LOCUS       KZ503875             1278363 bp    DNA     linear   CON 21-DEC-2017
DEFINITION  Dendrobium catenatum unplaced genomic scaffold
            original_scaffold_144855, whole genome shotgun sequence.
ACCESSION   KZ503875 JSDN02000000
VERSION     KZ503875.1
DBLINK      BioProject: PRJNA262478
            BioSample: SAMN03083363
KEYWORDS    WGS.
SOURCE      Dendrobium catenatum
  ORGANISM  Dendrobium catenatum
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliophyta; Liliopsida; Asparagales; Orchidaceae;
            Epidendroideae; Malaxideae; Dendrobiinae; Dendrobium.
REFERENCE   1  (bases 1 to 1278363)
  AUTHORS   Zhang,G.Q., Xu,Q., Bian,C., Tsai,W.C., Yeh,C.M., Liu,K.W.,
            Yoshida,K., Zhang,L.S., Chang,S.B., Chen,F., Shi,Y., Su,Y.Y.,
            Zhang,Y.Q., Chen,L.J., Yin,Y., Lin,M., Huang,H., Deng,H.,
            Wang,Z.W., Zhu,S.L., Zhao,X., Deng,C., Niu,S.C., Huang,J., Wang,M.,
            Liu,G.H., Yang,H.J., Xiao,X.J., Hsiao,Y.Y., Wu,W.L., Chen,Y.Y.,
            Mitsuda,N., Ohme-Takagi,M., Luo,Y.B., Van de Peer,Y. and Liu,Z.J.
  TITLE     The Dendrobium catenatum Lindl. genome sequence provides insights
            into polysaccharide synthase, floral development and adaptive
            evolution
  JOURNAL   Sci Rep 6, 19029 (2016)
   PUBMED   26754549
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1278363)
  AUTHORS   Zhang,G.Q., Liu,K.W., Li,Z., Lohaus,R., Hsiao,Y.Y., Niu,S.C.,
            Wang,J.Y., Lin,Y.C., Xu,Q., Chen,L.J., Yoshida,K., Fujiwara,S.,
            Wang,Z.W., Zhang,Y.Q., Mitsuda,N., Wang,M., Liu,G.H., Pecoraro,L.,
            Huang,H.X., Xiao,X.J., Lin,M., Wu,X.Y., Wu,W.L., Chen,Y.Y.,
            Chang,S.B., Sakamoto,S., Ohme-Takagi,M., Yagi,M., Zeng,S.J.,
            Shen,C.Y., Yeh,C.M., Luo,Y.B., Tsai,W.C., Van de Peer,Y. and
            Liu,Z.J.
  TITLE     The Apostasia genome and the evolution of orchids
  JOURNAL   Nature 549 (7672), 379-383 (2017)
   PUBMED   28902843
REFERENCE   3  (bases 1 to 1278363)
  AUTHORS   Zhang,G.-Q., Xu,Q., Liu,K.-W., Chen,F., Hsiao,Y.-Y., Yoshida,K.,
            Su,Y.-Y., Zhang,Y.-Q., Chen,L.-J., Deng,H., Zhu,S.-L., Zhao,X.,
            Deng,C., Niu,S.-C., Huang,J., Wang,M., Liu,G.-H., Yang,H.-J.,
            Mitsuda,N., Yeh,C.-M., Tsai,W.-C., Zhang,L.-S., Wang,Z.-W.,
            Luo,Y.-B., Bian,C. and Liu,Z.-J.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-OCT-2014) Shenzhen Key Laboratory for Orchid
            Conservation and Utilization, The National Orchid Conservation
            Center of China, and The Orchid Conservation and Research Center of
            Shenzhen, No. 889 Wangtong Road, Shenzhen, Guangdong 518114, China
REFERENCE   4  (bases 1 to 1278363)
  AUTHORS   Zhang,G.-Q., Xu,Q., Bian,C., Tsai,W.-C., Yeh,C.-M., Liu,K.-W.,
            Yoshida,K., Zhang,L.-S., Chang,S.-B., Chen,F., Shi,Y., Su,Y.-Y.,
            Zhang,Y.-Q., Chen,L.-J., Yin,Y., Lin,M., Huang,H., Deng,H.,
            Wang,Z.-W., Zhu,S.-L., Zhao,X., Deng,C., Niu,S.-C., Huang,J.,
            Wang,M., Liu,G.-H., Yang,H.-J., Xiao,X.-J., Hsiao,Y.-Y., Wu,W.-L.,
            Chen,Y.-Y., Mitsuda,N., Ohme-Takagi,M., Luo,Y.-B., Van De Peer,Y.
            and Liu,Z.-J.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-NOV-2017) Shenzhen Key Laboratory for Orchid
            Conservation and Utilization, The National Orchid Conservation
            Center of China, Wangtong Road, ShenZhen 518114, China
COMMENT     ##Genome-Assembly-Data-START##
            Assembly Date          :: 10-MAY-2014
            Assembly Method        :: platanus v. 1.2.1
            Genome Representation  :: Full
            Expected Final Version :: Yes
            Genome Coverage        :: 202.0x
            Sequencing Technology  :: Illumina HiSeq
            ##Genome-Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..1278363
                     /organism="Dendrobium catenatum"
                     /mol_type="genomic DNA"
                     /submitter_seqid="original_scaffold_144855"
                     /specimen_voucher="NOCC:Z.J. Liu 4979"
                     /db_xref="taxon:906689"
                     /chromosome="Unknown"
                     /sex="hermaphrodite"
                     /tissue_type="The whole plant"
                     /dev_stage="Growing period"
                     /country="China: Yunan, Guangnan County"
                     /lat_lon="23.57 N 104.59 E"
                     /collection_date="2012-09-17"
                     /collected_by="Zhong-Jian Liu"
     gene            complement(13728..14108)
                     /locus_tag="MA16_Dca015384"
     mRNA            complement(13728..14108)
                     /locus_tag="MA16_Dca015384"
                     /product="hypothetical protein"
     CDS             complement(13728..14108)
                     /locus_tag="MA16_Dca015384"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKU60840.1"
                     /translation="MLAVALVGLEKRNSRSHFQIYRRFLGYQSLDTLLRSVSLQTSSY
                     FVGFPQQMETGGIDLCCRMNSQYFLSTTIECTGPRGFQHVLELACLDPQFPSAQLLEC
                     SGSVTLRSVRPRLAAQHSTVRVDR"
     gene            14698..15024
                     /locus_tag="MA16_Dca015385"
     mRNA            14698..15024
                     /locus_tag="MA16_Dca015385"
                     /product="hypothetical protein"
     CDS             14698..15024
                     /locus_tag="MA16_Dca015385"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKU60841.1"
                     /translation="MLWETFLQEPVNLKFSKDRIKGFMNVKLSTEDFNATSSVESENF
                     FCQQNVIRRDSGFNKSSLIDFHSERHGVSKSSGKNLSNAFIKNITQSNRSKVRNRRSV
                     LLRITK"
     assembly_gap    25837..28373
                     /estimated_length=2537
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            42896..79771
                     /gene="PRMT6"
                     /locus_tag="MA16_Dca015386"
     mRNA            join(42896..43021,51656..51721,70916..70984,71112..71189,
                     71360..71438,71822..71916,75911..75995,78873..79078,
                     79391..79509,79729..79771)
                     /gene="PRMT6"
                     /locus_tag="MA16_Dca015386"
                     /product="putative protein arginine N-methyltransferase 6"
     CDS             join(42896..43021,51656..51721,70916..70984,71112..71189,
                     71360..71438,71822..71916,75911..75995,78873..79078,
                     79391..79509,79729..79771)
                     /gene="PRMT6"
                     /locus_tag="MA16_Dca015386"
                     /note="GO_function: GO:0008168 - methyltransferase
                     activity [Evidence IEA];
                     GO_process: GO:0006479 - protein methylation [Evidence
                     IEA]"
                     /codon_start=1
                     /product="putative protein arginine N-methyltransferase 6"
                     /protein_id="PKU60842.1"
                     /db_xref="InterPro:IPR025799"
                     /translation="MILGWRNFVHFFTSPGSSTSLLLNPFSHSQVYAIEASDIAVQAS
                     EVVKANNLSDKVIVIHERVEKVSIQEKVDVIISEWMGYMLLYESMLSSVIFARDNWLK
                     QGGLILPSHATLYMAPITHSERYSDSIDFWRDVYGIDMSVMLPLAKQCAFEEPSIETI
                     SAENVLTWPFVVKFVDCYTVTARELESITTKYNLTSMLRAPLHGFAFWFDAEFNGPST
                     FPSNNNLLSGSSTSDLYSNVYNNQRRQKAKSDQVLMLSTAPEDEPTHWQQTILYLYEP
                     IEVIQDQTIEGSITLSQSRENPRFLNIHLEYSSGGRSFIKESIMR"
     assembly_gap    52905..53688
                     /estimated_length=784
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            82587..83068
                     /locus_tag="MA16_Dca015387"
     mRNA            join(82587..82814,82898..83068)
                     /locus_tag="MA16_Dca015387"
                     /product="hypothetical protein"
     CDS             join(82587..82814,82898..83068)
                     /locus_tag="MA16_Dca015387"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKU60843.1"
                     /translation="MIAVPASRNFSPAAAFFRSSGELFLPRTKFMPGKTPSSIRFSPC
                     TFPRRRLFNLQVRAARAESSVASLGSRAPYFELPEPLTGKVWKLDDFDSYPALLVKCP
                     IYLVCMHSLGQLFGFWSSCFVIRACLATQV"
     gene            complement(88355..94352)
                     /gene="RBCMT"
                     /locus_tag="MA16_Dca015388"
     mRNA            complement(join(88355..89020,89620..89681,89777..89919,
                     90947..91143,93903..94352))
                     /gene="RBCMT"
                     /locus_tag="MA16_Dca015388"
                     /product="Ribulose-1,5 bisphosphate carboxylase/oxygenase
                     large subunit N-methyltransferase, chloroplastic"
     CDS             complement(join(88355..89020,89620..89681,89777..89919,
                     90947..91143,93903..94352))
                     /gene="RBCMT"
                     /locus_tag="MA16_Dca015388"
                     /note="GO_function: GO:0005515 - protein binding [Evidence
                     IEA]"
                     /codon_start=1
                     /product="Ribulose-1,5 bisphosphate carboxylase/oxygenase
