVDASVTVETGAIEIPRVAVVETRCGDGTLLTRGDSYAMPAGTYHVGIDPAPTKLYL
                     AFASPFSVSTTERTTRIDLDAPAEVTLGFRSLHQVPAGTIETPTDPESLMDAVSLLGS
                     ALQTTSPERSFPTLRGHPPLIEPGEEFRVPDRVEPVDSGIRIVVPPEYRYLYPVVSLA
                     YYFAADVVPGDPPRIEGDGWTHPLEPDFERRTGEVLRQAFHFDCLARTEGFYPVDLHE
                     RETTDLDLDWGRLYDLPLAERLGEYLAVPFERVEPELPQWTLTTDVRPDPENVELLPF
                     VAGELSIVRSPETVTPAMASGGDGLGFFRAPRADTASLDRDEFVRSTAGTEPTRGADA
                     SADRGAVAADTDFVRPEPVDTVEHAWVGAGVPLDANKATLDAYHRRLEAGAVEQSRIS
                     VLVVCNDEQMREEGEVADLYGLRDMVQFDIEVRHDLTREEMRETLQSDVDFLHYIGHV
                     DDRGMQCTDDYLDLTAEDLDVGVSAFLLNACQSYQQGEALVHRGSRGGIVTLSDVANS
                     PATQLGRIIARLMNSGFNLRAALYVAKRELITGHQYIVVGDGGTTICHSRSGIALVLN
                     LGINESNSWDLVAEGYPNGPYGVGTMSNLNLEKDECEHVIPFQIHISDIKMEEIDYFL
                     DLENTPIFFNDDLIWNDEPARLRALQQR"
     gene            complement(325357..325488)
                     /locus_tag="Hlac_0300"
     CDS             complement(325357..325488)
                     /locus_tag="Hlac_0300"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: hma:rrnAC0673 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACM55904.1"
                     /translation="MHESVADYVAEHPKMAGVLFTALLLLTQAAPAAANQATSVAGP"
     sig_peptide     complement(325384..325488)
                     /locus_tag="Hlac_0300"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.778) with cleavage site probability 0.742 at
                     residue 35"
     gene            325698..325946
                     /locus_tag="Hlac_0301"
     CDS             325698..325946
                     /locus_tag="Hlac_0301"
                     /inference="similar to AA sequence:KEGG:NP1446A"
                     /note="KEGG: nph:NP1446A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55905.1"
                     /translation="MIDIDATLRDAFEHTDYDLGDVAVNRKQVRVPVLQQGADPDALT
                     AVIEEALGADAVVAATVTTEAIDGEDTIGTVVSFRYQP"
     gene            326031..326840
                     /locus_tag="Hlac_0302"
     CDS             326031..326840
                     /locus_tag="Hlac_0302"
                     /inference="similar to AA sequence:KEGG:rrnAC1942"
                     /note="KEGG: hma:rrnAC1942 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55906.1"
                     /translation="MAQTMTADDGHDGVQYLAGSPVRVAMLRALRSEPRRPASLTAAV
                     DATRTTIQRILSGFRERDWVVKRGAAYHVTPTGKRVHDAYEELLDEVELADRYGQFAA
                     DLERVGADFPPSALDTGELTVAADRNPLAAVDRLTELLREGSGSEIRAVSPVVIQQFN
                     NAAAEALDAGAEVELVIDRDVVEESIAEFGPATDRALHDDGATVYVSPEPIEYGVFRY
                     DDLACVTAYDSRNNPRCVLESTDSGVVDWVDDKFESFVAEAQCLSGVVENT"
     gene            complement(326846..326986)
                     /locus_tag="Hlac_0303"
     CDS             complement(326846..326986)
                     /locus_tag="Hlac_0303"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACM55907.1"
                     /translation="MSAHSQPSVGIDHPTVVPANFEAEDDADDHAGVADDERADDGRA
                     ER"
     gene            complement(327152..327685)
                     /locus_tag="Hlac_0304"
     CDS             complement(327152..327685)
                     /locus_tag="Hlac_0304"
                     /EC_number="3.6.1.1"
                     /inference="protein motif:PFAM:PF00719"
                     /note="PFAM: Inorganic pyrophosphatase;
                     KEGG: hma:rrnAC3323 inorganic pyrophosphatase"
                     /codon_start=1
                     /transl_table=11
                     /product="Inorganic pyrophosphatase"
                     /protein_id="ACM55908.1"
                     /db_xref="InterPro:IPR008162"
                     /translation="MVNLWEDLETGPNAPDEIYAVVECLKGERNKYEYDKDIPSVVLD
                     RVLHSNVHYPYDYGFIPQSYYDDEDPFDVMVLVEDQTFPGCVIEARPVALMKMDDDGE
                     QDDKVIAVPTEDPRFDHIEDLSDLPQQTLDEIDEFFSTYKNLEAGKEVETLGWEDKQA
                     ARDAIEHAQDLYDEEFQ"
     gene            328126..328485
                     /locus_tag="Hlac_0305"
     CDS             328126..328485
                     /locus_tag="Hlac_0305"
                     /inference="protein motif:PFAM:PF03551"
                     /note="PFAM: transcriptional regulator PadR family
                     protein;
                     KEGG: hwa:HQ1230A transcription regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, PadR-like family"
                     /protein_id="ACM55909.1"
                     /db_xref="InterPro:IPR005149"
                     /translation="MSEAQSVTDESTTQTASDLTAFQQNILAILSEEAMYGLAIKREL
                     ESYYDSEVNHGRLYPNLDDLVEDGLVEKSELDKRTNQYELTEAGHDAVLGQLEWVLDR
                     FVTDETRADEVRALLTE"
     gene            complement(328605..329324)
                     /locus_tag="Hlac_0306"
     CDS             complement(328605..329324)
                     /locus_tag="Hlac_0306"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: hsl:OE1403F hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACM55910.1"
                     /translation="MTRTNDDEPPEWAKEQAREMMAAEEPSDDEETEKGDGGETEEGD
                     GERDADADDDRVPDVPADTVDEAERLTRLARRTEDEAAAAFYRERRDELVTDHDYVPR
                     LREEDDTLVLYPDEWMDDGTVQLDRIETTDRAVEVSLSGPGDAGRYREIAAYNDAVAD
                     AVADAHDAVHADTARSFAAFMSNHYVRAVDDATADMRAEFREEYFPRNGWPTDEQLAV
                     VDESLDAIESVAADVDGPEES"
     gene            complement(329311..329907)
                     /locus_tag="Hlac_0307"
     CDS             complement(329311..329907)
                     /locus_tag="Hlac_0307"
                     /inference="protein motif:PFAM:PF00075"
                     /note="PFAM: ribonuclease H;
                     KEGG: nph:NP5188A ribonuclease H I"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease H"
                     /protein_id="ACM55911.1"
                     /db_xref="InterPro:IPR002156"
                     /translation="MPTIDCDPATARAHLEDAGVRIDDGNTAHERWRAEREGAVAVAY
                     DDKVVVQGSDPTRLTALLSEGGGRAHVYFDGASRGNPGPGAVGWCLVTADGIVAEGGE
                     RIGRVTNNQAEYAALIRALEAADEYDFDEIDVRGDSQLIVKQVRGEWNANDPELRERR
                     VRVRELLERFDRWSIGHVPREINERADDLANEALDDAN"
     gene            complement(330021..330326)
                     /locus_tag="Hlac_0308"
     CDS             complement(330021..330326)
                     /locus_tag="Hlac_0308"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACM55912.1"
                     /translation="MKAARLSLLDADSLDQLGGVTGVGWTVSLLGYLTTVIGYGNALV
                     SRLIADPQSFLYVGSALFVATLGLNRLQQSATEGEQSVTERERSVTEGEQFATEQER"
     gene            330496..331497
                     /locus_tag="Hlac_0309"
     CDS             330496..331497
                     /locus_tag="Hlac_0309"
                     /inference="protein motif:PFAM:PF00382"
                     /note="PFAM: Zinc finger TFIIB-type domain protein;
                     Transcription factor TFIIB cyclin-related;
                     SMART: Cyclin domain protein;
                     KEGG: hwa:HQ1227A transcription initiation factor TFB"
                     /codon_start=1
                     /transl_table=11
                     /product="Transcription factor TFIIB cyclin-related"
                     /protein_id="ACM55913.1"
                     /db_xref="InterPro:IPR000812"
                     /db_xref="InterPro:IPR006670"
                     /db_xref="InterPro:IPR013137"
                     /db_xref="InterPro:IPR013150"
                     /translation="MTRPTRQRDHDRQRVRSEDADETETDAEGVEGADAGELDPEDFD
                     PEELTRTADGELIHEETGLIVEEEQIDPGPEWRAFNHSERQSKSRVGAPTTKTMHDKG
                     LTTTIDWKDKDAYGRSISSKKRSQMHRLRKWQERIRTKDAGERNLQFALSEIDRMASA
                     LGVPRSVREVASVIYRRALNEDLIRGRSIEGVSTAALYAACRKEGIPRSLEEISDVSR
                     VERKEIGRTYRYISQELGLEMRPVDPKKYVPRFSSELELSEEVQSKANEIIETTAEKG
                     LLSGKSPTGYAAAAIYAASLLCNEKKTQREVADVAQVTEVTIRNRYQEQIEAMGIHT"
     gene            331616..332908
                     /locus_tag="Hlac_0310"
     CDS             331616..332908
                     /locus_tag="Hlac_0310"
                     /inference="protein motif:PFAM:PF04894"
                     /note="PFAM: Protein of unknown function DUF650; Protein
                     of unknown function DUF651;
                     KEGG: hma:rrnAC3318 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Protein of unknown function DUF650"
                     /protein_id="ACM55914.1"
                     /db_xref="InterPro:IPR006978"
                     /db_xref="InterPro:IPR006979"
                     /translation="MRLDEFIEFEADERAERRRLAAEKDYGILDHLDSFERRFEEHVS
                     DDAVVGSVSPSIFVGRSNYPNVSTGLLSPVGREERAARFETSAAWYDEGVSIADVFDR
                     RTSLLNSTRGADVADAGRDGGGVHDAWNGWLGVQREVAIADRPVDVEIGLDGTPDLDF
                     DIGTEDIKTPTGPRAAARTADLGENPHVPRPVKKTLEDDDWRAEGAMTYLYRRGFDVY
                     DINTILSAGALGRGKNRRLVPTRWSITAVDDTVGQFLRGSIRDNPTVNRIEVHRNEYL
                     GNAFWVILVPGQWEYELVEMKSPGSIWNPDPGAGVYLSAASEGREGRTGYVEETAGAY
                     YAARMGVLEHLDDRGRQAKALVLRHVSDDYWGPVGVWQVREAVRNAFEGEHGTAETFG
                     EAVRGVADHLPVPLGRLRRKSTMAAGLQANLGDFVDAG"
     gene            332981..333241
                     /locus_tag="Hlac_0311"
     CDS             332981..333241
                     /locus_tag="Hlac_0311"
                     /inference="similar to AA sequence:KEGG:HQ2505A"
                     /note="KEGG: hwa:HQ2505A sec-independent protein
                     translocase component TatA"
                     /codon_start=1
                     /transl_table=11
                     /product="sec-independent protein translocase component
                     TatA"
                     /protein_id="ACM55915.1"
                     /translation="MVPTVPAFGGVPAGPELVIILMILVLLFGVPTVVIAGVVLFLKL
                     RSDGEEADTDRIAELEAEVERLREKVDDERYEKDESDGDDHL"
     gene            complement(333303..334301)
                     /locus_tag="Hlac_0312"
     CDS             complement(333303..334301)
                     /locus_tag="Hlac_0312"
                     /inference="protein motif:PFAM:PF04055"
                     /note="PFAM: Radical SAM domain protein;
                     KEGG: hsl:OE4012F hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Radical SAM domain protein"
                     /protein_id="ACM55916.1"
                     /db_xref="InterPro:IPR007197"
                     /translation="MISKGCEQCAKGGKMVLFVYGYCDQRDCFYCPLGENRKNVTDVY
                     ANERKVESNEDVIAEAKRMSALGTSITGGEPQEAMAKTCRYLELLKDEFGEDHHTHLY
                     TGITGGRENMRRLSEAGLDEIRFHPPLEMWGDMHGTEWEDILHIAREEGLTPAFEIPG
                     IRAEPEFLEFLDEGAAEFCNINEFEMSDGNYRRMQEEGFELQEGHMSAVEGSKDDSIV
                     SEMASHEKVYFCTSVFKDAAQHRNRLKRMAKNIRREFDEVTDDGTLVYGKAFADADRF
                     EALGVPEEFYTVKSDHVEVAWWLLEEMVEDGDLDRGEIVEQYPTTDGTVVERTPVA"
     gene            334455..335165
                     /locus_tag="Hlac_0313"
     CDS             334455..335165
                     /locus_tag="Hlac_0313"
                     /inference="similar to AA sequence:KEGG:rrnAC1293"
                     /note="KEGG: hma:rrnAC1293 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55917.1"
                     /db_xref="InterPro:IPR006311"
                     /translation="MTREPTADEMTDIDALTRRRALTAAGGAALAGLAGCTALDVATG
                     EPAEFTAGTATVADAALDESGYELNEVTENTQTREFDVAGSTREVRVTSTIAEYDKAV
                     ELFGERYQAAVFAVLTTPRVEVLGQAFNPVGELDDEERARLIVDRYESVSNLERSSEY
                     TTDILGTDARVVVYTADGEIKGTGVSVELEFHVAEAVEAGADYVVPLAAYPAAFGDGE
                     NVRRMLNGIEHEPASEDD"
     gene            335264..336373
                     /locus_tag="Hlac_0314"
     CDS             335264..336373
                     /locus_tag="Hlac_0314"
                     /inference="protein motif:PFAM:PF04123"
                     /note="PFAM: Protein of unknown function DUF373;
                     KEGG: hwa:HQ3256A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Protein of unknown function DUF373"
                     /protein_id="ACM55918.1"
                     /db_xref="InterPro:IPR007254"
                     /translation="MLLVLCVDLDDDLGRKTGIPTPVIGADDVTEAAVALATADPEDS
                     DVNVLFQGVNVHDELAAGGEAVEVAAVTGVDGSDVKANRAVGQEVDRVLAELSTGEEV
                     SAVVITDGAQDESVLPVIRSRMPIDGMRRVVVRQAQDLESLYYTIKQVLADPETRGTI
                     LVPLGVLLLIYPLVVVANLFDIAGAAVLGILSGVVGLYSLFRGLGLEETIDGAAASVR
                     NVLYTGRVTLVTYVVALALIVVGGVQGMDTIETVRSVRGGGVTVGIALAAFVHGFVQW
                     LAVAGVTSSLGQITDEYLAGRFRWRYLNAPFYVLSIAVVLYAVSGFFLPAAPGVTSLG
                     LPDLAMALAAGTLTAVLSTLAFAVAESQLPSADPT"
     gene            complement(336406..337377)
                     /locus_tag="Hlac_0315"
     CDS             complement(336406..337377)
                     /locus_tag="Hlac_0315"
                     /inference="similar to AA sequence:KEGG:OE1539F"
                     /note="KEGG: hsl:OE1539F hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55919.1"
                     /translation="MTSLSEAYGGRGRSEVDPRRVYLGVGSFVAGTLLLVVGLFVAAE
                     VVLPSGYSSGEARRLGGVLGGVGVPLVFLGVMTVLPADRNTRVAAIVGAAVMCLGVAL
                     FAYAYPNQWVGGPHPELRDLTLPTAGLYFVGAATTLWSVFVGVANFKTRNDPGGTVTM
                     EVTHKGETKVVEVDRAQLNRGGGVGLLGGTPDGDVETQTNRQEGSGSGSGSGSASKSR
                     SPGSAQPAGMSDGGATATGIRSPLDEDGGVDVETGGSDDQTGPAEPNGPVTPGVSPAA
                     RDGPGDTYCGNCAQFDYARTEQGMQPYCDHHDELMDDMDACEEWTPR"
     gene            complement(337472..338533)
                     /locus_tag="Hlac_0316"
     CDS             complement(337472..338533)
                     /locus_tag="Hlac_0316"
                     /inference="protein motif:PFAM:PF07085"
                     /note="PFAM: DRTGG domain protein;
                     KEGG: hsl:OE2373F putative phosphate acetyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="DRTGG domain protein"
                     /protein_id="ACM55920.1"
                     /db_xref="InterPro:IPR010766"
                     /translation="MTDTPTTLVTATGEGAGKTAITVALARLAADRDRSVGYMKPKGT
                     RLQSNVGKTLDQDPMLAREVLGLDAEMHQMEPIVYSPTFVEGAIRGTEDADALRDRIR