                     large subunit N-methyltransferase, chloroplastic"
                     /protein_id="PKU60844.1"
                     /db_xref="InterPro:IPR001214"
                     /translation="MSRYALFLARILRVALLVHDSFRSRRRLRAFKRWMKSQGFVYSD
                     ALEFVDSIDSGISVRALCDLKEGDLVATIPKSSCLTIRTSGISSVIEDAGLGGFLGLA
                     MALMYERSLGAASPWEGYLQLLPERECVPLVWSLEEVDTLLVGTELHKIIIEDKKFLY
                     EDWKEYIEPLIQSRPLEIDPNSFGIEQYFSAKSLIASRSFQIDGYHGSGMVPLADLFN
                     HKTGAENVHFTLTSSSSDSDDDIDTDIFYAFDDEKPSVKNFTNTSVGDPIGTLEMVVV
                     KEVEAGGEVFNTYGSMGNAALLHRYGFTELENPYNIVNIDLYLVLSWFSSSYSNRYVR
                     TRLGLWRKLNYSGCSSQNSEYFEVSSDGEPQMELLILLYIFLSENIYQKLDSVVDSLI
                     EANEDDKMIKLLELIKTDCEHKLEDFREVLLTDNVCQALISLADVRESLYGLTSLQED
                     ISRLLNCCELMESKLYHSLVLRVGERKILAKLRAYARNHFRAVKRRRVRKSARRC"
     gene            98112..99491
                     /locus_tag="MA16_Dca015389"
     mRNA            join(98112..98241,99277..99491)
                     /locus_tag="MA16_Dca015389"
                     /product="hypothetical protein"
     CDS             join(98112..98241,99277..99491)
                     /locus_tag="MA16_Dca015389"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKU60845.1"
                     /db_xref="InterPro:IPR007512"
                     /translation="MAEEELKKSRTALDAKWDACIDLTVRRFAYSSLAGTLAGLLFFR
                     SPITRWASVAFGAGVGIGTAYTECSYLFEGSVPKWTSSKISSVPYGSSQVRNLCLNTY
                     FDHANLILLQSI"
     gene            107593..111378
                     /locus_tag="MA16_Dca015390"
     mRNA            join(107593..107895,108608..108660,109641..109817,
                     111162..111378)
                     /locus_tag="MA16_Dca015390"
                     /product="hypothetical protein"
     CDS             join(107593..107895,108608..108660,109641..109817,
                     111162..111378)
                     /locus_tag="MA16_Dca015390"
                     /note="GO_function: GO:0008080 - N-acetyltransferase
                     activity [Evidence IEA]"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKU60846.1"
                     /db_xref="InterPro:IPR000182"
                     /translation="MAAATGLKAATRFFFHSPGDLLCQICNESSQQRRNPRLRTKRSK
                     AAHLSVAGGEYLVEEFGWGVRRMTVSGDEMRKVADVQAEAFHVPVSFFNDVFFEFFKA
                     EVLSALMYRIRNSPSDRYACLVAESIRAPVLLPETVEGIAGVVDCTVQSDEDVLRHLQ
                     GAEEYLYVSGIAVRSKFRRQKVGTVLLKACDALSQLWGHDYIALRAYEDDLAAKKLYS
                     KAGFKIVSIDPHWITWIGKKKRILMVKSFVL"
     gene            complement(112670..133396)
                     /locus_tag="MA16_Dca015391"
     mRNA            complement(join(112670..112949,113598..113888,
                     115042..115963,116048..116109,116180..116252,
                     118587..118654,118732..118913,121991..122135,
                     122251..122289,123771..123826,124083..124136,
                     124254..124357,124437..124537,124677..124747,
                     125767..125866,130113..130183,130277..130333,
                     131964..132074,133325..133396))
                     /locus_tag="MA16_Dca015391"
                     /product="hypothetical protein"
     CDS             complement(join(112670..112949,113598..113888,
                     115042..115963,116048..116109,116180..116252,
                     118587..118654,118732..118913,121991..122135,
                     122251..122289,123771..123826,124083..124136,
                     124254..124357,124437..124537,124677..124747,
                     125767..125866,130113..130183,130277..130333,
                     131964..132074,133325..133396))
                     /locus_tag="MA16_Dca015391"
                     /note="GO_component: GO:0016021 - integral to membrane
                     [Evidence IEA];
                     GO_function: GO:0004348 - glucosylceramidase activity
                     [Evidence IEA];
                     GO_process: GO:0006665 - sphingolipid metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKU60847.1"
                     /db_xref="InterPro:IPR006775"
                     /db_xref="InterPro:IPR024462"
                     /translation="MFMNGFEKNETDYSEAVEVVDTTTVKMDPGNPPQLAWQRKLTDE
                     GKGITEFTLTMMEKLHLGPMVLKLCHSYITETLKGRSASYNPFKKWEAASSLGVPLGG
                     IGAGSIGRSYKGYFQNWQLFPEVCEESPVLANQFSVFISRPGGKRYSSVLSPRNAQIP
                     RGSRNPGIESWDWNLSGEKSTYHALYPRSWTVYDGEPDPDLKITCRQISPVIPHNYQQ
                     SSYPVAVFTFTLFNSGKTPAEITLLFTWANSVGGSSEVSGNHSNSRIILQDGIRGVLL
                     HHRTANERPPVTFAIGCQETPDVHVSECPYFIISGNAQGFTASDMWEEIIKHGSFDEL
                     NGNETPNPSDPGSSIGAAVAASVTVPAQAVRSVTFALSWACPQVKFINGRTHHRRYTR
                     FYGSSEDAAANLVHDAIIDHGNWEAQIEDWQTPILQDKSLPSWYPTTLFNQLYFLNAG
                     GAIWTDGLPSILNLVSIEERKFHLDPSSLNKKIKTDNIVNNTATSILTNMASLFEGVQ
                     SPMVSKAALGTSLLLEGEENVGQFLYLEGSEYHMFNTYDVHFYSSFSLLMLFPKLELS
                     IQRDFAMAVLMHDPEKIKPIHGHKKVPRKVFGAVPHDIGQNDPWFETNSYNLHDPNKW
                     KDLNPKFVLQVYRDVVATGDKSFAHAVWPSVYIAMAYMDQFDKDGDGMIENDGGPDQT
                     YDMWSAYGVSAYTGGLWVAALQAASVLARLVGDEASEDYFWNRYLKAKSVYSKLWNGS
                     YFNYDSSGYQNSAIQADQLAGHWFAKASGLQPIVDEEKARSALAKIYEFNVLKVMNGK
                     MGAINGIKPNGEIGSLGLQAREIWSGITFAVAATMIQEGMTEQAFKTAQGIHEAAWSS
                     EGFGYAFRIPEALNVKGEYRSLNYMRPLAIWAMQWALHPPKLLELEPRPDNKQIDPSL
                     SNKEFSKIASLLKFPEEKPTPTLLSVFLDIIHELVRRH"
     gene            complement(141311..153744)
                     /locus_tag="MA16_Dca015392"
     mRNA            complement(join(141311..141335,141412..141503,
                     141845..141937,148338..148431,148586..148675,
                     148766..148827,149454..149819,152336..153004,
                     153685..153744))
                     /locus_tag="MA16_Dca015392"
                     /product="hypothetical protein"
     CDS             complement(join(141311..141335,141412..141503,
                     141845..141937,148338..148431,148586..148675,
                     148766..148827,149454..149819,152336..153004,
                     153685..153744))
                     /locus_tag="MA16_Dca015392"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKU60848.1"
                     /translation="MASDVQKTYFEWKHEQEDSQGPSISQMLDHGSISFGKFALETLS
                     WEKRSVFTHNERQEELEKFKSPGLVAKKKAYFEEYYKKVRALKAMQNQQTVLLLEYGA
                     DGSISSQTGDEDEPPFPSTIPNEMPESISEAPLEDLTAEITFEQECSTAFEHEYVASR
                     SVDVATAKEIIEPHSGHCEVKNEENYNNFIQVQISSPLVCSTDPTVSNVVEANFVPVD
                     NPVLEKNKLIVRKPKDGFTSVPMSKGNVTSARHLSKSVNKSLPERIKSSLGSKQLHNI
                     IDKAEVDMPLSKKTSNKVRSYNKSSFVPSHRSPTEVQNKVAIPRPNPLSKERKGVIPN
                     NSSELVLRSRSKVSNSSTSRKFNPKGNLRVQGESRETATQNTIKSRALQSKSVGHEEF
                     KKSLDSRCGSTVKGRAATEQLRTRSINLPSRNIHDTNRVISYQSGSLSGGDNIKKANA
                     STTRKYEGKSSMINTSRQSGNIKVDTYKKQMSTTEKQERPNGVSKSFIGGLPPDGRKS
                     RKENPRWR"
     assembly_gap    160334..160433
                     /estimated_length=100
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            172183..204148
                     /locus_tag="MA16_Dca015393"
     mRNA            join(172183..172307,176259..176310,190324..190387,
                     191341..191384,191540..191638,196127..196184,
                     196303..196355,196485..196586,201431..201496,
                     202404..202525,202626..202797,204047..204148)
                     /locus_tag="MA16_Dca015393"
                     /product="hypothetical protein"
     CDS             join(172183..172307,176259..176310,190324..190387,
                     191341..191384,191540..191638,196127..196184,
                     196303..196355,196485..196586,201431..201496,
                     202404..202525,202626..202797,204047..204148)
                     /locus_tag="MA16_Dca015393"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKU60849.1"
                     /translation="MAAISSIGTASYWGERRSRVPDAKLATGISKVAAVGWSNFLRLQ
                     VVTLAKELRVALKEKVRWNSVADKSVPDPPTAVFIHGSFARRLSQEFPMWQFLLVDLR
                     CHGDSASLKKLDPHSVASAARDVLQLVRQLRITPRVLVGHSFGGKVALSMVEQAAKPL
                     ARPVRVWVLDATPGKVRPGGDGEDHPGELIAFLQRLPRKVSSKQEVVSAIVQEGFSKD
                     VAQWVVTNLRPIENSNSRPVAFSWVFDLNGIADMYKSYETTNIWGIVENVPRGVHMNF
                     LKAERSLHRWALEDLQRIHAAEELASEEGAGVQMHVLEDAGHWVHADNPDGLFKILSK
                     SFKCTVAAKKVLNGLRSQ"
     gene            206495..220068
                     /locus_tag="MA16_Dca015394"
     mRNA            join(206495..207013,209901..210185,210301..210618,
                     212179..212406,214043..214146,214289..214391,
                     217813..218283,219871..220068)
                     /locus_tag="MA16_Dca015394"
                     /product="putative serine/threonine-protein kinase"
     CDS             join(206495..207013,209901..210185,210301..210618,