                     EEFDELAADRDQMFVEGGGRWTTGGVVDLTDVDVAELLDARVVLVAGYDSPNDLDEVL
                     AAADAFGDRLAGVVFNKVSDDAFESLDQDGIPFLESKGITVFGAIPSEKELAGVTVGE
                     LADELGAELLTDAPTDGFVERFLVGAMGGDEALRYFRRARDAAVITGGDRADVQTAAL
                     EASGVACLVLTGGHRPSGAVLGKAADAGKPVLAVNTDTVTAIDRAEGVVRGGRTRDAR
                     TVERMAELLAAHVDVDALV"
     gene            complement(338530..340644)
                     /locus_tag="Hlac_0317"
     CDS             complement(338530..340644)
                     /locus_tag="Hlac_0317"
                     /inference="protein motif:PFAM:PF02629"
                     /note="PFAM: CoA-binding domain protein;
                     KEGG: hma:rrnAC0888 succinyl-CoA synthetase"
                     /codon_start=1
                     /transl_table=11
                     /product="CoA-binding domain protein"
                     /protein_id="ACM55921.1"
                     /db_xref="InterPro:IPR003781"
                     /db_xref="InterPro:IPR011761"
                     /translation="MGTLNEMFDPDRVAVVGATSREGAVGRAVTSNLLDDFDGDTVPV
                     NPNYDEVLGTPCVDEVADADADVAVIVVPPSIVLDAIEACGEAGVRNVVVITAGFGET
                     GEDGAARERRLAEIADEYDLNLVGPNSLGIMSTPSGMNATFGPENALPGGLSFMSQSG
                     AFVTAVLDWANDNGIGFKDVVSLGNKAVLDETDFVDHWGNDEETDVIIGYLEGIEDGR
                     EFIEAARETTQDTPIVAVKSGRTSAGAQAASSHTGTLAGSDKAYEAGLDQAGVIRAES
                     VDELFDSAGILGSQPLPDTDSVAIVTNAGGPGVMATDAVGDADLDMASFTKKTSDALR
                     ESMPDEANIHNPVDVIGDADVERFREALEITVDDDNVGAALVLAAPTATIDFDDLADA
                     IGEVSDEMDAPVAACLMGGDRTREPKQQLQAKGIPCYFDPARGIESLATLGRYRDIKA
                     REYADPMSFDVDRKRAREILETVRDRDDNRLGVEAMELLDAYGIPTPAGEIVDSPERA
                     AEVAADIGGDVVMKIVSPDILHKSDIGGVAVGVSDADVTDTYEDLITRARNYQPDATV
                     LGVQVQEMVDLDDGVETIVGMNRDPQFGPLLMFGLGGIFVEVMEDTTFRVAPVSEPEA
                     REMTEEIQSAPLLRGARGRDPVDVDAVIETIGRLSQLVTDFPAILELDINPLVALPDA
                     DGGTNAAAVDVRLTVDPEKLEP"
     gene            complement(340893..342665)
                     /locus_tag="Hlac_0318"
     CDS             complement(340893..342665)
                     /locus_tag="Hlac_0318"
                     /inference="protein motif:TFAM:TIGR00229"
                     /note="KEGG: nph:NP2516A signal-transducing histidine
                     kinase;
                     TIGRFAM: PAS sensor protein;
                     PFAM: ATP-binding region ATPase domain protein; PAS fold-3
                     domain protein; PAS fold-4 domain protein; PAS fold domain
                     protein;
                     SMART: PAS domain containing protein; PAC
                     repeat-containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="putative PAS/PAC sensor protein"
                     /protein_id="ACM55922.1"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR000700"
                     /db_xref="InterPro:IPR001610"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR013655"
                     /db_xref="InterPro:IPR013656"
                     /db_xref="InterPro:IPR013767"
                     /translation="MSDSPDPAVLLDLAGDKIAVLDEDGIFRHLNAAVADLLGFHSDD
                     LVGTDAFALVHPDNEERLQETFARIVSGELTPDEPLEYRYRTADGGWVWLRTTVHPPE
                     ETEIDGYVLTSRDITSEVESRRRLETIASASSDVFWMFSAEWDELLFISDIVEEVFGV
                     SRDTLERQPNRFLDVVHPDDRSYVERAMDRLSNGESTLIDYRLGSADGTTKWVRVPGE
                     PVIENGTVVAVTGFARDVTDEYRRERQLAVMDNLLRHTIRNDMNIVDGTAERIVDAVA
                     AADAFDPEAWGDSVAAAEGNAEIGPDALAELGADLQEHAETIRRIASDLLATAEKQRG
                     VIDLLRQRGSPRAVEVAPVVEEALGMVVDDCDETVDVTYREPVDGEGAREGEPGDETE
                     NVDGMASEETAGEGTTNEETAGEETAGDNSTLPRVSVSYPPNAKAFTHPELDYAIAEL
                     VENALEHAESTPRIRIDVCTTDESIEVSIRDNCPPIPVEERYVITDRWEMDDLRHTGG
                     MGLWLVYWVANRSGGDLTFDTHADGNVVTLSVPNAKCGTINEDPRETTLSNRPMTAAV
                     EGADTRIRTDGSTTSEPKRRDETD"
     gene            complement(342766..343155)
                     /locus_tag="Hlac_0319"
     CDS             complement(342766..343155)
                     /locus_tag="Hlac_0319"
                     /inference="similar to AA sequence:KEGG:NP1562A"
                     /note="KEGG: nph:NP1562A transcription regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="transcription regulator"
                     /protein_id="ACM55923.1"
                     /translation="MKRNVPQATGPTTATEGDETLDDTFDALADPDCRAILGAADTAM
                     TTSELADACDIALSTAYRKVERLSETPLLVEGVRFDSDGDHAAEYTRGATDATIELGD
                     DGVTLTVDDSAADPVSAAFDTTSVSAD"
     gene            343310..343945
                     /locus_tag="Hlac_0320"
     CDS             343310..343945
                     /locus_tag="Hlac_0320"
                     /inference="protein motif:PFAM:PF04967"
                     /note="PFAM: Bacterio-opsin activator HTH domain protein;
                     KEGG: nph:NP1564A DNA binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Bacterio-opsin activator HTH domain protein"
                     /protein_id="ACM55924.1"
                     /db_xref="InterPro:IPR007050"
                     /translation="MGSGIRAEVSLPTASPSPFDGVVDGSTPIYSVARSSSNGDPETV
                     VLEFIADADLPVSEGVEVVFDYGAKAAYRFKVPRVEASPFAILDRHSVPVSETTIRDG
                     RLVVTFHATDLPTLRSVLDEFRESCSDMQVLRLLQSSSTPEESDLVTVDRSELTERQR
                     EVLTAAYDAGYFDHPKGANAGEVAESLGIDRSTFSEHMAAAQRKLLSALLD"
     gene            344067..344249
                     /locus_tag="Hlac_0321"
     CDS             344067..344249
                     /locus_tag="Hlac_0321"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: nph:NP1566A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACM55925.1"
                     /translation="MWIAVVLAAMTSQRTHTFVCPECRRSIEVDDAMRATLLETGCVV
                     CGAPVTEGDIADSQTA"
     gene            344369..344836
                     /locus_tag="Hlac_0322"
     CDS             344369..344836
                     /locus_tag="Hlac_0322"
                     /inference="protein motif:PFAM:PF01243"
                     /note="PFAM: pyridoxamine 5'-phosphate oxidase-related
                     FMN-binding;
                     KEGG: nph:NP1554A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxamine 5'-phosphate oxidase-related
                     FMN-binding"
                     /protein_id="ACM55926.1"
                     /db_xref="InterPro:IPR011576"
                     /translation="MATRSEVEMSDAEVDALLSRHETGVLALARDETPYAIPISYGFD
                     KESRTAFLRLVSTPDSEKREFLASDPQARIVVYEEGDKGGSEEYASVVGVGTLHRVDL
                     DDLTPETIAQYGKTQRPLFEIWADGKEDLDIELYRFEPKRLTGRTVVVDRDEA"
     gene            complement(345218..346288)
                     /locus_tag="Hlac_0323"
     CDS             complement(345218..346288)
                     /locus_tag="Hlac_0323"
                     /EC_number="1.8.1.9"
                     /inference="protein motif:PFAM:PF00070"
                     /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
                     oxidoreductase;
                     KEGG: hma:rrnAC1129 thioredoxin reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-dependent pyridine nucleotide-disulphide
                     oxidoreductase"
                     /protein_id="ACM55927.1"
                     /db_xref="InterPro:IPR000103"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR008255"
                     /db_xref="InterPro:IPR013027"
                     /translation="MTDDVVEHRRLIIAGTGIAGLTAAIYAARSNNDPLLVEGDEPGG
                     QLTLTTDVENYPGFPEGISGPELINNMKAQATKFGAEARNGIIVDVSKEPAGHFRVEL
                     SDGDVYTADAFIAASGASARTLGVPGEDELMGYGLSTCATCDGAFFRDEDMLVVGGGD
                     AAMEEANFLTKFADTVYIAHRREEFRAEDVWIERTMEKVEDGEIELLLNTELTEIHGT
                     PEDGIDHVTLVEHPDGHPTEKLDDPATADEVDEYDFDVGAVFFAIGHTPNTEFLEGTE
                     VETDDEGYLLTEGGRGGNQTATGVEGLFGAGDVVDFHYQQAVTAAGMGCQAALDADEY
                     LTERERAGELYEPTADAATADD"
     gene            complement(346431..347867)
                     /locus_tag="Hlac_0324"
     CDS             complement(346431..347867)
                     /locus_tag="Hlac_0324"
                     /inference="protein motif:PFAM:PF01368"
                     /note="PFAM: phosphoesterase RecJ domain protein; TrkA-N
                     domain protein; phosphoesterase DHHA1;
                     KEGG: hma:rrnAC1272 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoesterase RecJ domain protein"
                     /protein_id="ACM55928.1"
                     /db_xref="InterPro:IPR001667"
                     /db_xref="InterPro:IPR003148"
                     /db_xref="InterPro:IPR003156"
                     /translation="MARRLLLGCSAVGNTLVERTREARGELIAITDDTGWASTLRDRN
                     VATVEADPTDPATYPESAAVVLVASDDPARNVAAAEAARRHYPDAMIVAHVGTNPTAA
                     QQEALEAVADRVVDPVEAVVSRVCEATGVDADEEPVRLLRVLRSLTGPLLVVAHDNPD
                     PDAIASALGLARIAESVGIPADACYGGEIAHQENRAMVNLLDLSLRTFDGIDLDDYGG
                     VALVDHSRAGINDSLPEGHPVDIVVDHHPPRGPVAGEFVDIRPDVGATSTLIEEYLSR
                     VGIEPDRDLATALLYGIRIDTKDFTRATSIPDFEAAASLSPHADESTLERVESPSVSP
                     ETLRVLARAIEGRDVRGSTVASCVGEIGDRDALSQAAERLLDLDGIAVTFVFGYMDGV
                     IYGSARARGADLDVGELLRDALDPVGSAGGHATMAGAQVPLGILQEVSESESLEDVVE
                     AFVAGRFFEALDDAPSPPTGPLPEFSRE"
     gene            complement(347904..350540)
                     /locus_tag="Hlac_0325"
     CDS             complement(347904..350540)
                     /locus_tag="Hlac_0325"
                     /inference="protein motif:TFAM:TIGR01496"
                     /note="TIGRFAM: FolC bifunctional protein; dihydropteroate
                     synthase;
                     PFAM: dihydropteroate synthase DHPS; cytoplasmic
                     peptidoglycan synthetase domain protein; Mur ligase middle
                     domain protein;
                     KEGG: hma:rrnAC0184 dihydropteroate synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydropteroate synthase"
                     /protein_id="ACM55929.1"
                     /db_xref="InterPro:IPR000489"
                     /db_xref="InterPro:IPR001645"
                     /db_xref="InterPro:IPR004101"
                     /db_xref="InterPro:IPR006390"
                     /db_xref="InterPro:IPR013221"
                     /translation="MHYHEAAAFLFDLRRFSVKPGTERVAALLDQVGNPEEDVSFVQV
                     AGSNGKGSTARMTESILREAGLSVGLYTSPHLSALADRVRVDGLAMTEAAIADFVEEV
                     KPWLVERAANGEPLTFFEVVTAMAIHDFARREVDVAVLEVGLGGEYDATSAVDPVATA
                     VTNVSLEHTAVLGDTIAEIARTKARIADAGVPLVTACEGEALSVVREVANDAGAPIAT
                     VARASGSSGNGETDDQTLSVAYEGRVSPTDAEVTLAGEVDGTYRIPLVGDHQATNAGI
                     AVALARRTAGALGNGTDASLPDEAVRDGLARATWPGRFEVVDTAPLTVLDGAHNPAAC
                     RTLAGTLAEYDYDDLHLVYGAMHDKDHVGAASALPDADSAVTCRPDLDRAEDPEVLAA
                     ALRTAGVDDVTAGDDVAAALETAVERADLGDCVLLVGSLFAVAEARAARMRTVTPRTV
                     SGSDPDANAARALDIGGVPTGDESGASRRRREGIDHRVLSLRLRGDRAERLTAALREA
                     GGDAAIGGLGAGEGRVPGGEYVPVTLAGTVGEYRELLGRLREREGEEFAGIAGDIADR
                     VGIDDSDAADSAPDDYPWIDGTAIMGVLNVTPDSFHDGGRHAGPDDAVAGVERMVEAG
                     VDVVDVGGESTRPGAEPVPVDEEIDRVVPTLEAIQSVPAVADSNVLISVDTRKPAVAA
                     AALDAGADIINDVTGLADPEMREVVADAGCPVVVMHSLDAPVDPTNDPEYDDVVDDVI
                     AALRERLALAETAGIDREKVIVDPGLGFGKSATEAFDLIDRVGEFAALDCPVLIGHSH
                     KSMYGAVGRGEDDREHATVAATALAADRGADIVRAHDIAENRAAVDVAAAVNGSLRER
                     GGADENGDGDPEGGAKGNAAGE"
     gene            350681..351760
                     /locus_tag="Hlac_0326"
     CDS             350681..351760
                     /locus_tag="Hlac_0326"
                     /inference="protein motif:PFAM:PF00005"
                     /note="PFAM: ABC transporter related;
                     SMART: AAA ATPase;
                     KEGG: hma:rrnAC0048 ABC transporter ATP-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter related"
                     /protein_id="ACM55930.1"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /translation="MNETTAADVDAADDATRGRDAAGADAADPDAVVVGEGVRKSYGD
                     VVALDGVDIRVESGEVFGLIGPNGAGKTTLVRALTGTTEAEGDLRVFGVPPREVDPQR
                     IGLLPQSFDPPERLTATELVGYYGGLYDAARDAESVLRDVGMADDADVWYETLSGGQK
                     RRTCVATAIVNDPDLLFLDEPTTGIDPAGRRSIHRLIERLAGGGTTVFLTSHAMDEVE
                     RLADRVALLRDGKIVAVGAPEELIADHGGEPRLEVKLDGPASEADCEAVQEAIREALS
                     DESAGESEDAPAVESTRKGLRIGGVRPEGIGDAVDALETAEIDFESLAWSEPSLEDVY
                     LRLTGEEYSPRSEPLDEVAPDGGDR"
     gene            351757..352512
                     /locus_tag="Hlac_0327"
     CDS             351757..352512
                     /locus_tag="Hlac_0327"
                     /inference="protein motif:PFAM:PF01061"
                     /note="PFAM: ABC-2 type transporter;
                     KEGG: nph:NP2440A ABC-type transport system permease
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC-2 type transporter"
                     /protein_id="ACM55931.1"
                     /db_xref="InterPro:IPR000412"
                     /db_xref="InterPro:IPR013525"
                     /translation="MSRFGRITTEATAAARSFLRRRTAVFFTFFFPVILVVIFGALVQ
                     TQPTGGGLFAEPAGYYIPGYLAVVVLFTPLSRVGSEIARHRDGGRFEKLATTPLSRVE
                     WLLAHTLVNVAIIGAASLLILGLVLAVTDAEPVVSPALAALPVFVAVAVALFCGLGAL
                     LGALADSQDGVIAASNTVALPLLFLSETFVSPDLLPEWFLPAVAASPLTYFARGTRAI
                     IYEPGAWLGDLAVLSVLAVAFLALGAYAIPRTD"
     gene            352639..352776
                     /locus_tag="Hlac_0328"
     CDS             352639..352776
                     /locus_tag="Hlac_0328"
                     /inference="similar to AA sequence:KEGG:NP1556A"
                     /note="KEGG: nph:NP1556A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55932.1"
                     /translation="MPTVQFTCSDCAQTIEVNDEMRETILATGCPVCTTAASEGDFGD
                     E"
     gene            352933..353451
                     /locus_tag="Hlac_0329"
     CDS             352933..353451
                     /locus_tag="Hlac_0329"
                     /inference="protein motif:TFAM:TIGR00040"
                     /note="TIGRFAM: phosphodiesterase, MJ0936 family;
                     PFAM: metallophosphoesterase;
                     KEGG: hwa:HQ3640A
                     phosphoesterase,metallo-phosphoesterase-calcineu rin-like"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphodiesterase, MJ0936 family"
                     /protein_id="ACM55933.1"
                     /db_xref="InterPro:IPR000979"
                     /db_xref="InterPro:IPR004843"
                     /translation="MLVVVSDTHSREESKLQGRTAEAVREADVVVHAGDFYREPVLNA
                     FESATRSLRAVYGNNDDAGIRDRVPEVRTVEYAGVRFAVTHRHRNGDTGLVMLARERD
                     ADAVICGHSHRPRFDDDGALPILNPGSHAQPRGNRPAHAELEPASEGESTLNGRLVTP
                     DGQIFGEFQIAP"
     gene            353862..353990
                     /locus_tag="Hlac_0330"
     CDS             353862..353990
                     /locus_tag="Hlac_0330"
                     /inference="similar to AA sequence:KEGG:HQ3703A"
                     /note="KEGG: hwa:HQ3703A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55934.1"
                     /translation="MLPVEPLFVVILAILLGFFFFAFLLVRRTLTGLREGYDDGQR"
     gene            353992..355167
                     /locus_tag="Hlac_0331"
     CDS             353992..355167
                     /locus_tag="Hlac_0331"
                     /inference="protein motif:PFAM:PF01384"
                     /note="PFAM: phosphate transporter;
                     KEGG: nph:NP1412A phosphate/sulfate permease"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate transporter"
                     /protein_id="ACM55935.1"
                     /db_xref="InterPro:IPR001204"
                     /translation="MVVVTVATLGVAAAASLFMAWSIGAGSSGSTPFSPAVGANAISV
                     MRAGLVVGVLGLMGAILQGANVTEAVGTELIGGVTLTAGAAIVALLTAAALVAIGVFA
                     GYPIATAFTVTGAVVGVGLAMGGDPAWPKYTEILTLWILTPFVGGGVAYGVARMLIGE
                     RLPERALTAALAGLVGAIVANVGFALLGPAGQQASLSEAFGSGLGIGAIGTPLVTVAV
                     AAVVALAVYADLGRDREGAQRRFLLAMGGLVAFSAGGSQVGLAIGPLVPIFSDVGVPL
                     WALLVGGGVGLLVGSWTGAPRMIKAISQDYASMGPRRSISALIPSFAIAQIAVAFGIP
                     VSFNEIIVSAIVGAGYAAGDAGVSRSKMGYTVFAWIASLVGSLALGFGVYSAVQFVL"
     sig_peptide     353992..354108
                     /locus_tag="Hlac_0331"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.994) with cleavage site probability 0.369 at
                     residue 39"
     gene            complement(355679..356839)
                     /locus_tag="Hlac_0332"
     CDS             complement(355679..356839)
                     /locus_tag="Hlac_0332"
                     /inference="protein motif:TFAM:TIGR03317"
                     /note="TIGRFAM: folate-binding protein YgfZ;
                     PFAM: glycine cleavage T protein (aminomethyl
                     transferase); Glycine cleavage T-protein barrel;
                     KEGG: nph:NP0436A aminomethyltransferase, glycin cleavage
                     system T protein"
                     /codon_start=1
                     /transl_table=11
                     /product="folate-binding protein YgfZ"
                     /protein_id="ACM55936.1"
                     /db_xref="InterPro:IPR006222"
                     /db_xref="InterPro:IPR013977"
                     /db_xref="InterPro:IPR017703"
                     /translation="MTLVSDTHGAHGAVYRDRGGRRVVDHYRKPERVGKAVRNVVGAI
                     EMGYGVLAITGEDRVEFIDNAVSNRIPEADGQGVYALLLDPQGGIETDMYVYNADERL
                     LVFLPPERTEAVAEDWASKVFIQDVTIDDISDELGVFGVHGPKSTEKVASVLGGPGAP
                     EKPLSFVRGSMVDAGVTVIASDAPLGEEGYEVVCAAEDAEEVLDTLLNRGLNAAPFGY
                     RTWDALSLEAGTPLFEYELEGTVPNVLGLRNALDFEKGCYVGQEVVSRVENQGRPSRR
                     LIGLDLDGLADATADIDGDADPEGYDEILPSPGAAVFDGDEAVGEVTRAAVGPAAGDP
                     IALAFARFDADLVDPTVRVDGEEVAATRSDLPFPSVDGSAQSARLPTYPSDE"
     gene            complement(356931..357230)
                     /locus_tag="Hlac_0333"
     CDS             complement(356931..357230)
                     /locus_tag="Hlac_0333"
                     /inference="similar to AA sequence:KEGG:HQ3111A"
                     /note="KEGG: hwa:HQ3111A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55937.1"
                     /translation="MAAKPEYRDRPDVEVALLDALVDRGDEGMTVLELRAAVDANIDA
                     VEEALSALKADSLITVESEERVRVYPHDRVVPDPEDQIEDGSDTLVDAVRDRLGL"
     gene            complement(357302..357850)
                     /locus_tag="Hlac_0334"
     CDS             complement(357302..357850)
                     /locus_tag="Hlac_0334"
                     /inference="protein motif:PFAM:PF07998"
                     /note="PFAM: peptidase zinc-dependent;
                     KEGG: nph:NP0774A archaemetzincin-like protein"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase zinc-dependent"
                     /protein_id="ACM55938.1"
                     /db_xref="InterPro:IPR012962"
                     /translation="MIAAVKSCSMLVDIVPVGEVTPRVKREASAALRSVYDCDVTVHD
                     DQPIPGTAYDEGRDQYRAEDLIETVGRVGGGEKNIGITPRDLYYRRRNYVFGLAYLNG
                     NGSVISTHRLRTSSDGGVSTKPAVDVFADRVRKEVVHEIGHTLGLEHCDNSKCVMSFS
                     PTVREVDVKEENLCGTCSRLVR"
     gene            358436..359299
                     /locus_tag="Hlac_0335"
     CDS             358436..359299
                     /locus_tag="Hlac_0335"
                     /inference="protein motif:TFAM:TIGR01548"
                     /note="TIGRFAM: HAD superfamily (subfamily IA) hydrolase,
                     TIGR01548; HAD-superfamily hydrolase, subfamily IA,
                     variant 1;
                     PFAM: Haloacid dehalogenase domain protein hydrolase;
                     KEGG: hma:rrnAC2106 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="HAD superfamily (subfamily IA) hydrolase,
                     TIGR01548"
                     /protein_id="ACM55939.1"
                     /db_xref="InterPro:IPR005834"
                     /db_xref="InterPro:IPR006438"
                     /db_xref="InterPro:IPR006439"
                     /translation="MQVDAVVLDIDGVLVDVADSYRRAIIESVERVCDKTIDRDAIQL
                     FKDAGGFNNDWELTDAAALYVLARREGLGMDVETFTGRIAEGGGGLDAAKEVVGDLPR
                     VAQARVRDQWDTERLRETFQALYLGEELYRELEGGAPPLSAPGYIHDEPTLVEPETIA
                     DLTDRFDVGVLTGRPAAEAEIALERVGLDVPEDRRFTMDDWEEGKPHPRALVTLAERF
                     DADRIAFIGDTLDDVRTARNADDEDASRVYYGIGVLTGGLTGDEGRRKFAENGADAVV
                     EDVNELVELLE"
     gene            complement(359304..359378)
                     /locus_tag="Hlac_R0011"
                     /note="tRNA-Met3"
     tRNA            complement(359304..359378)
                     /locus_tag="Hlac_R0011"
                     /product="tRNA-Met"
     gene            complement(359517..359589)
                     /locus_tag="Hlac_R0012"
                     /note="tRNA-Asn1"
     tRNA            complement(359517..359589)
                     /locus_tag="Hlac_R0012"
                     /product="tRNA-Asn"
     gene            359762..361150
                     /locus_tag="Hlac_0336"
     CDS             359762..361150
                     /locus_tag="Hlac_0336"
                     /EC_number="2.7.7.72"
                     /inference="protein motif:PFAM:PF09249"
                     /note="PFAM: DNA polymerase beta domain protein region;
                     tRNA nucleotidyltransferase, substrate binding domain
                     protein;
                     KEGG: hsl:OE1222R tRNA adenylyltransferase, CCA-adding"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA nucleotidyltransferase, substrate binding
                     domain protein"
                     /protein_id="ACM55940.1"
                     /db_xref="InterPro:IPR002934"
                     /db_xref="InterPro:IPR015329"
                     /translation="MDDLEAVLSRVRDRAVPEPAERDRLRTVAVELADRTREAIADLP
                     VDADVVQVGSTARDTWVSGDRDIDLFVRFDAALDREQLEEYGLAVGHAVLPDGHEEYA
                     EHPYVKGTYEGFDVDLVPCHDVETAGDLISAVDRTPFHDAYLSARLDEGLADDVVLAK
                     AFLKGIGAYGSDLRTEGFSGYLTELLVLELGGFVPLVESARSWHPPVEFDPEGHAERT
                     FDDPLVVVDPTDPTRNVAAVLSAENLARFQHYARELLAAPSEAPFEPVDPAPLDPTDV
                     RDHLDRRETTPVAVVFDAPDLVDDQLWPQLRRSLDGIVRGLNDRGFDVLRARAMTDGS
                     GPEADGDGAKRAALYAELEVAERPAVTRHEGPPVAVRKHAASFYESYADDVDPETYGP
                     FIDGDRYVVEREREFTTVREYLESDAAGDVALGAQVEREFAERDVLVGDAVATLAPAF
                     GVPLREFYEPHP"
     gene            complement(361260..361604)
                     /locus_tag="Hlac_0337"
     CDS             complement(361260..361604)
                     /locus_tag="Hlac_0337"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACM55941.1"
                     /translation="MTDDAEDRVDVGDQIDADGSAVDASPGDTPPDGPNNPDVPVDFG
                     DLSLPQRAFVAAVQNPTRGVVIVGLLAFAFSFYVAFWLVFPQVAAFMSVIGAVLLGIV
                     ALVYLVSDRLSR"
     gene            complement(361657..362013)
                     /locus_tag="Hlac_0338"
     CDS             complement(361657..362013)
                     /locus_tag="Hlac_0338"
                     /inference="protein motif:PFAM:PF02537"
                     /note="PFAM: Camphor resistance CrcB protein;
                     KEGG: nph:NP0026A protein CrcB homolog 1"
                     /codon_start=1
                     /transl_table=11
                     /product="Camphor resistance CrcB protein"
                     /protein_id="ACM55942.1"
                     /db_xref="InterPro:IPR003691"
                     /translation="MTDPLLALVLVGLGGAGGAVARHVVGLRIEGRGSVLAVNTLGSL
                     TLGALLAAPIGSEATFLAVVGFCGAFTTFSSFAVETVSTAADGEGRTAAGFAAANLAA
                     GVLAFLVGAAVGGVFG"
     sig_peptide     complement(361948..362013)
                     /locus_tag="Hlac_0338"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.961) with cleavage site probability 0.901 at
                     residue 22"
     gene            complement(362010..362357)
                     /locus_tag="Hlac_0339"
     CDS             complement(362010..362357)
                     /locus_tag="Hlac_0339"
                     /inference="protein motif:PFAM:PF02537"
                     /note="PFAM: Camphor resistance CrcB protein;
                     KEGG: nph:NP0024A protein CrcB homolog 2"
                     /codon_start=1
                     /transl_table=11
                     /product="Camphor resistance CrcB protein"
                     /protein_id="ACM55943.1"
                     /db_xref="InterPro:IPR003691"
                     /translation="MERTPLGFFLVALGGFVGAVARHGIDIAVGDATGAATLLVNVLG
                     SFALGVLVTRAARHRTRLFVGTGMLSSFTTYSTFVGNAVTLGTTAGAAYVAVSYAAGF
                     AAAAAGLFVGGRV"
     sig_peptide     complement(362292..362357)
                     /locus_tag="Hlac_0339"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.799) with cleavage site probability 0.354 at
                     residue 22"
     gene            complement(362377..363516)
                     /locus_tag="Hlac_0340"
     CDS             complement(362377..363516)
                     /locus_tag="Hlac_0340"
                     /inference="protein motif:PFAM:PF01935"
                     /note="PFAM: protein of unknown function DUF87;
                     KEGG: hma:rrnAC2254 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF87"
                     /protein_id="ACM55944.1"
                     /db_xref="InterPro:IPR002789"
                     /translation="MYVLGRDTGSDDGTGSAGTNGEIGDERLPTVQLGSFLARDGSAG
                     AAVGIDADSPHAGVVFGKRGTGKSYTLGVLAEGLAAASGVAPVVVDPMGVFDGLRATG
                     GQVVEPRVRPAAIPPEAWPDLLGLDPASGPGSLVWRVVADALKSPEAGGSGESDESPS
                     LATLRDRVDAADAPAADRRAAANHLRLAESWGVFDADAPPTVRLVGGGEPTVLDLAGV
                     PEAAAAAVVRAVARGLYDARIDGDLDRLPWLLVDEAHAFFGGVADPALRTLLTRGRAP
                     GVSLVCATQRPGALPSVAVSQSDLLVAHRLTAERDLDRLAEAEATYLAGDLASRLPTE
                     TGEALVVDDATETAHTVRIRERRTPHGGGSPSASGTAAAKSEDPR"
     gene            363652..364128
                     /locus_tag="Hlac_0341"
     CDS             363652..364128
                     /locus_tag="Hlac_0341"
                     /inference="similar to AA sequence:KEGG:NP0022A"
                     /note="KEGG: nph:NP0022A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55945.1"
                     /translation="MPHSKRDERTANDRSFCSDRRAIEGLPVRLVIALVVGVASLSVM
                     MGMIGDIDGLAATELDAQPQPEVTTPGEQSLDVAVLDPDGSRVADATVIVRSGSAQID
                     GVATGTTGSDGTATVDVDPELGPNQPDGTLTVEVKPPAEGDYVDERRNTEVLVVAE"
     gene            complement(364129..364926)
                     /locus_tag="Hlac_0342"
     CDS             complement(364129..364926)
                     /locus_tag="Hlac_0342"
                     /inference="protein motif:PFAM:PF01135"
                     /note="PFAM: protein-L-isoaspartate(D-aspartate)
                     O-methyltransferase;
                     KEGG: nph:NP0020A protein-L-isoaspartate
                     O-methyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="protein-L-isoaspartate(D-aspartate)
                     O-methyltransferase"
                     /protein_id="ACM55946.1"
                     /db_xref="InterPro:IPR000682"
                     /translation="MDEASLRADMIEGLEHQIGETLDEPVLTALQRVSRDPFVDDGAT
                     AAGGETGRGGGSGGNGDRSLTLATVVRLISALDADAGDEVLVVGAGVGYSVALLAEIA
                     GARHIHAIDIDREAVAIARSNLSTAGYDAVLVDRRDGVNGLPEYAPYDRILLEASVVK
                     PPRALREQLAEGGRIVYPRGTAVQTIAAIEPDSGGDSADDGDDAPTGFRTTETAGPTR
                     LQPMLVDGEQRGVERNRTRREDAERAEQGHFARHGWEQDWIDWDDRI"
     gene            complement(364997..365629)
                     /locus_tag="Hlac_0343"
     CDS             complement(364997..365629)
                     /locus_tag="Hlac_0343"
                     /EC_number="2.1.1.77"
                     /inference="protein motif:TFAM:TIGR00080"
                     /note="TIGRFAM: protein-L-isoaspartate
                     O-methyltransferase;
                     PFAM: protein-L-isoaspartate(D-aspartate)
                     O-methyltransferase;
                     KEGG: nph:NP0018A protein-L-isoaspartate
                     O-methyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="protein-L-isoaspartate O-methyltransferase"