                     212179..212406,214043..214146,214289..214391,
                     217813..218283,219871..220068)
                     /locus_tag="MA16_Dca015394"
                     /note="GO_function: GO:0004672 - protein kinase activity
                     [Evidence IEA];
                     GO_function: GO:0004713 - protein tyrosine kinase activity
                     [Evidence IEA];
                     GO_function: GO:0005524 - ATP binding [Evidence IEA];
                     GO_process: GO:0006468 - protein phosphorylation [Evidence
                     IEA]"
                     /codon_start=1
                     /product="putative serine/threonine-protein kinase"
                     /protein_id="PKU60850.1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR020635"
                     /translation="MGCFCSKGIEGEKLVHGRRKKPLKRLAASSEKEDTVVTAVGVSL
                     GTESIDRGRERLIPEPEENGINPYPLLLGNGTVKDATTFEKSKKVAVQERWDSRDGWA
                     EQVGLVSVGDEAGDNQQQKQQQQNLVIPSVKNGTIAEHVAAGWPFWLTKVAGEAVKGW
                     LPRKLDSFINMEKIGQGTYSTVYKARDLLTGKIVALKKVRFVNLDPDSVQFMAREIYV
                     LRRLDHPNVIKLEGLVASKMSNSLWLIFPYMEHDLAGLAARPGIKFTHSQVKCFMQQL
                     FNGLNHCHNNGVLHRDIKGANLLLNDDGILKIADFGLATFFSNEPKHPLTSRVVTLWY
                     RPPELLLGAQKYGASVDLWSSGCMLAELLCGKPIMPGRTEVEQLHMIFKLCGSPSEEY
                     WRKSKLPHATIFKPQHPYKSNISQEFRDFPSTAVALLERLLAVDPADRGTSSLALASE
                     FFTVEPIACDPSDLPKFPPSKELDAKKLREVEAGRQREAAKMGNDRESGRKELKNSNG
                     MAILDANAESQRLHKNSRSSSVKHKPREDTSFFFLNDHPRGMTENGFARREGYGLSVS
                     KSSKEDSRHAVPGLLSSNSGKLNSSRSQRSHLTNGKVARFSGLSGPLESSLASTKFPN
                     HRDGHDQSYHSRQLQVSSHNQLDVGNASATYQLFNRRSSSHKRDERGRDLTAAYEHKR
                     NRIMYSGPLMPTVDNIDEMLKEHERQIEQAVRKACIKRKNDKMYGVKSQSETLLLTGR
                     I"
     gene            223210..224100
                     /gene="GXM1"
                     /locus_tag="MA16_Dca015395"
     mRNA            223210..224100
                     /gene="GXM1"
                     /locus_tag="MA16_Dca015395"
                     /product="Glucuronoxylan 4-O-methyltransferase 1"
     CDS             223210..224100
                     /gene="GXM1"
                     /locus_tag="MA16_Dca015395"
                     /codon_start=1
                     /product="Glucuronoxylan 4-O-methyltransferase 1"
                     /protein_id="PKU60851.1"
                     /db_xref="InterPro:IPR021148"
                     /translation="MKAKLSSFLRKMTWSRIQNTLHIKLLLLSLLLLFLFLLLLRPTP
                     SSPPSPAITTTASTSTTTTAPAAACYSKIPESLAETIIHYATSNTTPQQTHAEISVTA
                     RVLRHRSPCRFLVFGLGLDSPMWAGLNHGGRTAFLEEDESWIATVRARFPSLETYHVR
                     YDTRVRDADALMEIGRRPECSSTETTELRGSLCGLALKGLPDVFYDEEWDLIMVDAPT
                     GWIPEAPGRMGAIYTAGMAARGRKAEGETDVFVHDVDRKVEDEFSKEFLCEGYLREQV
                     GRLRHFSIPSYRKKKLPFCP"
     assembly_gap    231401..231500
                     /estimated_length=100
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            231732..231929
                     /locus_tag="MA16_Dca015396"
     mRNA            231732..231929
                     /locus_tag="MA16_Dca015396"
                     /product="hypothetical protein"
     CDS             231732..231929
                     /locus_tag="MA16_Dca015396"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKU60852.1"
                     /translation="MSAEDLASASAAAAAAADEMRRRQEEVYATACRRLAAADARRKR
                     KEMQRLKNSIAAGAPLCSRVR"
     gene            complement(237915..240134)
                     /locus_tag="MA16_Dca015397"
     mRNA            complement(join(237915..238189,238275..238527,
                     238618..238857,239021..239145,239993..240134))
                     /locus_tag="MA16_Dca015397"
                     /product="GDSL esterase/lipase"
     CDS             complement(join(237915..238189,238275..238527,
                     238618..238857,239021..239145,239993..240134))
                     /locus_tag="MA16_Dca015397"
                     /note="GO_function: GO:0016788 - hydrolase activity,
                     acting on ester bonds [Evidence IEA];
                     GO_process: GO:0006629 - lipid metabolic process [Evidence
                     IEA]"
                     /codon_start=1
                     /product="GDSL esterase/lipase"
                     /protein_id="PKU60853.1"
                     /db_xref="InterPro:IPR001087"
                     /translation="MAFFSFPFFLLLLLPFCSPDSSPDGGGQGRKELVPAMFIFGDSL
                     IDNANLLGLPLIPAHSETSTAYELLHGVNYASAAAGILDITGQNFMARIPFNEQIKNF
                     ESTLNQITGNLSADTVARSIGDSIFFIGMGSNDYLNNYLMPNYNTRIQYNPNQFSDLL
                     IQHYSHQLTSLYNLGARKFVLSGVGSLGCIPSILAQNMLTQCSQEIDQSLVHPFNSKM
                     KLMVDRFNQNLTAAKFTYIDTYHIFMEIINNPGTYGFNVTDSGCCGVGRNNGQFTCLP
                     YETPCSNREQYVFWDAFHPTAKVNVLMAKKAFAGGGDVAHPINIEQLAKLKLIQFNNS
                     YSYIEQERGD"
     gene            248050..304124
                     /locus_tag="MA16_Dca015398"
     mRNA            join(248050..248214,248437..248499,250190..250255,
                     250814..250879,250985..251060,251698..251762,
                     251839..251931,252278..252358,252441..252525,
                     252621..252667,253007..253066,253135..253188,
                     257175..257234,257336..257472,262336..262491,
                     263029..263402,269011..269042,269134..269259,
                     281897..281989,282065..282232,286702..286872,
                     291073..291290,291370..291427,292454..292563,
                     292645..292776,294010..294132,294285..294383,
                     294471..294662,294826..295000,295118..295274,
                     301136..301338,302899..303040,303114..303274,
                     303839..303946,304044..304124)
                     /locus_tag="MA16_Dca015398"
                     /product="Sugar transporter ERD6-like 7"
     CDS             join(248050..248214,248437..248499,250190..250255,
                     250814..250879,250985..251060,251698..251762,
                     251839..251931,252278..252358,252441..252525,
                     252621..252667,253007..253066,253135..253188,
                     257175..257234,257336..257472,262336..262491,
                     263029..263402,269011..269042,269134..269259,
                     281897..281989,282065..282232,286702..286872,
                     291073..291290,291370..291427,292454..292563,
                     292645..292776,294010..294132,294285..294383,
                     294471..294662,294826..295000,295118..295274,
                     301136..301338,302899..303040,303114..303274,
                     303839..303946,304044..304124)
                     /locus_tag="MA16_Dca015398"
                     /note="GO_component: GO:0005643 - nuclear pore [Evidence
                     IEA];
                     GO_component: GO:0016020 - membrane [Evidence IEA];
                     GO_component: GO:0016021 - integral to membrane [Evidence
                     IEA];
                     GO_function: GO:0022857 - transmembrane transporter
                     activity [Evidence IEA];
                     GO_function: GO:0022891 - substrate-specific transmembrane
                     transporter activity [Evidence IEA];
                     GO_process: GO:0006810 - transport [Evidence IEA];
                     GO_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="Sugar transporter ERD6-like 7"
                     /protein_id="PKU60854.1"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR007252"
                     /db_xref="InterPro:IPR020846"
                     /translation="MAIDKDIEDWMGSEQNGSVELLIEHGDLKSSKRSIWMILFSTIV
                     VVCGSFIFGSCVGFSAPSQSGIMNDMGLSLSEDVLLLDFGRIFTGFGTGVFSYVVPVF
                     IAEISPKNLRGVLTALNQLMIVGGLSVTYIVGTIVSWRELALIGLIPCLILLLGLFFI
                     PESPRWLAKVGKQELFEESLHRLHGKDADISEEAAEIQDYIETLNRLPRARIVDLFQR
                     KYIRSTIVGVGLMAFQQFGGINGIVFYSSQTFVSAGFSSGNFGTILIGAIQISSSGTF
                     LGCFVGALSFYLREQGVNAEWVSVLTLCGILIYIGSFAMGMGAIPWIIMSEIFPINIK
                     GTAGSLVTLMNWFGSWLISYTFNFLMSWSSWGNIFSGNRCLSSSSSSFSRVAFVRHFS
                     LGSLFEMEADMDTSPSYFNPEDLSSREKYRRYRKRQSTSSTSPLFGNSVSKFSGARLL
                     YEGNIIQRRPNAALLLEEIKQEAESYDLDGLEQSAPKTKYSLKGRESVDDHRLAESNT
                     CYNFAQSSQPVKLLKQEDELLVDGGETTFSLFASLLDSALQGNEELPRDLIMCPSTSH
                     QEACQFVSTNFTAELCLRIVLWLEGLATKALELEKKKQDEALLEDVWILLRAGHIDEA
                     CELCRSAGQPWRASTLCPFGGLDILPSIEAMAKNGKPRLLQAIELDSGIARQLRLWKW
                     ACYCASELGRRRLRRLELAAEVRVENQSDGSSSVGGRVGFEFGEGSTAGGLEEMRSET
                     VQFGRRSACWAMAKSWLDVQVDLHLTSFQRGRDAEKPYGDDTVGISSRGPSAGPETWP
                     DHVVDQQPRDFPSLLQKLHSGEIVHEAVSKACKEQHRQIELTLDYGQMNLMLCDIPYL
                     LDLIWLWISPSEDEQNGLRPHGDPQMIRFGAHLSLLLRYLLDDEMKDAFKEKLMTVGD
                     NILQMYAMFLFSEHHEELVGVYASQITRHYCIDLFVEMMELRLNSSIQIKHKLFRSAI