                     /protein_id="ACM55947.1"
                     /db_xref="InterPro:IPR000682"
                     /translation="MDDADHAAARRELVDGLRRRSDIDERTLAAIESVPRHAFVPERH
                     RSRAYADRPLPIGHDQTVSAPHMVALMTDLLDIEPGDRVFEVGTGCGYHAAVVAEIVG
                     PGNVYSVEYVPELAESARKRLRQLGYDVTVWAGDGQIAFRDEAPFDVAYLTCAPADGV
                     PDSIVDRVQTGGRVVAPVGRVGAQRLVRLTVKEEGVEREDHGGVRFVPMR"
     gene            complement(365714..366139)
                     /locus_tag="Hlac_0344"
     CDS             complement(365714..366139)
                     /locus_tag="Hlac_0344"
                     /inference="protein motif:PFAM:PF00011"
                     /note="PFAM: heat shock protein Hsp20;
                     KEGG: hma:rrnAC2949 small heat shock protein"
                     /codon_start=1
                     /transl_table=11
                     /product="heat shock protein Hsp20"
                     /protein_id="ACM55948.1"
                     /db_xref="InterPro:IPR002068"
                     /translation="MVIIMNRNSPFDEIEQFLGRAPFGGDRTWGRDLRATDIDVAEYD
                     DEFVVMADLPGYDREDIDVRATEGRLTITAEHDAASEDADRRYLRRERRHESVTRSVD
                     LPGPVVDEDASATYRHGVLTITLPKAADETDDGHRIDVA"
     gene            complement(366252..366806)
                     /locus_tag="Hlac_0345"
     CDS             complement(366252..366806)
                     /locus_tag="Hlac_0345"
                     /inference="protein motif:PFAM:PF00011"
                     /note="PFAM: heat shock protein Hsp20;
                     KEGG: nph:NP1078A HSP20-type chaperone"
                     /codon_start=1
                     /transl_table=11
                     /product="heat shock protein Hsp20"
                     /protein_id="ACM55949.1"
                     /db_xref="InterPro:IPR002068"
                     /translation="MTRRDRFTEIEDLIERMGREFEELGGTLDAPGPGVPGFPDTREI
                     AVDVIEDDETITVLADLPGFDADGIEVELHDETLSITATHDETRDTEVTVDEDDATAD
                     DAVEGDAAEGADTGGDDSSEAGGGDDVRYHRRERRRRAVSRRIPIPEPVDRDGATASY
                     DDGVLTVTLPKRSSDDAGHNIDVS"
     gene            complement(366926..368512)
                     /locus_tag="Hlac_0346"
     CDS             complement(366926..368512)
                     /locus_tag="Hlac_0346"
                     /inference="protein motif:PFAM:PF01944"
                     /note="PFAM: protein of unknown function DUF95
                     transmembrane;
                     KEGG: nph:NP2108A flagella cluster protein"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF95 transmembrane"
                     /protein_id="ACM55950.1"
                     /db_xref="InterPro:IPR002798"
                     /translation="MRCFDTRRVNARIARVFKYGTAEPVRMDLSSAVSAAASTLRRRP
                     ADLLPFYLLGTAVPVIARMGLFVALAGTYLHYELTGQLDDARRALTELDLTPPDTQDP
                     EAVQAWVETVAPALEPLASPTAVLLLTVVTAATLLLALLTYAAVSAGQMSAVAGRVRG
                     RRGLTAGIAGVRGRWLTFLGLYVTEVLLWVGVSLLGGLAIGGAFLVNPFLGAAVALVA
                     LLVGLTVLLLVRAVFAFAPAAVVVDETGVVGAVEGAGGFIRSNPVDALAYVVVAVGVL
                     VAISSAASALAFLGGGAVVALASAVVAAPALDLLKTVLYGDHRDAVAPVEPVDARLRD
                     QFVGGIRRGWREMTGFVRRTPGLHAIAILVGVGFGVIGWLAVDPLVGAVTTSIESRLI
                     GHLPPTAALNFFGNNWSVAIATSFGGVAFVIPALSSIAFNGLALGATAALEENLVALL
                     AFVAPHGILEIPALFISGALGIHLGIVSWRAFRGRLSREAFADALENAFWVLMGVGVL
                     IAVAACIEGFVSPYYWQPFL"
     gene            complement(368485..368640)
                     /locus_tag="Hlac_0347"
     CDS             complement(368485..368640)
                     /locus_tag="Hlac_0347"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACM55951.1"
                     /translation="MGTYVGVSLAYAWMALVVTVGFRYSGWADRAAEMMAERGAGDEC
                     DASTPDE"
     gene            368901..369395
                     /locus_tag="Hlac_0348"
     CDS             368901..369395
                     /locus_tag="Hlac_0348"
                     /inference="protein motif:PFAM:PF06094"
                     /note="PFAM: AIG2 family protein;
                     KEGG: LOC714771; hypothetical protein LOC714771"
                     /codon_start=1
                     /transl_table=11
                     /product="AIG2 family protein"
                     /protein_id="ACM55952.1"
                     /db_xref="InterPro:IPR009288"
                     /translation="MDVFVYGTLTEPERVAEVLDSYVYVGPATLFGLHLVEGRYPTLA
                     PGGETGGRLLRTEELDALDEYERVETGLYRQVTIPLDAPGGHPDEAAVYVGDPDRLGA
                     DAVWSEEGIGGEGNDGDRNDGDRNDGDRNDGDSDERDDGDPGFAERVDQYLEQEAVRV
                     RLTI"
     gene            369667..370878
                     /locus_tag="Hlac_0349"
     CDS             369667..370878
                     /locus_tag="Hlac_0349"
                     /inference="protein motif:TFAM:TIGR01127"
                     /note="TIGRFAM: threonine dehydratase;
                     PFAM: Pyridoxal-5'-phosphate-dependent protein beta
                     subunit; amino acid-binding ACT domain protein;
                     KEGG: nph:NP1076A threonine dehydratase"
                     /codon_start=1
                     /transl_table=11
                     /product="threonine dehydratase"
                     /protein_id="ACM55953.1"
                     /db_xref="InterPro:IPR000634"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="InterPro:IPR002912"
                     /db_xref="InterPro:IPR005789"
                     /translation="MISLSDVREARERVGDVARHTPLERSRTFSEMSGADVHLKLENF
                     QRTGAFKIRGAMNRIATLSESEREAGVVTASAGNHAQGVALAADRAGVDATVVMPRFA
                     PVSKVKATRGYGASVRLEGVDYDEAQAYAHELERKESRTYVHAFDDPVVMAGQGTIGL
                     EIVDDCPDLDTVVVPIGGGGLISGVAVAIKEQLPDVRVVGVQAEGAASAGESLKRGEV
                     YEIDSVDTIADGIATRSIGEQTLEVMSEYVDEVVTVDDREIALALTLLLERSKTLVEG
                     AGAVALAAVLSEAFEYENDETIVAALCGGNIDLNRLGTVIRRGLVQMGRYLKITIDLK
                     DRPGELERVSSIVARTGANVYAVHHDRTSRDVAVNAAELELELETDDAEHAADIVDAL
                     EADGYVVEVLS"
     gene            complement(370895..371437)
                     /locus_tag="Hlac_0350"
     CDS             complement(370895..371437)
                     /locus_tag="Hlac_0350"
                     /inference="protein motif:PFAM:PF01864"
                     /note="PFAM: protein of unknown function DUF46;
                     KEGG: hma:rrnAC3084 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF46"
                     /protein_id="ACM55954.1"
                     /db_xref="InterPro:IPR002726"
                     /translation="MIGSLVATAFWAMLPAYVPNNAAVLAGGGRPIDGGRDWRGARLL
                     GDGKTWRGTAVGTLTGVVLALALNRIAEPASAALGVDLPTFALPAAFALAFGAMCGDI
                     GASFLKRRSGRERGAAFPGLDQLDFVVVALAAVFVVDTDWALAVFTPSVLVVVLVMTP
                     ILHVVTNVGAYALGLKNEPW"
     sig_peptide     complement(371369..371437)
                     /locus_tag="Hlac_0350"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.606) with cleavage site probability 0.526 at
                     residue 23"
     gene            371563..372402
                     /locus_tag="Hlac_0351"
     CDS             371563..372402
                     /locus_tag="Hlac_0351"
                     /inference="protein motif:PFAM:PF01619"
                     /note="PFAM: Proline dehydrogenase;
                     KEGG: hsl:OE3955F proline dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="Proline dehydrogenase"
                     /protein_id="ACM55955.1"
                     /db_xref="InterPro:IPR002872"
                     /translation="MIPPIARRFVAGESAPEAIEHARARNEDGVAVILNLLGEHYDDP
                     ADARADTDAYLALLTDIADSGLDASISVKPSQIGLDVSDECFEGHYREIVARAHELDA
                     FVWCDMEDADTTDATLDAFESIAEEYPWSVGQCIQSNLKRTREDLDRLSDVPGKIRLV
                     KGAYDEPEAIAHKEQSRVDEAYREDLRFLFERRDRGIAVGSHDPAMISLADRLAREHG
                     ADYEVQMLMGVREDAQRDLAAQGVDVAQYAPYGTKWLSYFYRRVRERRQNLGFAVRAV
                     LGR"
     gene            372507..373217
                     /locus_tag="Hlac_0352"
     CDS             372507..373217
                     /locus_tag="Hlac_0352"
                     /inference="protein motif:PFAM:PF04367"
                     /note="PFAM: protein of unknown function DUF502;
                     KEGG: nph:NP0986A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF502"
                     /protein_id="ACM55956.1"
                     /db_xref="InterPro:IPR007462"
                     /translation="MSTWKRDFASGLIVLAPLLVLLLVLQWIYQYIASIPLIEGLQPA
                     IIPAPLEPISRVIIAMAVFATVVLAVGYFMRTTFGRLAESAVDGAINRIPALRVVYNA
                     SKLAIETAVSGTDELQSPVYIETWPGIRMTAFRTGKKTRDGKIVLFMPTAPNITTGFV
                     IEVEPERIEETGETVEEGMTRVLSAGFAESAHQVPVEEERPPEGTTGQPGGVGGVRTD
                     GTPGESDRPSTDGGGEGD"
     gene            complement(373250..374164)
                     /locus_tag="Hlac_0353"
     CDS             complement(373250..374164)
                     /locus_tag="Hlac_0353"
                     /inference="protein motif:TFAM:TIGR01122"
                     /note="TIGRFAM: branched-chain amino acid
                     aminotransferase;
                     PFAM: aminotransferase class IV;
                     KEGG: hwa:HQ3234A branched-chain amino acid
                     aminotransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid aminotransferase"
                     /protein_id="ACM55957.1"
                     /db_xref="InterPro:IPR001544"
                     /db_xref="InterPro:IPR005785"
                     /translation="MDVDTIWKNGEYLDWEDATTHVLTHALHYGSGVFEGVRCYDTEQ
                     GPAIFRWEEHLDRLFDSAKMYDMEIEYSREEITEATLELLDRQDLDSAYIRPLAYFGY
                     DSLGVSPKDCPTDLVLAAWPWGAYLGEEALEEGVDVMVSSWRKHASSQVPTNVKTTGL
                     YVNSMLAGEEARRNGYVEAIVLNKEGNVAEGPGENIFMVNDGEIYTTGPAQSILEGIT
                     RDTVIELAKERGYTVHDEAVISRGQLYTADELFFTGSAVEVTPIRSVDDTEIGSGTCG
                     PVTEELQSAFFDLVERRTDAHDDWFTYL"
     gene            complement(374364..375074)
                     /locus_tag="Hlac_0354"
     CDS             complement(374364..375074)
                     /locus_tag="Hlac_0354"
                     /inference="protein motif:TFAM:TIGR00506"
                     /note="TIGRFAM: 3,4-dihydroxy-2-butanone 4-phosphate
                     synthase;
                     PFAM: 34-dihydroxy-2-butanone 4-phosphate synthase;
                     KEGG: hma:rrnAC3073 3,4-dihydroxy-2-butanone 4-phosphate
                     synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
                     /protein_id="ACM55958.1"
                     /db_xref="InterPro:IPR000422"
                     /translation="MRADADTDVDAVPGSDADSVNRALDAFRAGDPVCVHDFADREGE
                     TDIIYPAGAVDEAAVAHMRNDAGGLICVAVADSVADAFGLPFLADALDHPAVNDDPEY
                     DDRSSFSLPVNHRETFTGITDEDRARTIVELAVSAAAVDADPAGYDPDDFAAEFRAPG
                     HVHVLRGAHDGLRGRTGHTELGLAMAEAVDAAPAAVVCEMLDDETGAALTPADAEAYA
                     RRRQIPYVEGAALVEAFK"
     gene            complement(375074..375865)
                     /locus_tag="Hlac_0355"
     CDS             complement(375074..375865)
                     /locus_tag="Hlac_0355"
                     /inference="protein motif:PFAM:PF01982"
                     /note="PFAM: protein of unknown function DUF120;
                     KEGG: hsl:OE3964R hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF120"
                     /protein_id="ACM55959.1"
                     /db_xref="InterPro:IPR002834"
                     /translation="MAEATSTADPDPAAIAALKHVGLAGGLTETKVSCAALGDRLDAS
                     TQTASRRLQTLESVGYIERDVVGDGQWVRVTDAGEAALRAEYADYRRLFETDVELVLR
                     GAVTGGMGEGRHYITLPGYAEQFRARLGYEPFPGTLNVDLSEESVRRRGEMAGIDAVP
                     IDAWEGEDRTYGAASCYGVTLVTGDERYEEVHAIVPDRTHHDDDQLELIAPERLRDAL
                     GLGDGDAVEVRVAATSRADTPESDYVEESDDENETPADPVETEVA"
     gene            376155..376226
                     /locus_tag="Hlac_R0013"
                     /note="tRNA-Ala2"
     tRNA            376155..376226
                     /locus_tag="Hlac_R0013"
                     /product="tRNA-Ala"
     gene            376688..376981
                     /locus_tag="Hlac_0356"
     CDS             376688..376981
                     /locus_tag="Hlac_0356"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACM55960.1"
                     /translation="MIRLDSIPVRDCLSCGAHVSTDFRQAHGGEREAQLRVWMGNLAG
                     ESWSDLVTRLKRYWTDAGCDPERLKEAVTHYRDDAGPKIRPARGAWGRGQTFR"
     gene            377290..377418
                     /locus_tag="Hlac_0357"
     CDS             377290..377418
                     /locus_tag="Hlac_0357"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACM55961.1"
                     /translation="MGISDLLEGKNLTHRQMGIIMIGWILLVTIVSVGLLLYTLST"
     gene            377639..378910
                     /locus_tag="Hlac_0358"
     CDS             377639..378910
                     /locus_tag="Hlac_0358"
                     /inference="protein motif:PFAM:PF07690"
                     /note="PFAM: major facilitator superfamily MFS_1;
                     KEGG: hma:rrnAC0944 putative sugar transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily MFS_1"
                     /protein_id="ACM55962.1"
                     /db_xref="InterPro:IPR007114"
                     /db_xref="InterPro:IPR011701"
                     /translation="MDSAEQRIVAFTAGSHGLVHTYELSIPILLTVWVGEFSTTAAVL
                     GLVVTVGYGLFGVGALPGGILVDRFGSKPLILACLGGMAGSFLLVSLAPNLLTLALAI
                     AVWGVTASVYHPAGLSLLSKSVDQRGTALGYHGIGGNLGIALGPLATALLLLAFDWRI
                     VTAALTVPAAVVAAYGLTVDIDDALPDTENAVSDGDIDGDGGSGANGAASLSTIADDT
                     RVLLAGGFLIVFVFVTFSGLYYRTFLTFLPDLLGDVLGGLIDIQLIDPESPYAEEFDV
                     ARYLYVAVLMVGVLGQYLGGRIADRVPPERALMVLMGILTVLALLFVPASETIVTFIA
                     VSLLLGVVLFTVQPLSQATVAAYSPSEARGISFGYTYLGIFGFGSLGAALAGTVLTRA
                     GPRELFFVLAGIAALGALSAAGVSRLATRQD"
     gene            complement(378983..380284)
                     /locus_tag="Hlac_0359"
     CDS             complement(378983..380284)
                     /locus_tag="Hlac_0359"
                     /EC_number="3.1.13.1"
                     /inference="protein motif:PFAM:PF00773"
                     /note="PFAM: ribonuclease II;
                     KEGG: nph:NP0874A ribonuclease R-like protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease II"
                     /protein_id="ACM55963.1"
                     /db_xref="InterPro:IPR001900"
                     /translation="MSDDEPKPGSAEDQGPVTITPELADRLAEKRTELFEEFEIRDEF
                     PNEVLREAETRTEDVYEEIEAEIDERKDLRDLTTWTTDPIDAQDFDDAISIEREEGAY
                     RLWVHIADVTHYVTPDTAMWEEAVKRANTVYLPDYTIHMLPPVLAETVCSLVPNEDRL
                     AHTVEMEIDDETLSFEDIDIYKSVINSDERLTYKECEERLEDPSLPLGEENELAYELA
                     DRMHEQRKEDGSLVLNPSRDRAHTIIEESMLKANKAVTHTLMWDRGVEAMYRVHPQPT
                     PDQWSKALREIQELDGVSIPGDAWGDDPRKAVNAALETAPDRQLNKIQRAVLKVMPRA
                     KYMNDPFGGHHALNFDIYGHFTSPIRRLSDTINHWIVHENDVPENILELCDHASDKQK
                     DGETAERLYKQFLQEQGLDPYAVNNRGVKVVEDPEEAKHTI"
     gene            complement(380372..381235)
                     /locus_tag="Hlac_0360"
     CDS             complement(380372..381235)
                     /locus_tag="Hlac_0360"
                     /inference="similar to AA sequence:KEGG:rrnAC1704"
                     /note="KEGG: hma:rrnAC1704 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55964.1"
                     /translation="MSLHSTLAAHPTPLRVTIDPLPTLIGVAALLVSLGFLARGGRGS
                     LDALRVARATATDPRSLQAGDRRVRVTGRAEIASGAHGRSDDDKEDAETLPAPFSDEQ
                     CLCCAYDVSEYRSQGKGRSWVSIDSGEAGVPFRVVVDGVGVRVDPAAADFAFGVDEDI
                     EIAADETPPERVRRFTDAVEAVDESEMGWTLGPLTIGDDPERRYRQRVLRPGDGVTVV
                     GDATAFPDAPVGEVKARIDGGSPFVVGDANARRTALRLVGRSAVPVVLGAVSLTVAAF
                     ALSPILGAVVG"
     gene            complement(381322..381630)
                     /locus_tag="Hlac_0361"
     CDS             complement(381322..381630)
                     /locus_tag="Hlac_0361"
                     /inference="similar to AA sequence:KEGG:HQ3179A"
                     /note="KEGG: hwa:HQ3179A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55965.1"
                     /translation="MWRSRKSRDRRTVICITCGDSVLREDAREYDKEGDRWNRRDKEF
                     EYLCTDCDNEICHQPRDGLESLITSIESDGLSREEFLDRYADAVDNADESRGRSERDR
                     "
     gene            381762..382241
                     /locus_tag="Hlac_0362"
     CDS             381762..382241
                     /locus_tag="Hlac_0362"
                     /inference="protein motif:PFAM:PF02080"
                     /note="PFAM: TrkA-C domain protein;
                     KEGG: hma:rrnAC3024 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="TrkA-C domain protein"
                     /protein_id="ACM55966.1"
                     /db_xref="InterPro:IPR006037"
                     /translation="MPITESDLPGVGKKFEINLDDGEMVVVIHNTGKREVFRRPNPDA
                     DSEKVFEFSDDLARTIGSIIEGAHFQPVEPATQETTLPGGILLEWYELHPGSPLIGET
                     LESADIGNRTGLAVVAIQRDDEVIDSPGAQTTLREGDTLIGVGTPENCEAFEEILTG"
     gene            382290..383534
                     /locus_tag="Hlac_0363"
     CDS             382290..383534
                     /locus_tag="Hlac_0363"
                     /inference="protein motif:PFAM:PF00999"
                     /note="PFAM: sodium/hydrogen exchanger;
                     KEGG: hma:rrnAC3025 sodium/protn antiporter putative"
                     /codon_start=1
                     /transl_table=11
                     /product="sodium/hydrogen exchanger"
                     /protein_id="ACM55967.1"
                     /db_xref="InterPro:IPR002114"
                     /db_xref="InterPro:IPR006153"
                     /translation="MAEALLELGVMFAAIAGVGALANRLGQSVIPFYIVAGMVLGEFV
                     LGRVALPVVGTTYIPESEFIAIGAELGIVFLLFFLGLEFNLDRLLARRRQIGTAGTID
                     LANFGAGFVLGWLVFGAFLPAFLIAGIVYISSSAVITKSLIDLGWIANDEAEPMLGTL
                     VYEDLFIAVYLAVASAIALGGGDVGAAAVDVGIAIGFILGLLGLVQFGTPAFARLVDT
                     TNREFIALRSIATVVLVAGGALALGVSEAVAAFFVGMAFASTDHTHEIETLLEPVRDT
                     FAAVFFFWIGLVTDPLLFGGVAALIALAVIVTTPTKLITGFLAGRAFDLNARRSTRVA
                     LGMTTRGEFSLIIATIAVTAGEAGAFDPALAATINAFAVGYVLVMAILGTTLMQYSEP
                     FESAVASWLDRSEPAGDGESSG"
     gene            complement(383690..386652)
                     /locus_tag="Hlac_0364"
                     /pseudo
     gene            384390..385724
                     /locus_tag="Hlac_0365"
     CDS             384390..385724
                     /locus_tag="Hlac_0365"
                     /inference="protein motif:TFAM:TIGR01766"
                     /note="TIGRFAM: transposase, IS605 OrfB family;
                     PFAM: transposase IS605 OrfB;
                     KEGG: hwa:HQ3077A IS1341-type transposase"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase, IS605 OrfB family"
                     /protein_id="ACM55968.1"
                     /db_xref="InterPro:IPR010095"
                     /translation="MLIQAFRMLEVHRTHQAKILNHSQGEESLDRHGWSASKLWNVAN
                     HHSRKVWKETGEIPGHGDLKDELKTHPKYNGLHSQSSQRVLEELAEAFNSWYGSDDDR
                     DNPPGYRKENYYDDQGRRVHEEHPRSTVTWKQNGIKHDTTNNRVRLSKGANHKEHPRA
                     WEYILVEYETRPGVTVENLQQVRAVYDSTKERWELHLVCKDEIETPNAPGNETAGVDL
                     GISNFAAVAYSTEDADLYPGNRLKQDGYYFPKEIAKCDDSGGDRATRLHHKWAERRTH
                     FFHSLAKHIVERCVEKEVGRINVGDLEGVREDENGSSKNWGKHGNLDLHGWAFDRFSS
                     ILEYKARVEGIEVLEVSERDTSKTCCTCGKTDDSQRVHRGLYVCDECDAAFNADVNGA
                     ENIRLDSNESNSESAPDLGGDRSTGWLAQPGVYLHDLSRGFQPRTEVVDCKP"
     gene            complement(386724..389444)
                     /locus_tag="Hlac_0366"
     CDS             complement(386724..389444)
                     /locus_tag="Hlac_0366"
                     /inference="protein motif:TFAM:TIGR00396"
                     /note="TIGRFAM: leucyl-tRNA synthetase;
                     KEGG: nph:NP0452A leucyl-tRNA synthetase"
                     /codon_start=1
                     /transl_table=11
                     /product="leucyl-tRNA synthetase"
                     /protein_id="ACM55969.1"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR002300"
                     /db_xref="InterPro:IPR002302"
                     /db_xref="InterPro:IPR013155"
                     /db_xref="InterPro:IPR015413"
                     /translation="MSQESYDHTAVEKRWQEAWDDASVYRTPDEVDDPTYVLGMYPYP
                     SGKLHMGHVRNYTITDAYARYRRMRGDDVLHPMGWDAFGLPAENAAKERDTNPRDWTF
                     DCIDTMKGQMQSMGFGYDWDREVTTCTPDYYQWNQWLFRRFHEAGLVERRDAEVNWCP
                     SCETVLADEQVEGDDELCWRCDTPVETRDLDQWFLEITEYADELLEAIDGLAGWPDSV
                     RQMQRNWIGRQHGTTLDFEVSEARSASNGRGEGTDPREYGPVEAFTTRVDTIHGATFF
                     ALAPDHPISEELAESDADVRHFIEEEADPEGDEPNGVATGLTATNPVTSEEIPVFVAD
                     FVLSDVGTGALMAVPGHDDRDHAFAEKMGVEIKPVIAPKPEDWDGETIPDAPDVSEGA
                     FTDDGVVIDSGEYSGLDSETARERLTEDIESAETTTQYRLRDWGISRQRYWGTPIPVV
                     HCDDCGSVLVPEADLPVELPEFINTTGNPLDAAEEWKETTCPECGEPATRETDTMDTF
                     VDSSWYFLRYVSPGAEDVPFDLDRANDWMPVDQYVGGIEHAVMHLLYSRFVTKVLADE
                     EGLAHREPFTNLLAQGMVQLEGEKMSKSKGNTVSPQRIVDEYGADTARLFIMQAAQPE
                     RDFDWAEEGVKSTHRFLARLTDLVEEYAAGEAETASSDADRDTIDDYVADEVDAAVAI
                     AGAEYDDLTFNVALREAQDLVGTLRSYRGHADPHPETYERGLDVAVRLLAPVVPHLAE
                     ELWETLDREGFVVEAEWPTATVDRETVERRRRLVANTREDVRDIVEVAGIEDPERIDV
                     VVAPDWKYDALSIAIDSDADNLISELMGEPHIREQGDDAASYGQDLQANREALQETLS
                     GDDEYDALRAASWLIEREFDAPVRVERAADADESVVRKAEPGRPAIDIVE"
     gene            complement(389572..391848)
                     /locus_tag="Hlac_0367"
     CDS             complement(389572..391848)
                     /locus_tag="Hlac_0367"
                     /inference="similar to AA sequence:KEGG:rrnAC3254"
                     /note="KEGG: hma:rrnAC3254 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55970.1"
                     /translation="MTDRASPGNDRSDIDDDRSDIDDDRSDIDDDRSDIDDDRPESGV
                     ARRTVLGALAGAGSAALAGCSGSEPDDAATDTLDPETLDELATRFAPTLFFDSAEPWF
                     PTDPRPYTVEEDDETVVDGFVAFDGYHERYDEAGEPPNPTVFYNGVQYEDSPLAVVQF
                     WLYSAFDQFTANFHWHDWEVLHVFVDLDTGDPQLYVASSHSRSVPNNEFLDPNPDAIP
                     RVLSELGSHSSTLSVNENPGQFQRVGEEGLLADITNTTIDTVEDLLGIPIAYGLPRDE
                     GMRLPFVVPEYEGEPLYDHPDLPSVSVESLVDGALTIRSLDALGSPPTDLPFRETGIA
                     FRHADREDELADRTADEVIGYDLVQSAELEDITAFTGPQLSYEFAVPEIVEDAVASHI
                     TTTGIPWKQPRYENPALDVTAGNHRAELAERYDAIAAEESFGDGATAELDAVVARVTR
                     AVESDDAPEGEGLTTTDAITESFVLIESDPEAVPTFGGGIAVANGIPEGDHRLTVNGA
                     GQAPHSEELAVSADEPLTTAGVDGEIPLVARENATKVELSDAESDIDMTRTAVEDDFA
                     GRIYDSAVDGSDAVYVHAGGAYTTEVRDADDEIGAYRIKPAPEAAGSGEPIRIDRPET
                     GAASLAGFVADVAEETRAEVAAVAAESGDDDSDDGSSGGGSDGSEGGPSNAIHGLERA
                     LAAAVDNAERAEERAREGDKEGTNRQLENVLERIARIQERLAAAREGLSPGLANATDR
                     RIEQATRRVKQAQESEKL"
     gene            392007..392408
                     /locus_tag="Hlac_0368"
     CDS             392007..392408
                     /locus_tag="Hlac_0368"
                     /inference="similar to AA sequence:KEGG:rrnAC3061"
                     /note="KEGG: hma:rrnAC3061 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55971.1"
                     /translation="MDGKRTLYYAAIAIAVLIALSVVGTIISLAIGVTVWMVTWAIRL
                     AVLAGLVYVAYKAGSWLLGDDNAPSIDSLERSRGSTSASAGDTSESRQDRLRRQYVEG
                     QISEAEFERRIASELETEEFDDIDRELERER"
     sig_peptide     392007..392099
                     /locus_tag="Hlac_0368"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.824) with cleavage site probability 0.389 at
                     residue 31"
     gene            complement(392423..392752)
                     /locus_tag="Hlac_0369"
     CDS             complement(392423..392752)
                     /locus_tag="Hlac_0369"
                     /inference="protein motif:TFAM:TIGR03188"
                     /note="TIGRFAM: phosphoribosyl-ATP diphosphatase;
                     PFAM: phosphoribosyl-ATP pyrophosphohydrolase;
                     KEGG: hma:rrnAC2371 phosphoribosyl-ATP pyrophosphatase"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosyl-ATP diphosphatase"
                     /protein_id="ACM55972.1"
                     /db_xref="InterPro:IPR008179"
                     /translation="MSDSDAENDENPEVPPDDVLDELFATIESRKAELPEGSYTASLF
                     THEKGENAVLEKIGEESTETILAAKDDDLDELTYESADLVYHLLVLFAMKDLDLDDLR
                     EELRDRF"
     gene            complement(392749..393342)
                     /locus_tag="Hlac_0370"
     CDS             complement(392749..393342)
                     /locus_tag="Hlac_0370"
                     /inference="protein motif:PFAM:PF01174"
                     /note="PFAM: SNO glutamine amidotransferase; CobB/CobQ
                     domain protein glutamine amidotransferase;
                     KEGG: hma:rrnAC2369 glutamine amidotransferase subunit
                     PdxT"
                     /codon_start=1
                     /transl_table=11
                     /product="SNO glutamine amidotransferase"
                     /protein_id="ACM55973.1"
                     /db_xref="InterPro:IPR002161"
                     /db_xref="InterPro:IPR011698"
                     /translation="MQAGVIAVQGDVAEHAAAVENAAAAHGEPAEVVEVRDAGIVPDC
                     DVLLMPGGESTTISRLIRREGIDEEIREHVASGKPVLATCAGLIVCSRDAKDDRVDAL
                     GLVNVSVDRNAFGRQKDSFEAKIPMTGLDEPFHAVFIRAPLIDDVGEGVEVLATVDGR
                     PVAVRDGPVVATAFHPELTDDSRIHDLAFFPEQEVVA"
     gene            complement(393456..393620)
                     /locus_tag="Hlac_0371"
     CDS             complement(393456..393620)
                     /locus_tag="Hlac_0371"
                     /inference="similar to AA sequence:KEGG:HQ1302A"
                     /note="KEGG: hwa:HQ1302A preprotein translocase subunit
                     SecG"
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecG"
                     /protein_id="ACM55974.1"
                     /translation="MSSGSNSGGLMSSAGLVRYFDSEDRDAIAIDPKTVLAFCVLFGV
                     FVQILSLTVA"
     gene            393781..394050
                     /locus_tag="Hlac_0372"
     CDS             393781..394050
                     /locus_tag="Hlac_0372"
                     /inference="protein motif:PFAM:PF00085"
                     /note="PFAM: Thioredoxin domain;
                     KEGG: hma:rrnAC2110 thioredoxin"
                     /codon_start=1
                     /transl_table=11
                     /product="Thioredoxin domain protein"
                     /protein_id="ACM55975.1"
                     /db_xref="InterPro:IPR006662"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="InterPro:IPR017937"
                     /translation="MTVRLLDFHADWCGPCKTQDPILEEIQEDLGDAFELQKVNVDEE
                     QDVANQYQVRSLPTLIIENDEGVVDRFVGVTQREDIEAALSEAGA"
     gene            394165..394314
                     /locus_tag="Hlac_0373"
     CDS             394165..394314
                     /locus_tag="Hlac_0373"
                     /inference="protein motif:PFAM:PF01020"
                     /note="PFAM: Ribosomal protein L40e;
                     KEGG: nph:NP0094A 50S ribosomal protein L40e"
                     /codon_start=1
                     /transl_table=11
                     /product="Ribosomal protein L40e"
                     /protein_id="ACM55976.1"
                     /db_xref="InterPro:IPR001975"
                     /translation="MASFDAAERRNLDRHICMRCNARNSPDADRCRKCGYTNLRPKAK
                     ERRAA"
     gene            394490..395503
                     /locus_tag="Hlac_0374"
     CDS             394490..395503
                     /locus_tag="Hlac_0374"
                     /inference="protein motif:PFAM:PF00248"
                     /note="PFAM: aldo/keto reductase;
                     KEGG: hsl:OE2451R putative oxidoreductase (aldo-keto
                     reductase family protein)"
                     /codon_start=1
                     /transl_table=11
                     /product="aldo/keto reductase"
                     /protein_id="ACM55977.1"