                     EYLPFSMEDQSKASFKDIIERVLSRSREMKASKYVEKPSDVAEQHRLQSLQKAMAIQW
                     LCFTPPTTVSDFETIRAKLLIRALIHSNILFREFALISMWRIPKMPIGAHMLLSFLAE
                     PLKQPKEALLSFDDYNVLENLHEFEDWREYYSCDATYRSWLKLEWENSAVPPADLSSE
                     EKEMAIVAARETLNSSLSLLLREGTPWLNAIENCPLELTSGIFLDLHAYGMLCLPSGE
                     CLCPDATLCTTLTSALYNSVSEEEALKRQLMVNVSVSLTNNDCLEVSLRCLAIEGDGL
                     GLHESNDGGVLATVMAAGFKGELARFQAGVSLEISRMDAWYSDSDGSFQIPATYVVKG
                     LCRKCCLPEIILRCMQVSVSLAESGESNDHHDELIELVASGMLRLFSQQQLQEFLLFE
                     RHCSLYKMELREEEPSAVDD"
     assembly_gap    277266..281379
                     /estimated_length=4114
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            complement(307247..349668)
                     /gene="APC2"
                     /locus_tag="MA16_Dca015399"
     mRNA            complement(join(307247..307369,307457..307525,
                     309353..309532,321387..321468,321545..321633,
                     321822..321941,328205..328284,328369..328483,
                     328645..328846,328982..329398,332738..332976,
                     334333..334404,334579..334856,345605..345836,
                     348143..348229,349456..349668))
                     /gene="APC2"
                     /locus_tag="MA16_Dca015399"
                     /product="Anaphase-promoting complex subunit 2"
     CDS             complement(join(307247..307369,307457..307525,
                     309353..309532,321387..321468,321545..321633,
                     321822..321941,328205..328284,328369..328483,
                     328645..328846,328982..329398,332738..332976,
                     334333..334404,334579..334856,345605..345836,
                     348143..348229,349456..349668))
                     /gene="APC2"
                     /locus_tag="MA16_Dca015399"
                     /note="GO_component: GO:0031461 - cullin-RING ubiquitin
                     ligase complex [Evidence IEA];
                     GO_function: GO:0031625 - ubiquitin protein ligase binding
                     [Evidence IEA];
                     GO_process: GO:0006511 - ubiquitin-dependent protein
                     catabolic process [Evidence IEA]"
                     /codon_start=1
                     /product="Anaphase-promoting complex subunit 2"
                     /protein_id="PKU60855.1"
                     /db_xref="InterPro:IPR001373"
                     /db_xref="InterPro:IPR014786"
                     /db_xref="InterPro:IPR016158"
                     /translation="MLVDPTILDSLSEQTIGEILQSWIAFVSCTEILLGGSGDLSAAS
                     ELASSVTILCRNGLRSLLEDHFLQYLEDTFMARAVLKFWRHFDKYSDVLRLDLQNQIL
                     VDQLHEELCSSLEEMCSEKNYQEKCLVMLIHALQLYEESIATGKINSGHYESNLLSRY
                     QLMVSSVLLTTLPSHFPEVLRLYFKHKLEELNTMIAVNYKDGMESLNNDRNLKYNVPD
                     EMNIDGSHPESAVSKNYTLVKCIGKVVLDLRNLGFTALTEDAYASSIIQLLKAKVQNL
                     AVDDYRTPVLQSIKEWIQAVPLQFLHALLCYLGDSFDNDVSSGPISPLASRPLSYPGI
                     DAPSEGLVRWQLRLEYFAYEKLQDLRIGKLFEIIVDYPDSSPAIEDLKQCLEYTGQHS
                     KLVDSFISSLRYRLLTAGASTNDILHQYVSTIKALRTIGPTGVFLEAVGEPIRDYLRG
                     RKDTIKCIVTMLTDGSGINPSGMGNTGDSLLEELNREAENQETADTDDDINVDDKQAW
                     INAERWEPDPIEADPLRGSRQRGKIDILEMLVSIIGSKDQLVNEYRVMLAEKLLNKSD
                     YDIDSEIRTLELLKIHFGESSMQKCEIMVNDLISSKRMNANIKASKSQLAMNGSEQGE
                     SMSLDLVDATIISSNFWPPIQEESLHLPLPVQQLLSDYAERFHEIKTPRKLLWKKYLG
                     IVKLELHFDDRNVEFSVTPLHAAIIMQFQEKTSWASKSLAAAVGLPVDILNRRMSFWM
                     SKGVITDTGGADSSERVFTLVDDLTDTNRNGISNETEGMDEEGESSVASVEEQLQKEM
                     TIYQKFIEGMLTNFGGMPLDRIHNTLKMFCVAEPTYDKSLQELQSFLSVLRAEEKLDL
                     RDGHYYLKK"
     assembly_gap    338078..338225
                     /estimated_length=148
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            complement(353111..353863)
                     /locus_tag="MA16_Dca015400"
     mRNA            complement(353111..353863)
                     /locus_tag="MA16_Dca015400"
                     /product="Putative AC9 transposase"
     CDS             complement(353111..353863)
                     /locus_tag="MA16_Dca015400"
                     /codon_start=1
                     /product="Putative AC9 transposase"
                     /protein_id="PKU60856.1"
                     /translation="MRDIGQLILQTNYESSISMTDSKFDQSEFHDMFIACIIMHDLSF
                     QCVEWVEVRALLTYLRRDLQLFSRNTARSDCMKLFIKEKSNIRSQLANLTSRVCLTSD
                     LWTSINTDDFICLTMHFIDKDWHLQKKIISFYLMPPPHDSISLFEKLQSFVMEWKIDT
                     KFFSITLANVSANNTLIEFLRNHLCLRGALFCDGEFFHIRCTAHIVNLIVQDGLKEVN
                     LSVIKIRESIKYVKDSQVRKQKFVDCIKQSCL"
     gene            362184..363484
                     /locus_tag="MA16_Dca015401"
     mRNA            join(362184..362319,363246..363484)
                     /locus_tag="MA16_Dca015401"
                     /product="hypothetical protein"
     CDS             join(362184..362319,363246..363484)
                     /locus_tag="MA16_Dca015401"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKU60857.1"
                     /translation="MKYMGEGPGRTKSTKRSREMSRGDVRGLWWRHLVLFTAIALQLI
                     PGLGDNPSTSKDAGANEYSKSNGSTGRVILLIFLGLVAFVALSVVIFKIWQKKKRREQ
                     YARLLRLFEEDDELELELGLRD"
     gene            373655..386001
                     /gene="AGL5"
                     /locus_tag="MA16_Dca015402"
     mRNA            join(373655..373836,378941..379070,382754..382818,
                     383073..383172,383512..383553,383667..383708,
                     385837..386001)
                     /gene="AGL5"
                     /locus_tag="MA16_Dca015402"
                     /product="Agamous-like MADS-box protein AGL5"
     CDS             join(373655..373836,378941..379070,382754..382818,
                     383073..383172,383512..383553,383667..383708,
                     385837..386001)
                     /gene="AGL5"
                     /locus_tag="MA16_Dca015402"
                     /note="GO_component: GO:0005634 - nucleus [Evidence IEA];
                     GO_function: GO:0003677 - DNA binding [Evidence IEA];
                     GO_function: GO:0003700 - sequence-specific DNA binding
                     transcription factor activity [Evidence IEA];
                     GO_function: GO:0046983 - protein dimerization activity
                     [Evidence IEA];
                     GO_process: GO:0006355 - regulation of transcription,
                     DNA-dependent [Evidence IEA]"
                     /codon_start=1
                     /product="Agamous-like MADS-box protein AGL5"
                     /protein_id="PKU60858.1"
                     /db_xref="InterPro:IPR002100"
                     /db_xref="InterPro:IPR002487"
                     /translation="MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEIA
                     LIVFSSRGRLYEYSNSRRRSAGAGGRANAVQIAIGSPAYAERVKAEMQGGDQGRVYRA
                     TYQYYQQEAAKLRHQIQILHNTNRHLMGEGLTSLSIKELKQLESRLERGITRIRSKKH
                     EMLFAEIEFMQKREEDLQNENMYLRAKITENERQANIATTASALDTLSTFDSRNYYSV
                     NMLEAAANYHNQDQTALHLGYDN"
     gene            complement(389009..391459)
                     /gene="LHCB5"
                     /locus_tag="MA16_Dca015403"
     mRNA            complement(join(389009..389269,389342..389476,
                     389562..389670,389791..389841,391058..391142,
                     391240..391459))
                     /gene="LHCB5"
                     /locus_tag="MA16_Dca015403"
                     /product="Chlorophyll a-b binding protein CP26,
                     chloroplastic"
     CDS             complement(join(389009..389269,389342..389476,
                     389562..389670,389791..389841,391058..391142,
                     391240..391459))
                     /gene="LHCB5"
                     /locus_tag="MA16_Dca015403"
                     /note="GO_component: GO:0016020 - membrane [Evidence IEA];
                     GO_process: GO:0009765 - photosynthesis, light harvesting
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Chlorophyll a-b binding protein CP26,
                     chloroplastic"
                     /protein_id="PKU60859.1"
                     /db_xref="InterPro:IPR001344"
                     /db_xref="InterPro:IPR022796"
                     /translation="MASLATAAAAPAALGHSEMFGISLGSITTVRAAAPPSSSASGSK
                     IVALFSKKAPAKSKAVPASPVSEELAKWYGPDRRIFLPEGLLDRSDVPEYLTGEVPGD
                     YGYDPFGLSKKPADFAKYQAFELIHARWAMLGAAGFIIPEAFNKFGANCGPEATGALL
                     LDGNTLNYFGKNIPINLVLAVAAEVILVGGAEYYRITNGLNLEDKLHPGGPFDPLGLA
                     NDPDQAALLKVKEIKNGRLAMFAMLGFFLQAYVTGEGPVENLAKHLSDPFGNNLLTVI
                     SGSVERAPTL"
     gene            399075..399818
                     /locus_tag="MA16_Dca015404"
     mRNA            399075..399818
                     /locus_tag="MA16_Dca015404"
                     /product="hypothetical protein"
     CDS             399075..399818
                     /locus_tag="MA16_Dca015404"
                     /note="GO_function: GO:0008168 - methyltransferase
                     activity [Evidence IEA];
                     GO_process: GO:0008152 - metabolic process [Evidence IEA]"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKU60860.1"
                     /db_xref="InterPro:IPR013216"
                     /translation="MPTTKPLVKPFLFLLCLSLLFLLSLLLSRSPLNPNLTRQVLLSS
                     SSSSLLKIRPGFRSYDDYLKLQLNKTLNPRLRRVWATRDWNRKISVFSRFFAELRQSG
                     FLSDTSRALCVGARMGQEVAALKSVGVADSIGMDLVPSPPLVVQGDFHSQPFANSSFD
                     FEFSNVFDHALYPERFSREIERTLRPGGVCVLHVAVARRGDRYSANDLYGIEGVTSLF
                     KDSDLVRVRKVDGFGLDTELVLRKKNRSR"
     gene            complement(401188..404256)
                     /gene="PER47"
                     /locus_tag="MA16_Dca015405"
     mRNA            complement(join(401188..401585,403611..403776,
                     403855..404043,404125..404256))
                     /gene="PER47"
                     /locus_tag="MA16_Dca015405"
                     /product="Peroxidase 47"
     CDS             complement(join(401188..401585,403611..403776,
                     403855..404043,404125..404256))
                     /gene="PER47"
                     /locus_tag="MA16_Dca015405"
                     /note="GO_function: GO:0004601 - peroxidase activity
                     [Evidence IEA];
                     GO_function: GO:0020037 - heme binding [Evidence IEA];
                     GO_process: GO:0006979 - response to oxidative stress
                     [Evidence IEA];
                     GO_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Peroxidase 47"
                     /protein_id="PKU60861.1"
                     /db_xref="InterPro:IPR000823"
                     /db_xref="InterPro:IPR002016"
                     /translation="MDYYAFSCPSAESMVMNTVFQALNKDPTLAAGLLRMHFHDCFIQ
                     GCDGSVLIDSTKDNTAEKDSPANLSLRGFEIIDDAKNLLEDWCPGMVSCADILAMAAR
                     DSVFFKAGGPAYDIPTGRKDGRRSRIEDTINLPQPSFNASSLIRIFGQHGFSAQEMVV
                     LSGGHTLGVARCSSFKNRLSQFDPTHQQDPSLDPSFAKFLSQKCLAGDNTAVAFDASP
                     NIFDNNYFNTIQRGAGLLFSDQALFNSPMIRGLVNLYSMDRALFSFDFQQALVKMGLL
                     DVKEDDEGEIRLNCHRIN"
     gene            complement(407215..427797)
                     /locus_tag="MA16_Dca015406"
     mRNA            complement(join(407215..407499,407666..407792,
                     426325..426553,427513..427545,427698..427797))
                     /locus_tag="MA16_Dca015406"
                     /product="PHD finger protein ALFIN-LIKE 8"
     CDS             complement(join(407215..407499,407666..407792,
                     426325..426553,427513..427545,427698..427797))
                     /locus_tag="MA16_Dca015406"
                     /note="GO_function: GO:0005515 - protein binding [Evidence
                     IEA];
                     GO_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     GO_function: GO:0042393 - histone binding [Evidence IEA];
                     GO_process: GO:0006355 - regulation of transcription,
                     DNA-dependent [Evidence IEA]"
                     /codon_start=1
                     /product="PHD finger protein ALFIN-LIKE 8"
                     /protein_id="PKU60862.1"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="InterPro:IPR021998"
                     /translation="MEGGGAAYNPRTPEEVFRDFRGRRAGIVKALTTDMEKFYELCDP
                     EKENLCLYGNPNETWEVALPAEEVPPELPEPALGINFARDGMDEKDWLSLVAVHSDSW
                     LLAVAFYFGARFGFDKESRKRLFTMINNLPTIYEVVTGTVKKQSKEKTPNSSSKSNKS
                     SSKVTCFQSQLQTEVSRAPQKDFDESGEDDDEEEDEDEHGNTLCGACGDNYASDEFWI
                     CCDVCERWFHGKCVKITPARAEHIKQYKCPACSNKRARA"
     gene            429574..436206
                     /locus_tag="MA16_Dca015407"
     mRNA            join(429574..429935,433376..433487,433575..433668,
                     434589..434766,434838..434907,435895..436206)
                     /locus_tag="MA16_Dca015407"
                     /product="hypothetical protein"
     CDS             join(429574..429935,433376..433487,433575..433668,
                     434589..434766,434838..434907,435895..436206)
                     /locus_tag="MA16_Dca015407"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKU60863.1"
                     /db_xref="InterPro:IPR000073"
                     /translation="MAHLPAIFLLQKSPAIPLLSFCSPLFPSLPSSSTSSSSPLHTLS
                     TYRIGNVRLGAFRAKIAAGSGSVAPTLPELSGGLKDIYKCCSIWRWKGYSVNFFVKGT
                     GPPLLLVHGFGASIAHWRRNIGVLSENYTVYAIDLLGFGSSDKPLGFSYTMEVWSQLI
                     LDFLSEIIKKPTVLIGNSVGSLTCVIAASEATQGMVRGIVLLNCAGGMNNKAIVDDWR
                     IRLILPLFWLIDLLLKQRSIASAIFENVKKRENLKNILLSVYGNKESVDEDLIAIIKN
                     PADDVGALDAFISIVTGPPGPNPVSLMPKVTVPVLLLWGDKDPFTPIDGPVGKYFSSL
                     PSQLSNVNLYLLEGVGHCPHDDRPDLVHEKLLPWLAALPAL"
     gene            complement(438105..447657)
                     /locus_tag="MA16_Dca015408"
     mRNA            complement(join(438105..438173,440322..440405,
                     440484..440570,441174..441281,441347..441421,
                     441820..441954,443348..443452,443553..443678,
                     444785..444991,445089..445215,445476..445552,
                     445719..445760,446101..446142,446253..446319,
                     446466..446581,446812..446941,447252..447355,
                     447469..447524,447600..447657))
                     /locus_tag="MA16_Dca015408"
                     /product="putative phenylalanine--tRNA ligase beta
                     subunit"
     CDS             complement(join(438105..438173,440322..440405,
                     440484..440570,441174..441281,441347..441421,
                     441820..441954,443348..443452,443553..443678,
                     444785..444991,445089..445215,445476..445552,
                     445719..445760,446101..446142,446253..446319,
                     446466..446581,446812..446941,447252..447355,
                     447469..447524,447600..447657))
                     /locus_tag="MA16_Dca015408"
                     /note="GO_function: GO:0000287 - magnesium ion binding
                     [Evidence IEA];
                     GO_function: GO:0003723 - RNA binding [Evidence IEA];
                     GO_function: GO:0004826 - phenylalanine-tRNA ligase
                     activity [Evidence IEA];
                     GO_function: GO:0005524 - ATP binding [Evidence IEA];
                     GO_process: GO:0006432 - phenylalanyl-tRNA aminoacylation
                     [Evidence IEA]"
                     /codon_start=1
                     /product="putative phenylalanine--tRNA ligase beta
                     subunit"
                     /protein_id="PKU60864.1"
                     /db_xref="InterPro:IPR005146"
                     /db_xref="InterPro:IPR005147"
                     /translation="MPTVSVGRDCLFQALGRSYTQEEFEELCFEFGIELDDVTTEKEI
                     IRKEKHLETEVGGEDEEEVIYKIEVAANRYDLLCLEGIARALRIFIGKEEIPIYKFRE
                     IPRESMLQINVSKATSQIRPYVVGAVLRGVSFNRANYNSFIDLQDKLHQNICRKRTRV
                     AIGTHDLDTIDTPFSYEALIPQDITFIPLKQVKSFRADELLEFYKSDLKLKKFLHIIE
                     NSPVYPVIYDRNRTVLSLPPIINSAHSALSLRTKNVFIECTATDLTKAKIVLNTMVTM
                     FSEYCDSKFEVEPVEVVYPDDRQFEDCTSEGIFKGKNIYPDLAVTVMDIPLSVITCPI
                     GVTLGVAEVIPLLNKMQLHAKEKLVTGNNVITVHVPPTRSDILHPCDVMEDVAIAYGY
                     DKIPRTKPKCIGGQQPLNVFSDKIRGEVSSAGYMEVLTWLLCSHEENFAMVKRKDDGA
                     KAVTIENPRSSEFEVVRTSLLPGLLKTLKHNIDHRRPIKIFEVGDVVCLDGTRDVGAS
                     NNRRLAALYCNVTSGFEEILGLVMRIMQVVRKPHEPANDNFIRPSNEPEFFPNRQCYI
                     IFKDKQIGAFGVVHPEVLEKFGIPDPCSFVEIDIQALL"
     gene            454531..482063
                     /gene="MLO1"
                     /locus_tag="MA16_Dca015409"
     mRNA            join(454531..454659,454745..454802,454917..455107,
                     455845..455961,456063..456117,456219..456310,
                     466769..466843,466983..467071,467274..467323,
                     479806..479846,480408..480617,480697..480764,
                     481652..481712,481800..482063)
                     /gene="MLO1"
                     /locus_tag="MA16_Dca015409"
                     /product="MLO-like protein 1"
     CDS             join(454531..454659,454745..454802,454917..455107,
                     455845..455961,456063..456117,456219..456310,
                     466769..466843,466983..467071,467274..467323,
                     479806..479846,480408..480617,480697..480764,
                     481652..481712,481800..482063)
                     /gene="MLO1"
                     /locus_tag="MA16_Dca015409"
                     /note="GO_component: GO:0016021 - integral to membrane
                     [Evidence IEA];
                     GO_process: GO:0006952 - defense response [Evidence IEA]"
                     /codon_start=1
                     /product="MLO-like protein 1"