                     /db_xref="InterPro:IPR001395"
                     /translation="MDPTLDEIDLDTVRLGRTGLRTNEFQLGTWRFGRVTEAGNVEID
                     EARAHELLDGYEAAGGRYIDTADVYGGGDCERWIGDWLAERDRERYTIASKVYWQIRD
                     GDPNSRGTNRKNVRHRVDALLDRLDTDYLDVLYIHRWDDETPARELMKTLNGLVESGK
                     VHYLGASTLRPNAWKVARANEIARSEGWEPFNVLQPRYNLVDREIEGEYLEFARQQNL
                     AVSPWSPLGQGFLTGKYDRDEDLPEESKAAESSRFQEAYLTAENFDLHDELDAVAEEV
                     DATPAQTALAWLAHRDGVTAPIVGARTTAQLAENLAAASIDLSDEQVDRLTAAKSGPY
                     DGL"
     gene            complement(395542..396201)
                     /locus_tag="Hlac_0375"
     CDS             complement(395542..396201)
                     /locus_tag="Hlac_0375"
                     /inference="protein motif:TFAM:TIGR01855"
                     /note="TIGRFAM: imidazole glycerol phosphate synthase,
                     glutamine amidotransferase subunit;
                     PFAM: glutamine amidotransferase class-I; SNO glutamine
                     amidotransferase; CobB/CobQ domain protein glutamine
                     amidotransferase;
                     KEGG: nph:NP0082A imidazole glycerol phosphate synthase
                     subunit HisH"
                     /codon_start=1
                     /transl_table=11
                     /product="imidazole glycerol phosphate synthase, glutamine
                     amidotransferase subunit"
                     /protein_id="ACM55978.1"
                     /db_xref="InterPro:IPR000991"
                     /db_xref="InterPro:IPR002161"
                     /db_xref="InterPro:IPR010139"
                     /db_xref="InterPro:IPR011698"
                     /db_xref="InterPro:IPR011702"
                     /translation="MSTFEPPAETLADVVLVDYGLGNLRSATRGLERAGASVEITDDP
                     EAFADADGVVLPGVGAFREGMENAGPLREALTDHADAGRPLFGICLGMQMLLTSSEEA
                     DHEGEGEVTGLDLVPGTNVRFDVDRKVPHMGWNELEVERDHPLVEGVDGEYAYFVHSY
                     YAEPDDPDAVVATADYGVDFPAVVANEAGNVFGTQFHPEKSGETGLRILRNFVEYCAE
                     R"
     gene            complement(396290..397381)
                     /locus_tag="Hlac_0376"
     CDS             complement(396290..397381)
                     /locus_tag="Hlac_0376"
                     /inference="protein motif:TFAM:TIGR01097"
                     /note="TIGRFAM: phosphonate ABC transporter, inner
                     membrane subunit;
                     PFAM: binding-protein-dependent transport systems inner
                     membrane component;
                     KEGG: hsl:OE3907R phosphate/phosphonate ABC transporter
                     permease"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonate ABC transporter, inner membrane
                     subunit"
                     /protein_id="ACM55979.1"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="InterPro:IPR005769"
                     /translation="MTKDTTTSDGTAGSGAIDDADGSGVPNRIAEQFENIKRTRRRRA
                     LGWTGLLAFLAFATLQAFAATELLNPDARLETFTESLTGFFPITNYFGVIPFLDFGQY
                     IQFIRQENLLYDPEIGRLLFQFPPNPTDIYVFFFQELGIFQIFGEAGITLAMGFVGTV
                     LGFPFALVFGTLGSERVTPFPFNFIFRGTMSFIRAIPAIIWTLIFIPFLGLGPASAAI
                     AIAFDTIGNLGRLFVDELEEIEDGPIEAMRTTGASKPQIVFFGMLSQVRTAFIAWTLY
                     IFEINVRIGVTVGVIGAGGLGYVLTSQQNLLRFTEMMATLLAIFLLIISVELFSQRLR
                     SRLRSDDVEMSIWELVTGFPRRMADSMLK"
     gene            complement(397404..398189)
                     /locus_tag="Hlac_0377"
     CDS             complement(397404..398189)
                     /locus_tag="Hlac_0377"
                     /inference="protein motif:PFAM:PF00005"
                     /note="PFAM: ABC transporter related;
                     SMART: AAA ATPase;
                     KEGG: hsl:OE3908R phosphate/phosphonate ABC transporter
                     ATP-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter related"
                     /protein_id="ACM55980.1"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /translation="MTYIEVDGLTKRFGDTVALDDVSFEVPAGEFVIVLGVSGSGKST
                     LLRTLSGLLSPTDGEILIDGEPMFEPRPEVAMIFQQHNIIGDMTAYSNSLSGGVHRSG
                     FLSSVLQLQDPEEKHRALDALDTVGLLDEAEQKARSMSGGQQQRVGISRALVQQPNVL
                     LADEPVASLDPGSAQSVMNYLRTASNDRDLTTFCSLHQVNIARKFGHRFIGLRDGKKV
                     FDGYRDELTIDVIDDLYGDIDTEGMFVRDDGDSDEATDEVATT"
     gene            complement(398218..399312)
                     /locus_tag="Hlac_0378"
     CDS             complement(398218..399312)
                     /locus_tag="Hlac_0378"
                     /inference="similar to AA sequence:KEGG:OE3910R"
                     /note="KEGG: hsl:OE3910R phosphate/phosphonate ABC
                     transporter periplasmic substrate-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate/phosphonate ABC transporter
                     periplasmic substrate-binding protein"
                     /protein_id="ACM55981.1"
                     /db_xref="InterPro:IPR006311"
                     /translation="MSDNRWSANRRTFVKTAGAAGVVGLAGCSDGGTSGDSGNSATEV
                     TWVMNPAEEEIDIQVQYQPMFEYLESEADIEIIEQPTASYSGTAQELRRASEGDRVFA
                     DTSPGAVAQIPDQLDVTGMRVAYGAEKYFSLITTTADSDIEELADLEGEVFASAAPTS
                     VSGTLFPLYMLSNAGIDIGSAPSGSPEDFELRTSDHSTAREQLIQDDRIAAAGTGAFS
                     TASHVPQEQFDEMSQEFVDISAEYDGAGEDDPELQLLAVSDPIPRAPIVSNAAWEESL
                     KDDIRQLMIDAPQEAFEHDSQADIAEALNIDPEILDMDESELSEDQREDLDLVEAHAL
                     WFSGVVEASAEDYDPVAQLGQELGLEWNEL"
     sig_peptide     complement(399217..399312)
                     /locus_tag="Hlac_0378"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.662) with cleavage site probability 0.619 at
                     residue 32"
     gene            complement(399415..400029)
                     /locus_tag="Hlac_0379"
     CDS             complement(399415..400029)
                     /locus_tag="Hlac_0379"
                     /inference="protein motif:TFAM:TIGR00758"
                     /note="TIGRFAM: phage SPO1 DNA polymerase-related protein;
                     PFAM: Uracil-DNA glycosylase superfamily;
                     KEGG: hma:rrnAC2796 uracil DNA glycosylase superfamily
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="phage SPO1 DNA polymerase-related protein"
                     /protein_id="ACM55982.1"
                     /db_xref="InterPro:IPR005122"
                     /db_xref="InterPro:IPR005273"
                     /translation="MTENGDALDGDLRVPSCERCPALVESRSRIVDGVGPTDADLLFV
                     GEGPGAQEDERGEPFVGRSGDVLDDALRDAGLARADVRITNCVRCRPPDNRDPTTEEL
                     ANCRGYLDAEIDRLDPELIVTLGKVPSEHLLDRSVAITSESGEVVDVRIAGASRRVLL
                     SVHPAATLYDRSQRDGFFETIARAGELSGTAGAGSGGQSRLGEF"
     gene            complement(400284..401798)
                     /locus_tag="Hlac_0380"
     CDS             complement(400284..401798)
                     /locus_tag="Hlac_0380"
                     /EC_number="1.1.1.81"
                     /inference="protein motif:PFAM:PF05161"
                     /note="PFAM: MOFRL domain protein;
                     KEGG: hma:pNG7015 putative hydroxypyruvate reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="MOFRL domain protein"
                     /protein_id="ACM55983.1"
                     /db_xref="InterPro:IPR007835"
                     /translation="MTDDAETIDDAVTFRDRERLARTPTHEAALDCLAAGIEAALPER
                     LIRDAVSVRDGTLRIEGVDGAGGEYDLDAYDRVVLLGAGKATAGAAAGVAGALGRSDR
                     EIDEGIVVTDDPPDWTGADASDPSSTATIDVLPGDHPLPSERGVESARRVLDAAERAG
                     PDDLVLAVITGGGSALLAAPADPISVGDLRALTSALLTSGASIDEINAVRKHCSAVKG
                     GQLARAAAPATTVTLAVSDVIGDPLDTIASGPTVPDPSTYADALAVLDRYDLDAPDSV
                     RERLRAGADGELPETPTAGDPAFDRSAAFVVGNGRTALDAAATAAADRGYEPLVLSAS
                     VRGEAREAGTTHAAIAEECAARGSPIEPPAVLLSGGETTVTLGDAADPGTGGPNAEFA
                     ASAGLALAEGPLGDGGGGGGGDDDGHGHSAPRVVVASADTDGLDGPTDAAGAIADATT
                     LDPDAARDALDRHDAYPLFDDAGALLRTGPTGTNVNDLRAIVVEKRDGEEGRSL"
     gene            complement(401866..402453)
                     /locus_tag="Hlac_0381"
     CDS             complement(401866..402453)
                     /locus_tag="Hlac_0381"
                     /inference="protein motif:PFAM:PF01949"
                     /note="PFAM: protein of unknown function DUF99;
                     KEGG: nph:NP0086A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF99"
                     /protein_id="ACM55984.1"
                     /db_xref="InterPro:IPR002802"
                     /translation="MTPPSRTLGIAFSDDDRTSRLAGAVVRADGTLDGLGFETCTVGG
                     TDATDAAIALFDRLRREDVRHVAVAGIAPAWFNLLDLSRLHEALDRPVYAVSYEESPG
                     LEPALREAFDGEALARRLDTYRSLPPRVRVERDEWNSAASDAPEPLFVRAVGIDVDEA
                     AAAVCGLVREGFRRPEPLRIAAIAASAHREATRER"
     gene            complement(402458..402640)
                     /locus_tag="Hlac_0382"
     CDS             complement(402458..402640)
                     /locus_tag="Hlac_0382"
                     /inference="similar to AA sequence:KEGG:rrnAC2799"
                     /note="KEGG: hma:rrnAC2799 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55985.1"
                     /translation="MGFGSYDESEQENQDLDADFDDDDGVQAAEEVHEGSVDYEPGAS
                     NDELLDRLQEIKSEET"
     gene            402757..403398
                     /locus_tag="Hlac_0383"
     CDS             402757..403398
                     /locus_tag="Hlac_0383"
                     /inference="protein motif:PFAM:PF00753"
                     /note="PFAM: beta-lactamase domain protein;
                     KEGG: hwa:HQ1377A hydrolase (hydroxyacylglutathione
                     hydrolase)"
                     /codon_start=1
                     /transl_table=11
                     /product="beta-lactamase domain protein"
                     /protein_id="ACM55986.1"
                     /db_xref="InterPro:IPR001279"
                     /translation="MEPITVTADAEEFTCNAYLVSGEAPTLVDAGTMPGVDDVIADAL
                     DEAGVDGLDRVVLTHQHHDHVGQLDAVLDRFDATLYANAAHPRRDVAIGDGDEILVGD
                     EPCEVVETPGHAADHISLVGDDRVYSGDVVVYNDGAFDDGSFGRTDMAGQSREVLIES
                     LHTLLDRLPDTASAMYPGHGDVYRASDGPDTVREVIERATERAERREPKYPDE"
     gene            complement(403595..404578)
                     /locus_tag="Hlac_0384"
     CDS             complement(403595..404578)
                     /locus_tag="Hlac_0384"
                     /inference="protein motif:PFAM:PF08542"
                     /note="PFAM: AAA ATPase central domain protein;
                     Replication factor C;
                     SMART: AAA ATPase;
                     KEGG: nph:NP0900A replication factor C small subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="Replication factor C"
                     /protein_id="ACM55987.1"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR013748"
                     /translation="MSEADEQTAATATGREIWIEKYRPQSLDDIHGQEAIVERLQSYI
                     EQDDIPHLLFGGPAGTGKTTAATAIARQVYGDDNWRGNFLELNASDQRGIDVVRDRIK
                     GFARSSFGGDFRIVFLDEADSLTDEAQAALRRTMEQFSDNTRFILSCNYSSKIIDPIQ
                     SRCAVFRFSPLSDAAVAAQTREIAAAEGIEVTDEGVDALVYAADGDMRRAINSLQAAA
                     TTGEIVDEEAVYAITATARPEEIESMVTNALHGDFTRARATLDTLLTETGMAGGDVID
                     QLHRSVWEFDLSEREAVALMERIGEADYRIAEGANEQVQLESLLASLSLAE"
     gene            complement(404656..405579)
                     /locus_tag="Hlac_0385"
     CDS             complement(404656..405579)
                     /locus_tag="Hlac_0385"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: sth:STH2472 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACM55988.1"
                     /translation="MSPIRAAVPTAEEVSALLAGVWRTVDTETDAVAAELAGDESDAV
                     LLDLVATPFASVSDVNERLARTESYLRERGDRRAVFLTVYSRMTATVQTAIDDGAFLD
                     SEWAASYLVAFAERYRRALVAFERRAFESLPRPWLIAFAAAARSEALVAQDALLGINA
                     HITYDLTYTLGDVGIDPDRDGKLADHDRINAILAHLVQTVQDALVETYAAVEIAGVDR
                     LLDPLDDRLALLGLKGSREFAWRNAVLRADLPTWIGEPYVDWRTETVATGAAAIALAP
                     DIDADARERLRDAEADVDAVAAFYEAIRRRM"
     gene            complement(405596..406543)
                     /locus_tag="Hlac_0386"
     CDS             complement(405596..406543)
                     /locus_tag="Hlac_0386"
                     /inference="protein motif:PFAM:PF00766"
                     /note="PFAM: Electron transfer flavoprotein
                     alpha/beta-subunit; Electron transfer flavoprotein alpha
                     subunit;
                     KEGG: nph:NP3168A electron transfer flavoprotein, alpha
                     subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="Electron transfer flavoprotein alpha subunit"
                     /protein_id="ACM55989.1"
                     /db_xref="InterPro:IPR014730"
                     /db_xref="InterPro:IPR014731"
                     /translation="MSDVLVVSEHRRGELRDVSYEAITAGREIADARGGNLHVAVISG
                     DIDRFADDLNREGVDAVHAVANGEEFDHTVYQSAVGALLEKIDAGTVVIPNSVNGLDY
                     APAVAEAHDLPLVTDVIGFEYDDGLTATREMYGSKVETTVDVAGDRFVLTVRGGEWAP
                     AEGVGDATVESLEVDHPESGARVTGFEEVGGGDVDIADADVLVSVGRGIEEEENLELV
                     EELADALGATLSASRPIVDNGWLPKNRQVGQSGKVVTPDVYIAVGISGAVQHVAGMKG
                     SDTIVAINTDSNAPIFDIADYGIVGDLFEVVPELIDEFA"
     gene            complement(406543..407331)
                     /locus_tag="Hlac_0387"
     CDS             complement(406543..407331)
                     /locus_tag="Hlac_0387"
                     /inference="protein motif:PFAM:PF01012"
                     /note="PFAM: Electron transfer flavoprotein
                     alpha/beta-subunit;
                     KEGG: hsl:OE4005F electron transfer flavoprotein beta
                     subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="Electron transfer flavoprotein
                     alpha/beta-subunit"
                     /protein_id="ACM55990.1"
                     /db_xref="InterPro:IPR014730"
                     /translation="MKILVTVKEVAEPDDDFAIEDTDIAASDLEYDLNEWDDYAIEAA
                     VQLAEAGIADEVVTVTIGPERAEETIRMALAKGADRAVRVWDDAFEAGFADVAAKVTT
                     FEAVVDAEEPDLILGGVQAADTGFGATGVALAERIGFEHAAVVNDLEVDADAGVAHVH