                     /protein_id="PKU60865.1"
                     /db_xref="InterPro:IPR004326"
                     /translation="MEEGEAEGAIKLEFTPTWIVAVVCSIIVFISLIVERLLHYLGKF
                     LRRKSQKSLFEALQKVKEELMLLGFISLLLTVFQGTIVKICISKEWTGHLLPCKEDSS
                     ADLVRPTGGKRRLLSSRESYCDAKYEVPLLSVEALHQLHIFIFVLAITHVVYSVLTMV
                     LAGLKIREWKHWEDSIKKNDSGSVPRTIAHVHQFEFIRDHFMGIGKDSEILSWLHSFG
                     KQFYGSVSKSDYTTMRLGFIMTHCGSNPKFNFHKYMVRALEADFKKVVGISWYLWIFV
                     VVFLLLNVSGWHTYFWIAFIPLILLLAVGTKLEHVISQLAHEVAEKHSAIEGDLVVKP
                     SDDHFWLHRPKIVLYLIHFILFQNAFEISFFFWILTTYGSNSCIMERMRYIVPRLVIG
                     LIIQILCSYSTLPLYAIVTQMGSSFKKAIFEEHVQLSLIGWAHKVRKRKVHRGSEASS
                     TRSGSVGSKDQSSRGAHLQKLDQDDLNEDGRVEPQTKSSTPLNTGPKSV"
     assembly_gap    463643..463790
                     /estimated_length=148
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     assembly_gap    468660..468759
                     /estimated_length=100
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            complement(486456..511064)
                     /locus_tag="MA16_Dca015410"
     mRNA            complement(join(486456..486509,487784..487858,
                     487934..488144,488303..488427,488709..488810,
                     488943..489005,489081..489161,493548..493659,
                     503527..503699,503801..503908,509659..509742,
                     510109..510171,510978..511064))
                     /locus_tag="MA16_Dca015410"
                     /product="hypothetical protein"
     CDS             complement(join(486456..486509,487784..487858,
                     487934..488144,488303..488427,488709..488810,
                     488943..489005,489081..489161,493548..493659,
                     503527..503699,503801..503908,509659..509742,
                     510109..510171,510978..511064))
                     /locus_tag="MA16_Dca015410"
                     /note="GO_function: GO:0005093 - Rab GDP-dissociation
                     inhibitor activity [Evidence IEA];
                     GO_process: GO:0015031 - protein transport [Evidence IEA]"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKU60866.1"
                     /db_xref="InterPro:IPR000806"
                     /db_xref="InterPro:IPR018203"
                     /translation="MDEEYDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGEST
                     SLNLIQLWKRFRGSDKPPAHLGPSRDYNVDMIPKFMMANGTLVRVLIHTDVTKYLSFK
                     AVDGSYVYNKGKVHKVPATDMEALKSPLMGLFEKRRARKFFIYVQDYDETDPKTHEGL
                     DLTRLSTKELIAKYGLDDNTVDFIGHALALHRDDKYLDEPALDTVKRMKLYAESLARF
                     QGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEEGKVCGVTSEGETA
                     RCKKLVCDPSYLPNRVRKVGKVARAIAFMSHPIPNTNDSHSVQVILPQKQLGRKSDMY
                     LFCCSYTHNVAPKGKFIAFVSTEAETDRPELELKPGIDLLGPVDELFFDTYDRFEPVN
                     EPSLDNCFISTSYDDTTHFESTVMDVLSMYRMITGKDVDLSVDLSAASAAQEY"
     assembly_gap    526763..526862
                     /estimated_length=100
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            complement(546961..547905)
                     /locus_tag="MA16_Dca015411"
     mRNA            complement(546961..547905)
                     /locus_tag="MA16_Dca015411"
                     /product="Desiccation protectant protein Lea14"
     CDS             complement(546961..547905)
                     /locus_tag="MA16_Dca015411"
                     /note="GO_process: GO:0009269 - response to desiccation
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Desiccation protectant protein Lea14"
                     /protein_id="PKU60867.1"
                     /db_xref="InterPro:IPR004864"
                     /db_xref="InterPro:IPR013990"
                     /translation="MASSENMKVEREITERGHKDEERNEENGGFMDKIKDFIHDIGEK
                     IEGAVRFGKPTADFKAVHLPSINLHKADLVVDVLVSNPNPIPIPLVDIDYSVESDGRK
                     LVSGLIPDAGTIHAHGSENVKIPVTLIFHDIKSTYDDIKPGSVIPYRVKIALLVDVPI
                     FGRLTLPLEKKGEIPVPYKPDVDIQKIHFGKFSLEETVATLHLKIENNNDFELSLNKL
                     ECEIWLSDVSIGSVELYKSIKIAKKGISRIQIPMTFRPKDLGSAIWDMIRRRGTRYSI
                     KGNIDVDTPFGPMKLPISKEGGKTHLKKGEEEEDDDEV"
     gene            complement(552382..552889)
                     /locus_tag="MA16_Dca015412"
     mRNA            complement(join(552382..552521,552579..552708,
                     552857..552889))
                     /locus_tag="MA16_Dca015412"
                     /product="hypothetical protein"
     CDS             complement(join(552382..552521,552579..552708,
                     552857..552889))
                     /locus_tag="MA16_Dca015412"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKU60868.1"
                     /translation="MVWRSLGPQVVSGEGEGLKWLSGEGEVLKWWSGESEGLSRWSGE
                     GDGLRWWSGEELRRWSRRSFFFLFLLFSSSLIFFLLGSPFKRNEESIYRFLEWHGP"
     gene            562878..567089
                     /gene="BT1"
                     /locus_tag="MA16_Dca015413"
     mRNA            join(562878..563005,566509..566820,566939..567089)
                     /gene="BT1"
                     /locus_tag="MA16_Dca015413"
                     /product="BTB/POZ and TAZ domain-containing protein 1"
     CDS             join(562878..563005,566509..566820,566939..567089)
                     /gene="BT1"
                     /locus_tag="MA16_Dca015413"
                     /note="GO_component: GO:0005634 - nucleus [Evidence IEA];
                     GO_function: GO:0003712 - transcription cofactor activity
                     [Evidence IEA];
                     GO_function: GO:0004402 - histone acetyltransferase
                     activity [Evidence IEA];
                     GO_function: GO:0008270 - zinc ion binding [Evidence IEA];
                     GO_process: GO:0006355 - regulation of transcription,
                     DNA-dependent [Evidence IEA]"
                     /codon_start=1
                     /product="BTB/POZ and TAZ domain-containing protein 1"
                     /protein_id="PKU60869.1"
                     /db_xref="InterPro:IPR000197"
                     /translation="MSPVLARVLNLPNKRWKSEKVIRILGVPNEAVLAFVRLLHAGWE
                     KQSRRNMEEQKTYQQLSEAMECLEHIFKEGCTDIKPDRRRRSSCSCPPLDACQPLQLL
                     LLHFSKCDGNRATCSRCRRIWQLLKLHSSICMAQDSSSCKVPLCRQFKYKMQKMEEKL
                     EERKWMVLGKKVASVVAFSSFAKRKRYESGRDLGPE"
     assembly_gap    568780..568879
                     /estimated_length=100
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            complement(585050..587186)
                     /gene="SEN102"
                     /locus_tag="MA16_Dca015414"
     mRNA            complement(join(585050..585301,585756..585896,
                     585988..586220,586736..587186))
                     /gene="SEN102"
                     /locus_tag="MA16_Dca015414"
                     /product="Thiol protease SEN102"
     CDS             complement(join(585050..585301,585756..585896,
                     585988..586220,586736..587186))
                     /gene="SEN102"
                     /locus_tag="MA16_Dca015414"
                     /note="GO_function: GO:0008234 - cysteine-type peptidase
                     activity [Evidence IEA];
                     GO_process: GO:0006508 - proteolysis [Evidence IEA]"
                     /codon_start=1
                     /product="Thiol protease SEN102"
                     /protein_id="PKU60870.1"
                     /db_xref="InterPro:IPR000668"
                     /db_xref="InterPro:IPR013128"
                     /db_xref="InterPro:IPR013201"
                     /translation="MKLFHLLLAFLFLAAAASAIDIIEKDLETEDSLWSLYERWRSHH
                     TVSRDLDEKKKRFNVFKENARYIHEFNKRKDAPYKLHLNKFADLTNQEFRSAYAGSRI
                     NHHRALRSPRRGVANSFTYKSLDVNSLPASVDWRQKGAVTAVKDQGQCGSCWAFSTVA
                     AVEGINQIKTKKLVSLSEQELIDCDTKENNGCNGGLMDYAFEFIKNKGGITSEAAYPY
                     AEADGSCAAEKSNPVVSIDGHEDVPANDEDSLLKAVANQPVSIAIEASGSDFQFYSEG
                     VFTGKCGTDLDHGVAIVGYGTAQKGTKYWIVRNSWGPEWGEKGYIRMLRGSSDPQGLC
                     GLAMEASYPIKSSPNPTHKPKDEL"
     gene            complement(592793..595056)
                     /gene="SEN102"
                     /locus_tag="MA16_Dca015415"
     mRNA            complement(join(592793..593044,593146..593286,
                     594284..594516,594609..595056))
                     /gene="SEN102"
                     /locus_tag="MA16_Dca015415"
                     /product="Thiol protease SEN102"
     CDS             complement(join(592793..593044,593146..593286,
                     594284..594516,594609..595056))
                     /gene="SEN102"
                     /locus_tag="MA16_Dca015415"
                     /note="GO_function: GO:0008234 - cysteine-type peptidase
                     activity [Evidence IEA];
                     GO_process: GO:0006508 - proteolysis [Evidence IEA]"
                     /codon_start=1
                     /product="Thiol protease SEN102"