                     RELEGGIEELTDVDLPAVLTVQTGLNEPRYASLRGIRQAQRKEIDAKDLADLGLSADD
                     VESALAITSMYEPESESNAEIIDGDAGESASRLAEVLREKGVSA"
     gene            complement(407428..408735)
                     /locus_tag="Hlac_0388"
     CDS             complement(407428..408735)
                     /locus_tag="Hlac_0388"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: nph:NP5028A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACM55991.1"
                     /translation="MRNAPSRALLVGLVAVALVASGVAPVAGGAPSPSSSPSLDADPS
                     AATPSVINPSTVNPSIVEQIDEPFDPNTATRIRIEPTSDGDAQWTVSVRYALSDERDR
                     AAFDSVGERFRDGEVGPDATLFEGFARQASQNLDRTMRIENVDREVVTHDDPSSFDVA
                     SAETAAVGELRLTFVWTEFLEEDGENLVLGDALTTSDGGTWLLSLEDRQTLEVATPEG
                     YSVTGTPSTAVAQLSDGDVIIEGPQTFEGGDPVVIVYGPASTIAPPWTMLTAAIVIAA
                     VLIAGSIVGYRRMDGSPGSAASGSVDEATVDSGGGERTDHGRLDAVTGDPTDPNSASN
                     GSGADGGEAAAEEEAEAEDLSLLSDEERVERLLEDNGGRMRQADIVAKTGWSDAKVSQ
                     LLSAMAELGRVEKLRLGRENLISIPDDGGAPDGDNGESSESEA"
     sig_peptide     complement(408646..408735)
                     /locus_tag="Hlac_0388"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.727 at
                     residue 30"
     gene            408893..410236
                     /locus_tag="Hlac_0389"
     CDS             408893..410236
                     /locus_tag="Hlac_0389"
                     /inference="similar to AA sequence:KEGG:HQ3253A"
                     /note="KEGG: hwa:HQ3253A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55992.1"
                     /translation="MRALPISLSVLLLLASIAGAVSPAAVAGAVADPVGEGTESVAGN
                     TEPAAASVAPTVENAADALDGADGDPDRPQVDAENLTFRTLSTPIGVATRVESGSRGA
                     NLGSSVGFAVGETDAAMETAAVVQRIEAAETSVERQRRILAAINRVERDEVTLNSRQT
                     EAFSAHAAGNLSDRELLDELVRIAATAREYDERLDELDALAEETDGFSSPTRLDELQV
                     ALQVYGGPVRDYALSTARGATPATDVYVESSNRSIVLATVVDGEYVREVFRVDRWDRG
                     GGSIGNDEAINATSAAYPETASLREPDAFGAGSVQRITIPHDFGLLRTFVSGGTEQVF
                     VEHQRIALGAFPDTEPVSVNGDGFNVTVDRSYAGGPVTVTVRNEETGEPVSDVTVTKS
                     VGDGDSQAIGTTDADGMVRTLSPAESYRVTVVDEPRAVFVDNLQPIATPRPVDDE"
     sig_peptide     408893..408976
                     /locus_tag="Hlac_0389"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.810 at
                     residue 28"
     gene            410300..410809
                     /locus_tag="Hlac_0390"
     CDS             410300..410809
                     /locus_tag="Hlac_0390"
                     /inference="similar to AA sequence:KEGG:NP5032A"
                     /note="KEGG: nph:NP5032A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55993.1"
                     /translation="MPIDTDADLLPSGPSADRSERALAPVASVLLLAITVVLAGGVVT
                     AAIDTPAEPAPTTFLSLSATDDRITVTHRGGDALDAAELEIRVRIDGESLARQPPVPF
                     FSAAGFHPGPTGAFNAATDGDWRVGGSASFRVAGTNDPTLEPGRTVTVDVSVDGRPVA
                     TLETVVESG"
     gene            complement(410843..411466)
                     /locus_tag="Hlac_0391"
     CDS             complement(410843..411466)
                     /locus_tag="Hlac_0391"
                     /inference="protein motif:PFAM:PF08241"
                     /note="PFAM: UbiE/COQ5 methyltransferase;
                     Methyltransferase type 11; Methyltransferase type 12;
                     KEGG: hma:rrnAC3151 ubiquinone/menaquinone biosynthesis
                     methyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="Methyltransferase type 11"
                     /protein_id="ACM55994.1"
                     /db_xref="InterPro:IPR004033"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="InterPro:IPR013217"
                     /translation="MGILENKSNARLFYKYLSKVYDQVNRFTWTEEMRTEALSWLEFG
                     DDPKVLDVGCGTGFGTEGILEHADDVHGLDQSVHQMEKAFEKFGKHDRVNFYRGDAER
                     LPFRDDTFDIVWSSGSIEYWPNPIEGLRELRRVAKPGGQVLVVGPDYPHNPVLQRVAD
                     AIMLFYDEDEADRMFEAAGYEAYEHHIQRASPQSPRAITTVARVSEE"
     gene            411637..412431
                     /locus_tag="Hlac_0392"
     CDS             411637..412431
                     /locus_tag="Hlac_0392"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: hsl:OE2077F hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACM55995.1"
                     /translation="MEPTTSGRFRVHDRRPRPDIDGTGPADPPEEFVLVDYPEAPIDP
                     TAPDAGDRFDPLYAAAEGYDGDMADRVASLEPGFVVDATLAWTDGSARFADVEVVRES
                     RFRFADDVDGMFEAAVDAWDQIRSAGEAVGSITTRSNDGEPNGALYLFADAPGSDAFA
                     DLRSGRLPIEPLVARVNESREDDGPREVFVLRPAAHDFVAVYVVFDREGVLAQTVRDT
                     YDLGPGLAAGLDGGALDAAKAGSDGAEDGADERDDGKDGFDALDRL"
     gene            complement(412467..413441)
                     /locus_tag="Hlac_0393"
     CDS             complement(412467..413441)
                     /locus_tag="Hlac_0393"
                     /inference="protein motif:PFAM:PF02826"
                     /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
                     catalytic region; D-isomer specific 2-hydroxyacid
                     dehydrogenase NAD-binding;
                     KEGG: hma:rrnAC2056 D-3-phosphoglycerate dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="D-isomer specific 2-hydroxyacid dehydrogenase
                     NAD-binding"
                     /protein_id="ACM55996.1"
                     /db_xref="InterPro:IPR006139"
                     /db_xref="InterPro:IPR006140"
                     /translation="MAKVVLSAFPMIDPETYREVLDEAVDEPVEIEVAQLGSTERLIE
                     AAAGADAVVTDIDTPVTDEALGRLDLRAVVRAAVGVDNVDVGAAAERGVTVTRAPDYC
                     TDEVAIHSVSLLLACLRSLKAYDDHVVDDGWSWEVGRPIRRVSASTVGFVSFGPIARR
                     AAEQIAGFDADLVAYDPFVEADEMAEYGVEKADFDELFDRADHVGVYAPLTDATRGMV
                     DADALARLDESSVVVNVSRGPVVDADALLDALESETIKGAGLDVLAEEPPEDDPLVDR
                     DDTIVTPHAAWYSEAARDDLNRSGAVDVAAVLNGETPDGRVDPDADWL"
     gene            413625..413912
                     /locus_tag="Hlac_0394"
     CDS             413625..413912
                     /locus_tag="Hlac_0394"
                     /inference="similar to AA sequence:KEGG:HQ1351A"
                     /note="KEGG: hwa:HQ1351A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55997.1"
                     /translation="MLVLLESLAFYRNARVGLVVGALFAVLLYGVRALELLGPVIDIR
                     DYPLFGPDVWFLLLAFVLAATFALLVAIGLTVVEAVRGARDLSAERSEEKS"
     gene            complement(413924..414205)
                     /locus_tag="Hlac_0395"
     CDS             complement(413924..414205)
                     /locus_tag="Hlac_0395"
                     /inference="similar to AA sequence:KEGG:HQ1370A"
                     /note="KEGG: hwa:HQ1370A ArsR family transcriptional
                     regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="ArsR family transcriptional regulator"
                     /protein_id="ACM55998.1"
                     /translation="MEGTQTEGLDDLPPSAKLVFKVLEYNGPLTQKGIVQESMLSART
                     VRYALERLEGIDVVDEDVYFADARQKLYKLTEPAQEFTGDENEASCTAD"
     gene            414529..414837
                     /locus_tag="Hlac_0396"
     CDS             414529..414837
                     /locus_tag="Hlac_0396"
                     /inference="similar to AA sequence:KEGG:HQ1371A"
                     /note="KEGG: hwa:HQ1371A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM55999.1"
                     /translation="MSDDSGISGHTRSVVVTTICSLAGIAAGVISAVYVGTDPVDAAS
                     TTLVLVLGAFVLAQYPLYKMIGVGDFGVKDNLYVAFLTFTLWFISYTVLATSGVELVV
                     "
     gene            414839..416659
                     /locus_tag="Hlac_0397"
     CDS             414839..416659
                     /locus_tag="Hlac_0397"
                     /inference="protein motif:PFAM:PF00005"
                     /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
                     protein; ABC transporter related; metal-binding domain in
                     RNase L inhibitor, RLI;
                     SMART: AAA ATPase;
                     KEGG: hsl:OE4667R ABC-type transport system ATP-binding
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter related"
                     /protein_id="ACM56000.1"
                     /db_xref="InterPro:IPR001450"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR007209"
                     /db_xref="InterPro:IPR013283"
                     /db_xref="InterPro:IPR017871"
                     /translation="MADDSIAVVDLDRCQPDRCNYECANYCPPNRTGKECITKRGEDA
                     AEGDPDQIHISEEICLGETCGICVEKCPFDAIEIINLPSELDEEPVHRYGDNAFSLYG
                     LPTPKPGNVTGILGPNGIGKSTAVHALAGEMVPNLGDYESEGDWERVLDRFRGTGLQN
                     YLQSLKEGDVTVARKPQYVDQIPNQFDGNTRELLERTDERGALDSLIDRLNIRPVMDQ
                     PIDSISGGELQRVAIAACLARDADFYFLDEITPYLDIGQRMIVARLIRELADDDAAER
                     SMLVVEHDLAILDLLADTLHVAYGEPGAYGVVTDPKSVRNGINEYLKGYLDNENMRIR
                     PSAITFEEHAPRVSSRSETLIEYPELSKSYGDGEFELHVEGGEINRSEVLGVVGPNGI
                     GKSTLAKLFAGSLEPDEGELDFALDIAYKPQYIDIDQPMRVDVFLSSITDDFGSSYWN
                     TEIAQPLQLDRVMEQNLSDLSGGERQRVAIAACLSEDADLYLLDEPSAHLDVEQRVRA
                     TTAIRRYAENHDATVMVIDHDIYMIDLLADRLMVFDGEPAERGHATPPQEMRDGMNEF
                     LADLDITFRRDERTGRPRINKPGSQLDSSQKRDGEYYYSG"
     gene            416900..417586
                     /locus_tag="Hlac_0398"
     CDS             416900..417586
                     /locus_tag="Hlac_0398"
                     /inference="similar to AA sequence:KEGG:rrnAC2611"
                     /note="KEGG: hma:rrnAC2611 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM56001.1"
                     /db_xref="InterPro:IPR001844"
                     /translation="MNRSQLLPALIALLAITSLSVASTTLETSLTTDPDEEINPNWES
                     LPIGQDDAAAIQESIEGGGGESDGGGGSGSTDATGSATDDRSLFDRLIALLSRLFRLL
                     LPIAAVLAVAALAYRYRDLLADLFGRDSRTTPATESRPTAERWPGTTPEHDVDRAWVE
                     LIRRLNPNRPETTTPDECRALARVRGVDRDAVESIVSAFEHVHYGGRSVDAEADRARD
                     GLRALEDDVK"
     sig_peptide     416900..416968
                     /locus_tag="Hlac_0398"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.858 at
                     residue 23"
     gene            417583..418416
                     /locus_tag="Hlac_0399"
     CDS             417583..418416
                     /locus_tag="Hlac_0399"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: hsl:OE1353F hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACM56002.1"
                     /translation="MTDRTVDRDPATDSSDADTRRIGAGGLLARLGRVARVLLLLVGV
                     ATLGVGLLVAFDPETEGVLRIDAAIEALGSDYVVLAVFGLLAVVLALLLVAAQRVRGV
                     SEATPPAVEGVLTASYPGASFDHAGGGRLRRFRSTRSATDRRRRLREAAVRATMRAEG
                     CSRTDAERRVDEGTWTNDSVAASSLSASGRGVLGGTLSALEVTRDGDPADRTVDAILA
                     KTTGKRSVVRGSDRDGNEDLTAATVRNSGRGTDRDADRDANRASDRRSDERSTAQEGA
                     Q"
     gene            418413..419930
                     /locus_tag="Hlac_0400"
     CDS             418413..419930
                     /locus_tag="Hlac_0400"
                     /inference="protein motif:PFAM:PF01882"
                     /note="PFAM: protein of unknown function DUF58;
                     KEGG: hsl:OE1356F hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF58"
                     /protein_id="ACM56003.1"
                     /db_xref="InterPro:IPR002881"
                     /translation="MTPDIAALRRCLGGSERPERTAVDGGSRWGSAARTDGGATAEPA
                     SETNRPSAVRWTGRWRGIAAVTLLAVAIGVLAKRPPLLLVGALTGAYVAYPRLTATPN
                     PDLSVRREIDPASPADGEWVSVRTTITNEGDSALADVRVVDGPPAMLSVSDGSPRCAT
                     ALLPGGEVTIRYELRARPGRHAFQPTTVLCRDASGSVEVELSLTAASSFECEAEIPTV
                     PLRAQTGHHPGPLVTDDGGEGIEFHSVEEYRRGDPANRIDWRRYARTGELTSMTFRTE
                     RLAEVVVCVDARPASYRAADATEPHAVALAVDAAGRIGDALFDANHQVGLAGFGRHVC
                     VLPTRNGPDHASRFHRRLATDPAFGLDPPETARTTDREGGTALPGSVAGDGPDGGWVT
                     RGDGADGPDGAVPVDTQLSRIRAEIGANTQVVLITPLCDDEASRIAQRFESGGTAVRV
                     VSPDVTTTETAGGRLARLERTHRLSMLRNAGIPVVDWTPTQPLGAAMAAVEGWGR"
     gene            419927..420676
                     /locus_tag="Hlac_0401"
     CDS             419927..420676
                     /locus_tag="Hlac_0401"
                     /inference="similar to AA sequence:KEGG:rrnAC3540"
                     /note="KEGG: hma:rrnAC3540 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM56004.1"
                     /translation="MTASDATGPATVPDGATARFVRRPAITSSVVALAAGGVAVALVA
                     DTALQREILRLAVGGALAFGIGARLVRHGGTALRALGALIALGGGLVVLVAVGQAATQ
                     SPQVTHRVELLPGIVGMWTLSAALAPVRFRWSRALIDLGAGFVFLGVLVTGVTQGVGT
                     TALLLAALATIVARDAAENAVSVGGQIGGQRGARTVRAELAHVGVAASVGAGAVVVVL
                     GVARLDIDGLPFGALVALIVGSVVLVLGSNR"
     gene            complement(420735..421688)
                     /locus_tag="Hlac_0402"
     CDS             complement(420735..421688)
                     /locus_tag="Hlac_0402"
                     /inference="protein motif:PFAM:PF07726"
                     /note="PFAM: ATPase associated with various cellular
                     activities AAA_3; ATPase associated with various cellular
                     activities AAA_5;
                     KEGG: hma:rrnAC3062 methanol dehydrogenase regulatory
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase associated with various cellular
                     activities AAA_3"
                     /protein_id="ACM56005.1"
                     /db_xref="InterPro:IPR011703"
                     /db_xref="InterPro:IPR011704"
                     /translation="MDPATVQQRSDQILDGIASVVVSERSTLKTVLVGLLSDGHILLE
                     DVPGTGKTLTARSFANAVDVSFSRVQFTPDLLPSDVIGSNVFDEKTQSFEFQPGPVFA
                     NVVLADEINRAPPKTQAALLEAMEEGQVTVDGETHPLPDPFVVIATQNPVEMEGTFEL
                     PAAQKDRFIVKTSLGYPDRAGELELIDRRAGRQASSPSVRTVCSLDTLTQLRRAPESI
                     RVEDGVRQYLVDVARATRTDERVNTGVSPRGIQRFFEVVRTHAALMGRSYATPDDVKA
                     MAPPALSHRIVVTPDARVSGVSTTEIVDDILSEIPMPQLRA"
     gene            421879..422145
                     /locus_tag="Hlac_0403"
     CDS             421879..422145
                     /locus_tag="Hlac_0403"