                     /protein_id="PKU60871.1"
                     /db_xref="InterPro:IPR000668"
                     /db_xref="InterPro:IPR013128"
                     /db_xref="InterPro:IPR013201"
                     /translation="MKLLYLLSALLFLAATASAIDIVEKDLETDDSLWSLYERWRSHH
                     TVSRDLDEKKKRFNVFKENARYIHEFNKRKDATYKLSLNKFADLTNQEFRSTYASSRI
                     NHHRALRGSRRGGDLFMYESLDIHSLPASVDWRQKGAVAPVKDQGQCGSCWAFSTVAA
                     VEGINQIKTKKLIPLSEQELIDCDTEQNSGCNGGLMDYAFEYIQKNGGITSEAAYPYA
                     AEDGSCAVEKSAHVVSIDGHQDVPANDENSLLKAVANQPVSIAIEASGFGFQFYSEGV
                     FTGRCGTDLDHGVAIVGYGKTQQGTKYWIVRNSWGADWGEGGYIRMHRGISDRKGLCG
                     LAIEPSYPIKTSPNPTDKRRDEL"
     gene            complement(608067..611197)
                     /gene="TE1"
                     /locus_tag="MA16_Dca015416"
     mRNA            complement(join(608067..608435,608524..608665,
                     609442..609564,609662..610084,610177..610342,
                     610549..611197))
                     /gene="TE1"
                     /locus_tag="MA16_Dca015416"
                     /product="Protein terminal ear1"
     CDS             complement(join(608067..608435,608524..608665,
                     609442..609564,609662..610084,610177..610342,
                     610549..611197))
                     /gene="TE1"
                     /locus_tag="MA16_Dca015416"
                     /note="GO_function: GO:0003676 - nucleic acid binding
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Protein terminal ear1"
                     /protein_id="PKU60872.1"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR007201"
                     /translation="MERGFSGNLLDPSALEFYPANQFGSVPAQIYFPYPPPPPPPPPP
                     LPPPAAYHPNLQLHHPLPDDGEPTRAVILSLLPPHIDEASVMAAMEAFGAVRSLDSAS
                     LTSDGSATVHFYDLRSAIAAVFEIRDQHMRQQSFLSRQYGVVPANWGVVEWPSVATDL
                     SFSAASAGGRGLVAGQAVWAQFGSRGVDGPNQGSLFISNCDPTLPSAYLAQLFGSLGD
                     VKEVKETIWKPQQRFIEYYDIRDAARAVSELNGKEVYGRRLVVEFSCAAGLTKRRSTG
                     RQSRSFGQPPPRLLRTASPQSGRWVAAANPLSSSSSERGSNRKVGKSGREDKRGKGRQ
                     EQTALTTTAASCSSSSSSSIVVAKQQQLSSRGWKNHSRNGGDSRFQFKETMTMEEGSS
                     PTCIMDSRTTVMIKNIPNKYSQMLLLRMLDNHCIRCNEEIGERGEEEPFSAYDFVYLP
                     IDFNNKCNVGYGFVNLTSPEAAVRLHRAFHMQPWEVFNSRKICQVNYARLQGLEALKE
                     HFKNSKFACDTDEYMPVVFCPPRDGKQMTEPVPVGGRGLMRRSLNLDRTCGGVGETEP
                     EPSDPGEAASSTTASTHAPSDNGDGVDDDRDDGDGDGDETASGLSQALLQLSYSSQS"
     gene            complement(625296..633592)
                     /gene="YMF40"
                     /locus_tag="MA16_Dca015417"
     mRNA            complement(join(625296..627529,633232..633592))
                     /gene="YMF40"
                     /locus_tag="MA16_Dca015417"
                     /product="putative mitochondrial protein ymf40"
     CDS             complement(join(625296..627529,633232..633592))
                     /gene="YMF40"
                     /locus_tag="MA16_Dca015417"
                     /note="GO_function: GO:0003723 - RNA binding [Evidence
                     IEA];
                     GO_function: GO:0003964 - RNA-directed DNA polymerase
                     activity [Evidence IEA];
                     GO_process: GO:0006278 - RNA-dependent DNA replication
                     [Evidence IEA];
                     GO_process: GO:0006397 - mRNA processing [Evidence IEA]"
                     /codon_start=1
                     /product="putative mitochondrial protein ymf40"
                     /protein_id="PKU60873.1"
                     /db_xref="InterPro:IPR000477"
                     /db_xref="InterPro:IPR024937"
                     /translation="MSDRRNGGEDESSRGELDKLIPRNRGPRDHEEEEEEEDGIQCEK
                     TKLLLEISENQRKESDEEKQKQVSFHGNQKKVRSKVKRILLTPFRQFNKHREGKKKKA
                     ADRRCCKAPFPYDGEDFGGLGFRRILHSKISPFVFFQIARSVSGNRASKPSPDIESLV
                     LRQYRDGKFRDLFRAAISEPSFLLSACQNLCLEEIPPSADSINRFISIEDIAFDLREG
                     RLDVESLCVKLLPSRKKGTHLVLPNLKLKVVIEAVRMALEIIYEKRFATFAYGGRVGK
                     GRHTAVRYLKAAVENPNWWFRVPFRRQALDLCRLKAALAEKIEDDALIGFIERLFTSE
                     AVVIELGGLDLGRGFPQESSLNSILVNIYFDGLDQEIQEIRAQIHRGNPKLRNLEKAE
                     NSLVFHKPVRVYAVRYLDEALIVTSGSKLLTIDIKNRIFKYVEGNMNLKVDKLKAHIH
                     SAVSEKMDFLGMELQAVSPLVLHPPLSEKAMRAKKKHLKQKAAKALELKNARETIRKK
                     LGLKIMKHVFKKLKRVGGFKIDLPVEGEVRELFRTWAEEVVVEYLKSKEDCYHWHKML
                     TYGNFLSLKRVRDQLPESLVDAYDQFQEKLNKHLMPERASKHVEDNEMVEKDEEKRYA
                     KRTVEDLIELCMRVNAPIELVRRAIKLAGFTNSMGRPRPIKLLICLDDSDIIKWYAGV
                     ARSWLDFYCCCRNFKMVKTVVSYHLRFSCLLTLAEKHESTKSQAIQHYTKDLRIIGEN
                     GMEEVYFATEKEIKMLGDRNLSDPKPVDGAITMVLVRLAIDEHSPVCLAHFCESTNNT
                     IYRVRLLQNRLNVDPLKEDKWVPGMGAIHEALNRKCLPLCSKHATNLFIGNICLQDID
                     CTSFLNAD"
     gene            645099..651171
                     /gene="AFC2"
                     /locus_tag="MA16_Dca015418"
     mRNA            join(645099..645194,647911..648097,648762..648788,
                     648971..649124,649221..649269,649362..649476,
                     649755..649854,649978..650105,650199..650263,
                     650350..650447,650846..650948,651022..651171)
                     /gene="AFC2"
                     /locus_tag="MA16_Dca015418"
                     /product="Serine/threonine-protein kinase AFC2"
     CDS             join(645099..645194,647911..648097,648762..648788,
                     648971..649124,649221..649269,649362..649476,
                     649755..649854,649978..650105,650199..650263,
                     650350..650447,650846..650948,651022..651171)
                     /gene="AFC2"
                     /locus_tag="MA16_Dca015418"
                     /note="GO_function: GO:0004672 - protein kinase activity
                     [Evidence IEA];
                     GO_function: GO:0004713 - protein tyrosine kinase activity
                     [Evidence IEA];
                     GO_function: GO:0005524 - ATP binding [Evidence IEA];
                     GO_process: GO:0006468 - protein phosphorylation [Evidence
                     IEA]"
                     /codon_start=1
                     /product="Serine/threonine-protein kinase AFC2"
                     /protein_id="PKU60874.1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR020635"
                     /translation="MELECLTELPHAHVDRPRKRARLGWDVSIAPTIGVLCGQEVGGV
                     TSLASVGAPSDHTYYTMHAKGVARIASPPWREDDKDGHYMFGLGENLTSRYKIYSKMG
                     EGTFGQVLECWDRESKEMVAIKIVRGIKKYWDAALIEIDVLQQLAKHQASSGLCVQIR
                     NWFDYRNHICIVFEKLGPSLYDFLRKNGYRPFPIDLVREIGRQLLESVAFMHDLRLIH
                     TDLKPENILVVSQEHVNVSDHKVFCNNMRLPKSSAVKVIDFGSTTYDSRDHNYIVSTR
                     HYRAPEVILGLGWSYPCDVWSLGCILVELCSGEALFQTHENLEHLAMMERVLGPIPRH
                     MMKRADRHAEKYFRRTRLNWPEGASSRESINAVHKMLRLQNLVMKHVDRSAGDLIDLL
                     QGMFKYEPAERLTAHEALRHPFFRNNNRRME"
     gene            complement(653237..654148)
                     /locus_tag="MA16_Dca015419"
     mRNA            complement(653237..654148)
                     /locus_tag="MA16_Dca015419"
                     /product="Pentatricopeptide repeat-containing protein"
     CDS             complement(653237..654148)
                     /locus_tag="MA16_Dca015419"
                     /codon_start=1
                     /product="Pentatricopeptide repeat-containing protein"
                     /protein_id="PKU60875.1"
                     /db_xref="InterPro:IPR002885"
                     /translation="MATALRWSPLSISKCFLLVSRRLSYPSLQLYIHSLLPQPLNPRP
                     NLSPPLSAVPLSSSIFYHPRFILRAFSSNSNTNSPSSFDWSDDEDDTKIKEVAKGNKT
                     MPPPYDPFNKKPAIEEPKDPSNLQEIFHKLRTDGLTNSAVKMFDALSKDGLTHEALEL
                     FAVIKDKGNMPDVVAHTAVIEAYANAGGHSKETIRTFDRMLASGVSPNAYTYAVLVKG
                     LARDSKLPEARKYLLEMMGKGMKPNAPTYLAVFEAYLREQQLDDARILLDEMRGKGFR
                     PDEKAVRENLSKRGQVFRGIMSLLFGR"
     gene            complement(657674..658504)
                     /locus_tag="MA16_Dca015420"
     mRNA            complement(join(657674..658108,658211..658504))
                     /locus_tag="MA16_Dca015420"
                     /product="hypothetical protein"
     CDS             complement(join(657674..658108,658211..658504))
                     /locus_tag="MA16_Dca015420"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKU60876.1"
                     /translation="MASSSWSLEIAGGASKPVCFGRDLPQRTRRRFSSLRLNPPLRRR
                     QTAAAALEFHPTPSISPPPVRIDSLTTFAERARDGRDRITPQKLDDWMRESVGEIVRN
                     IGKAPFLVRIFSDESESKQISSTIEKEDATAESWLGIKKRWEQESSVPDGVILVEELD
                     AEEDEEGDDVAASNEEGGDRSNVRWGVVIQGRGMDCSACYILDTSKVRSSMGFCTHFC
                     LVRAKCFGDPVGVQLKNAWLQSER"
     gene            complement(661501..672519)
                     /gene="RGLG1"
                     /locus_tag="MA16_Dca015421"