                     /inference="similar to AA sequence:KEGG:NP1612A"
                     /note="KEGG: nph:NP1612A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM56006.1"
                     /translation="MQHLIIRGDPGIRRDAVIEYDGEELVCFGINVQGGWHGPDEPQL
                     WCTVGTEDEREAYDKREYVPHWLDVDTVDAEELDVIKAKGELSV"
     gene            complement(422186..422785)
                     /locus_tag="Hlac_0404"
     CDS             complement(422186..422785)
                     /locus_tag="Hlac_0404"
                     /inference="protein motif:TFAM:TIGR00057"
                     /note="TIGRFAM: Sua5/YciO/YrdC/YwlC family protein;
                     PFAM: SUA5/yciO/yrdC domain;
                     KEGG: hma:rrnAC2602 DNA binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Sua5/YciO/YrdC/YwlC family protein"
                     /protein_id="ACM56007.1"
                     /db_xref="InterPro:IPR004388"
                     /db_xref="InterPro:IPR006070"
                     /translation="MTKDTDTLRRAAEAVADGDLVVYPTETVYGLGGDALDPTAVERV
                     FDLKGRERSNPLSLGVPSVDAALRYTKPTEFAVAFARAFLPGPVTVVVERGDPVPDAL
                     TAGSDRVGVRVPDHPIARDLLRETGPLTATSANVSGRGSVTHPDDLDDRIREGVAVVI
                     DDGETPGTESTVVDPDARTIHRRGAMAGAIEAWLDDPPV"
     gene            complement(422866..423375)
                     /locus_tag="Hlac_0405"
     CDS             complement(422866..423375)
                     /locus_tag="Hlac_0405"
                     /inference="protein motif:PFAM:PF00578"
                     /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
                     antioxidant/ Mal allergen;
                     KEGG: hwa:HQ3707A peroxiredoxin-like protein"
                     /codon_start=1
                     /transl_table=11
                     /product="alkyl hydroperoxide reductase/ Thiol specific
                     antioxidant/ Mal allergen"
                     /protein_id="ACM56008.1"
                     /db_xref="InterPro:IPR000866"
                     /translation="MVDFDVVSLPETDHVAEGDAAPDFTRPLVGEEYWEDRALSEAVD
                     GPTLLLFHPMDGAFQATYLYNTIDDHGWADDLDILGVSISTPYAHKRLLAERADGVRI
                     FSDPGADVIDAYGLAHDIDGMTGIAETRPAVFLLDADRTVEYAWVASEHPEFPDAEAI
                     GGAIDRLVD"
     gene            complement(423377..423637)
                     /locus_tag="Hlac_0406"
     CDS             complement(423377..423637)
                     /locus_tag="Hlac_0406"
                     /inference="protein motif:PFAM:PF00462"
                     /note="PFAM: glutaredoxin; Glutathione S-transferase
                     domain;
                     KEGG: hma:rrnAC2599 glutathione S-transferase"
                     /codon_start=1
                     /transl_table=11
                     /product="glutaredoxin"
                     /protein_id="ACM56009.1"
                     /db_xref="InterPro:IPR002109"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="InterPro:IPR011767"
                     /translation="MSESPITLYRLQACPYCERVVRMLNELDLEYRSRYVEPMHSERN
                     VVKRVSGARSVPAIVDPETGVTMSESANIVEYLESTYAEGGA"
     gene            423835..425229
                     /locus_tag="Hlac_0407"
     CDS             423835..425229
                     /locus_tag="Hlac_0407"
                     /inference="protein motif:PFAM:PF01595"
                     /note="PFAM: CBS domain containing protein; protein of
                     unknown function DUF21; transporter-associated region;
                     KEGG: hwa:HQ3705A CBS domain-containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="protein of unknown function DUF21"
                     /protein_id="ACM56010.1"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR002550"
                     /db_xref="InterPro:IPR005170"
                     /translation="MGLSSSVPVADLLQIPMPGDGVVLALGVAAILFLIGLSAFFSSS
                     EIAMFSLPQHRVDSLVDEGVKGAETIRGMKQNPHRLLVTILVGNNIVNVAMTSIATAL
                     FGIYLSRGESVLATTFGITTLVLIFGESAPKSYAVENTESWALRIARPLKLSEYALYP
                     LVVLFDYIVKGINKIIGGSAAIESTYVTRDEIQDIIETGEREGVIEEEEREMLDRIFR
                     FNNTIAKEVMTPRLDVTAVAKESSVEEAIETCIQADHERVPVYEGNLDNIIGVVTVRD
                     LVRELRYSEGEPSLERVVKPTLHVPESKNADELLAEMQDNRLQMVTVIDEFGTTEGII
                     TLEDMVEEIVGEILEGDEEAPVEFLEDNVAVVQGEVNIDEVNEMLGIDLPEGEEFETL
                     AGFVFNRAGRLVEEGEEIEFDEIRIRIERVDNTRIMSARVTVLDGAEAADVVAEDDAL
                     ESSGEPEAPPNDAE"
     gene            complement(425545..426276)
                     /locus_tag="Hlac_0408"
     CDS             complement(425545..426276)
                     /locus_tag="Hlac_0408"
                     /inference="similar to AA sequence:KEGG:HQ3389A"
                     /note="KEGG: hwa:HQ3389A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACM56011.1"
                     /translation="MDLRVQGDVPPDPFLGAADLFETEWSLDDPVHVKVREDPDERTW
                     AGHYDGYHVLNVSKRAATSAMARELAVHELSHMARYEEGHASHVQSTEEALYLGLSGE
                     TVERRKLAHCYQIANHMKDIYADDITLSVAPADKLLGFLESTLAAAVADRPEVSRDGA
                     PPVTAGADPEITAVNAAFALALVERHDIAGPNHRIYDLARAAGSDTDAVDVDAFKERF
                     LALGPDPSESDYRKALVAAARAYAV"
     gene            426358..427587
                     /locus_tag="Hlac_0409"
     CDS             426358..427587
                     /locus_tag="Hlac_0409"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: hma:rrnAC2123 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACM56012.1"
                     /translation="METRVYAAYDDGLRIVDPETGTVSHRLADRAVECLSVVSGGTES
                     GGTGGDGECIDGDGSGGDGSGGDESRGDESRGDGSKRDRSAGARVLAGTFDAGLFRST
                     DGGGSFERVATESLGPGGSGSEAVTAVATSPHDPEVVWIGTEPSRVYRSTDGGETVER
                     IGGLTEVPSASEWSFPPRPDTHHVRWIEPCPADPERWFVGVEAGALVVTPDGGETWVD
                     RPEGSRRDNHALATHPDAPNLVYAAAGDGFAESGDRGDSWRVVDRGLDHGYVWGLAVD
                     PGDPETALVSAASGAGAAHSRGEAYLYRRSVGGDSRRDDRGDDRENGRGDDRGDGGNG
                     RSAASDSGPRFERLDDRGIPTGEGTYRAVLASGRADGTMWAVHNEGLYRTRDAGESFE
                     RVPADLPASPARALAIE"
     gene            complement(427671..428396)
                     /locus_tag="Hlac_0410"
     CDS             complement(427671..428396)
                     /locus_tag="Hlac_0410"
                     /inference="protein motif:TFAM:TIGR00697"
                     /note="TIGRFAM: conserved hypothetical integral membrane
                     protein;
                     PFAM: protein of unknown function DUF165;
                     KEGG: nph:NP1354A hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="integral membrane protein-like protein"
                     /protein_id="ACM56013.1"
                     /db_xref="InterPro:IPR003744"
                     /translation="MSEGTARAAGGEGPFAADPLDRSAVAAVGLITLFVVALATAQLT
                     AAKVIALPLPFALPVVGPEITLPGAALAYALTFLASDCYAELYGRRATQVVVNVAFLA
                     NFLVLALVWSTLAAPGIDPEIAAAFDTALGPAANVVAGSLLAYVVSQNWDVVVFHAIR
                     DRTGRGMLWLRNIASTASSQAIDTAIFVGVAFYAAPLVLGSGDPLPASVLLALGLGQY
                     LLKLAIAVLDTPIVYLVVGAVRE"
     gene            complement(428389..428622)
                     /locus_tag="Hlac_0411"
     CDS             complement(428389..428622)
                     /locus_tag="Hlac_0411"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: hsl:OE4179R hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator,
                     CopG/Arc/MetJ family"
                     /protein_id="ACM56014.1"
                     /translation="MPKISVEIPGELLDDLDGHVGDDGKFVNRSDAVRASIRKTLDVL
                     DEIDARHDRLADEAAEGAADATDRDDPAGGDDE"
     gene            429354..432545
                     /locus_tag="Hlac_0412"
     CDS             429354..432545
                     /locus_tag="Hlac_0412"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: hma:rrnAC1408 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACM56015.1"
                     /db_xref="InterPro:IPR006172"
                     /translation="MTNDNNTRKKASAVFFAAIMVVSMVAIGFAAAPAAADLDGTNST
                     IDSAAAEPVTAGFDSSEQDVQVKVTISDNASDNVTVDLSEAADVEAVPSLQDVTISPS
                     TTGNVNLLGSEFDESTNVLEFQVKGTTAGDDVATVTASFEHDLSNVEGPAGTTNRLSY
                     SVGAGTETDSTIANFEVYSAEDVSLDAPLTEDNVNSADFTVSHPANTPVAGDEVSLFI
                     TGNDNSTVVDPTSATTDADPTTFTGVNLDSQGIASGAGDEIQFHAVLAADADNGTSGF
                     EASLNNVQADGTATVDDSDADIITDSDWDGSQLWEGQTVTVDLSGSNVAPGDEVTVRE
                     VTNRNGNGYATNTRLARSLTVSGDRTISIETDRLRGEAEYVLRTSNGLLAAGTAGAGT
                     DGEFRMVLGVSDIAEAQVLTQDLSAEFAEDEANNDEKIDVDVASLRSEFDVEVSGDLD
                     DSELSEEELENIFDDESATGLDDGDDDTVLIEDVQDGEAFVANFTDVDGGNYSFDFDV
                     EDTTASDTDSIEVTELGEGELTLGGESIVTEQQGDVANITVTFDGTAETGTLLVGDED
                     DVGYQGNITIDSNGEDEVNVLFNSYAAGSSGNGTVFELANPDDTDAELDNFQQNQISD
                     VLSDGDYTLSVSTSSDYDDTLDDPDTIGTLVLEQRATTNQQIWTTSEGTVTDIVDAAD
                     ADDEDGLEELNSQIEGDNVTQASTIAEGDYVIHQIEASGLSGLLAQYDDDPTTALNDA
                     VTDTGAGIGTAVTDTGAGIGTNDGALSLRVRQTQASTTANQDPAELQSNILGNMTVFA
                     DEETNNYYVVYDLDDTSAEDGEAFDARFRVQDDRLLNPSDSDRDALSTNELTNEYYQS
                     VTASFDVAEREFEFDQDPYNVTNAEGQAVSGTSNVAPGTEVNVRLRSASGTSPSFIET
                     SEGVRVNADGTWMTEFDFSDTSVGDEYTFTVRQTGLDENPSVDGTVIEAVDDGTDDGD
                     DGNVTDGDDGDDGNVTDGDDGDDGNVTDGDDGTDDGDDGTDDGDDGSDDGSDGSDGGD
                     DGGDSEDGTPGFGALVALVALIAAALLATRRNE"
     sig_peptide     429354..429464
                     /locus_tag="Hlac_0412"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.617 at
                     residue 37"
     gene            433018..433608
                     /locus_tag="Hlac_0413"
     CDS             433018..433608
                     /locus_tag="Hlac_0413"
                     /inference="protein motif:PFAM:PF00827"
                     /note="PFAM: Ribosomal protein L15e;
                     KEGG: nph:NP0246A 50S ribosomal protein L15e"
                     /codon_start=1
                     /transl_table=11
                     /product="Ribosomal protein L15e"
                     /protein_id="ACM56016.1"
                     /db_xref="InterPro:IPR000439"
                     /translation="MARSFYSHIKEAWRSPKEGKLAELQWQRKQEWRDEGAIERIERP
                     TRLDKARELGYKAKQGVVVARVSVRKGGSRKQRHKAGRRSKRQGVNRLSRRKSIQRIS
                     EERASRKYRNLRVLNSYWVGEDGSQKWHEVILVDPNHPAIENDGDLGWIASDDHKGRA
                     FRGLTSAGTKGRGQRTRGTGTEKTRPSVTGNDRQGK"
     gene            complement(434253..435528)
                     /locus_tag="Hlac_0414"
                     /note="ribosomal slippage"
     CDS             complement(join(434253..434825,434827..435528))
                     /locus_tag="Hlac_0414"
                     /inference="protein motif:PFAM:PF06774"
                     /ribosomal_slippage
                     /note="PFAM: Protein of unknown function DUF1225;
                     KEGG: nph:NP2942A IS1341-type transposase"
                     /codon_start=1
                     /transl_table=11
                     /product="Protein of unknown function DUF1225"
                     /protein_id="ACM56017.1"
                     /db_xref="InterPro:IPR010641"
                     /translation="MKRANTFEVVPQTENDKECLLRLLDASASLWNELTYERRQNYFG
                     DGDVWDTPEYRGRYNGVVGSATVQQVTRKNSEAWRSFFALKEKGEYANPPSYWGNEED
                     GRELRTYIRCNQYTIEWGKRSRLEIPVGQELKDEYGLGYHERLRLEVRGNPKWDGKQG
                     RLELEYDEVSDTFRAFQPVTVPDSRLDSPLASEEAALDVGANNLVACSTTTGNQYLYD
                     GRELFGRFRETTDEIARLQSKLREGRYSSNRIRRLYRQRTKRRDHAQNALVRDLVERL
                     YDEGVATVYVGDLTDVLEAHWSVRVNEKTHNFWAFKKFIHRLACVCEEYGISLETESE
                     AWTSQTCPECGDHEKTVRHEDTLTCPCGFEGHADLTASETFLRENSNCEIRPMARPVR
                     FEWDDHDWSGKLYPHESPKEVRTNPQVASVGR"
     gene            complement(435525..435905)
                     /locus_tag="Hlac_0415"
     CDS             complement(435525..435905)
                     /locus_tag="Hlac_0415"
                     /inference="protein motif:PFAM:PF01797"
                     /note="PFAM: transposase IS200-family protein;
                     KEGG: hsl:OE5063R IS200-type transposase (TCE31)"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS200-family protein"
                     /protein_id="ACM56018.1"
                     /db_xref="InterPro:IPR002686"
                     /translation="MVKSTRHAKYELYYHIVFVPKYRRSHLTGKTKERLESIFAEICE
                     DKGLELAESEVMPDHVHLFIGSPPKNAPSLIVNWVKGISARKYNQRYDDRVKWTRSYY
                     VGTAGSASKGAVEQYIAEQEGDDE"
     gene            complement(436055..437701)
                     /locus_tag="Hlac_0416"
     CDS             complement(436055..437701)
                     /locus_tag="Hlac_0416"
                     /inference="protein motif:TFAM:TIGR02339"
                     /note="TIGRFAM: thermosome;
                     PFAM: chaperonin Cpn60/TCP-1;
                     KEGG: hwa:HQ1387A thermosome, beta subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="thermosome"
                     /protein_id="ACM56019.1"
                     /db_xref="InterPro:IPR001844"
                     /db_xref="InterPro:IPR002194"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR012714"
                     /translation="MQQGQPMIIMGDDAQRVKDKDAQEYNISAARGVAESVRSTLGPK
                     GMDKMLVDSTGGVTITNDGVTILQTMDIDNPTAEMIVEVAQTQEDEAGDGTTSAVAIA
                     GELLKNAEDLLEQDIHPTAVIKGFNLASEYAREQVDEVATQVDPDDTETLKSVAETSM
                     TGKGAELDKDTLADLVVRAIQGVTVEADDGSHVVDLANLNIETRTGRAAGQSRLLSGA
                     VIDKDPVHEDMPTDFEDANVLLLNDPIEVEEADVDTAVNVESPDQLQRFLDQEEEQLR
                     DKVDKIVESGADVVFCQKGIDDLAQHYLAKEGILAVRRTKKSDLTFLKNVLGAPIVSD
                     LDSLTADDLAIGTVSRDTEEGLFYVEGEDAHGVTLLLYGTTEHVVDELERGIQDAIDV
                     VSTTVSDGRTLPGGGAIEVELASRLRDYADTVSGREQLAVEAFADSLELIPRVLAENA
                     GLDAIDLLVDLRAAHEAGDTEAGLNVFSGEVENTTEAGVVETAHAKEQAIASAAEAAN
                     LVLKIDDIISAGDLSTGGDGDEGGAPAGGMGGMGGMGGAM"
     gene            complement(438078..438245)
                     /locus_tag="Hlac_0417"
     CDS             complement(438078..438245)
                     /locus_tag="Hlac_0417"
                     /inference="ab