     mRNA            complement(join(661501..661581,661675..661734,
                     664307..664487,664597..664724,664795..664900,
                     665736..665815,668015..668112,668207..668320,
                     668398..668538,668617..668701,672238..672519))
                     /gene="RGLG1"
                     /locus_tag="MA16_Dca015421"
                     /product="E3 ubiquitin-protein ligase RGLG1"
     CDS             complement(join(661501..661581,661675..661734,
                     664307..664487,664597..664724,664795..664900,
                     665736..665815,668015..668112,668207..668320,
                     668398..668538,668617..668701,672238..672519))
                     /gene="RGLG1"
                     /locus_tag="MA16_Dca015421"
                     /note="GO_function: GO:0005515 - protein binding [Evidence
                     IEA];
                     GO_function: GO:0008270 - zinc ion binding [Evidence IEA]"
                     /codon_start=1
                     /product="E3 ubiquitin-protein ligase RGLG1"
                     /protein_id="PKU60877.1"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR010734"
                     /translation="MGGRGSKEEVRRSFRSADSFRSRGYAEEQYSTPRYGGDVPAYQN
                     YPTSTSSYDPPHATGYSQPYSVPQPPATRQTRKLDRRYSQISDNYNSLEQVTEALARA
                     GLESSNLIVGIDFTKSNEWTGKFSFHNRSLHHISDIPNPYEHAISIIGQTLSAFDEDN
                     LIPCYGFGDASTHDQDVFSFFPDERPCTGFSEALSRYKEIVPHLRLAGPTSFAPIIEK
                     AMTIVEQSGGQYHVLLIIADGQVTRSVDTQSGYLSSQEQKTVDSIVKASEFPLSIVLV
                     GVGDGPWDMMKEFDDNIPARSFDNFQFVNFTEIMSKNTHQKRKETEFALAALMEIPSQ
                     YKATIELGILGKSARSPQRIALPPPDGSRAAAAFGSKSFQSTSFQKSSTPYTGYDSPT
                     SYAPSASSASWEQASCPICLTNPKNLAFGCGHQTCYDCGQSLLTCPICRSEIVTRIRL
                     Y"
     gene            complement(675796..678300)
                     /gene="EXPA8"
                     /locus_tag="MA16_Dca015422"
     mRNA            complement(join(675796..676102,676893..677214,
                     678102..678300))
                     /gene="EXPA8"
                     /locus_tag="MA16_Dca015422"
                     /product="Expansin-A8"
     CDS             complement(join(675796..676102,676893..677214,
                     678102..678300))
                     /gene="EXPA8"
                     /locus_tag="MA16_Dca015422"
                     /note="GO_component: GO:0005576 - extracellular region
                     [Evidence IEA];
                     GO_process: GO:0009664 - plant-type cell wall organization
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Expansin-A8"
                     /protein_id="PKU60878.1"
                     /db_xref="InterPro:IPR002963"
                     /db_xref="InterPro:IPR007112"
                     /db_xref="InterPro:IPR007117"
                     /db_xref="InterPro:IPR007118"
                     /db_xref="InterPro:IPR009009"
                     /translation="MEEAFSKLKFFIEFDRVGRMEKATCNHGGALLLLLIFLYSASTA
                     FAEGWMPATATFYGGSDASGTMGGACGYGDLYQDGYGIKNSALSTALFNDGGSCGECF
                     QIVCDTTKAAKWCKRGTYITITATNFCPPNDNLPSDNGGWCNPPRQHFDMSQPAWETI
                     AIYRAGIVPVFYRRVRCKRSGGVRFTINGRDYFDLVLVSNVGGSGIVTAMWIKGSNTD
                     WMIMSRNWGMNWQSNSYLNGQSLSFRVQTDDGRTKTFNNVAPSNWKFGDTFATSIQF"
     gene            complement(683594..689775)
                     /locus_tag="MA16_Dca015423"
     mRNA            complement(join(683594..684376,689557..689775))
                     /locus_tag="MA16_Dca015423"
                     /product="Uncharacterized protein"
     CDS             complement(join(683594..684376,689557..689775))
                     /locus_tag="MA16_Dca015423"
                     /note="GO_component: GO:0016021 - integral to membrane
                     [Evidence IEA];
                     GO_function: GO:0004252 - serine-type endopeptidase
                     activity [Evidence IEA];
                     GO_function: GO:0008270 - zinc ion binding [Evidence IEA]"
                     /codon_start=1
                     /product="Uncharacterized protein"
                     /protein_id="PKU60879.1"
                     /db_xref="InterPro:IPR001876"
                     /db_xref="InterPro:IPR022764"
                     /translation="MDRDGGIRRRITRGMIPVLALHVGTEFYRLRRKPPVTAGLILAN
                     TLIYLRPGALDRLLPTIDEVWFNPHLIVKYRDLRRFFLSAFYHMGESHLVYNMMSLLW
                     KGIQLETSMGSVEFASMVAALLGLSQGITLLLAKSLLLFFDYETAYYNQYAVGFSGVL
                     FAMKVVLNSESDDLTSLNGLLVPARHAAWVELILIQLFVPGVSFLGHLGGILAGLLYL
                     KLRRSYSGPDPLAALIRKVAGAITWPVKFLKSLIGWQTRRITGRGTVGSRRPVQRVYD
                     VWRCTACTYDNSALADVCEMCSTERSGHGFASPAPSNNNGALSLEEVRRRRLERFSR"
     gene            complement(692984..707995)
                     /locus_tag="MA16_Dca015424"
     mRNA            complement(join(692984..692987,695306..695433,
                     697122..697712,707016..707408,707489..707995))
                     /locus_tag="MA16_Dca015424"
                     /product="hypothetical protein"
     CDS             complement(join(692984..692987,695306..695433,
                     697122..697712,707016..707408,707489..707995))
                     /locus_tag="MA16_Dca015424"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKU60880.1"
                     /translation="MGKKKKSFIDKKNSATFKLLACDTSTFPESAAAAVPPVTARVFV
                     RVDNNSVNVRGIFEDDNGRDDRAAPEPAGLKGEDDVDSIFADAPGDTDDEGSFSQPWP
                     SHVARGSSDRTSHFLPDEFRKEILELGLPDDGYNYLQHLREISNAGAGSAYYQNSKAR
                     LDLVPLDVKAFDAKRLTISGAESKKNSIYAVASKAVGIKVQKVVDPDVSRLLEDSDLS
                     RFGSDTEEFEDDFVFKANLPEGNEGESEEVEETEPGAGEAERQMCLIKTEQEGESFDE
                     DSEDELDDGDKPRIHRLLDEQFDLLALQEYGETYSDDDGYLGEEGETIVAKLHDALKE
                     CKVDDLEFEEHYRVPGDYVHKQDAHVGIPLDDSTDVISKCREYADKYCDDDEDEEQFI
                     MVEESSDELEIWDCETIVSTYSNLDNHPGTIKTPEILKRKFAKSFPVDSIRKTDMIEL
                     RGKEKLPVEFLPHAKKDLEKVKKPAGFEKQKIKPRREESKDEKKERKVAVKEERREAR
                     RAKKELKGLYRCETQKAQKVAAVSMPSAIHLM"
     gene            709464..710054
                     /locus_tag="MA16_Dca015425"
     mRNA            709464..710054
                     /locus_tag="MA16_Dca015425"
                     /product="Retrovirus-related Pol polyprotein from
                     transposon TNT 1-94"
     CDS             709464..710054
                     /locus_tag="MA16_Dca015425"
                     /codon_start=1
                     /product="Retrovirus-related Pol polyprotein from
                     transposon TNT 1-94"
                     /protein_id="PKU60881.1"
                     /translation="MSNIKNVVHYSLTPDNHSTWRAQVIKVFQANGFHGFLDGSASAP
                     TKYIIGSDQSSSVNPDFTLWQLIDQNLKAALYSVISPPLLPYVLNLDHTHSVWVTIDK
                     RLQSTNRSRILQLKNELHHLTMKDMTMTQYLSLVKSKVDAINAAGSSIDTEDIILYTL
                     NGLPGNYNAFKTSIRINLQPLSLEICTPCCAVRRSI"
     gene            complement(719185..719935)
                     /locus_tag="MA16_Dca015426"
     mRNA            complement(join(719185..719273,719362..719935))
                     /locus_tag="MA16_Dca015426"
                     /product="hypothetical protein"
     CDS             complement(join(719185..719273,719362..719935))
                     /locus_tag="MA16_Dca015426"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKU60882.1"
                     /translation="MASNVIFTGHLPLMEIHAAAAAEDDGGGDEADDEMSYKTPPYSA
                     DDEDDDAGDHGSAKGRGSRRTASLPGTPRRPWEPWRKYASEMELRNGLGRRRRRWNRE
                     RKLDRAWEMRKSRASFADSVLGGGSGGEGGECLVLVRPRGSSGRRICMDMDEVKACRD
                     LGLDIPRDFTVEIPGGISGNSSGADSPISGTGEDAKEIKAKLKMWAHAVAFVSSAARS
                     GR"
     assembly_gap    729918..730017
                     /estimated_length=100
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            758266..759672
                     /gene="MYB86"
                     /locus_tag="MA16_Dca015427"
     mRNA            join(758266..758398,758483..758612,758706..759672)
                     /gene="MYB86"
                     /locus_tag="MA16_Dca015427"
                     /product="Transcription factor MYB86"
     CDS             join(758266..758398,758483..758612,758706..759672)
                     /gene="MYB86"
                     /locus_tag="MA16_Dca015427"
                     /note="GO_function: GO:0003682 - chromatin binding
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Transcription factor MYB86"
                     /protein_id="PKU60883.1"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR017930"
                     /translation="MGRHSCCHKQKLRKGLWSPEEDEKLLKHITKHGHGCWSSVPKLA
                     GLQRCGKSCRLRWINYLRPDLKRGTFSQQEENLIIELHAVLGNRWSQIAAQLPGRTDN
                     EIKNLWNSCIKKKLRQRGIDPSTHKSLSEAENPEENKVSTSSERNSILYTGDSLKHTV
                     PQPAPSLMQSVDKNSIAAKEFFIDNSTTCLRSSSNSMACFTVPQLNYGSSTSSLPSNP
                     NPFLCFNQNCRVFDMNPELSCTSISTIGPSISSSILSNSIDFKSSVDLSSSCLPPSYT
                     GAPVFPYLEVVNPSRCSSGSSSSSSFFDSGLLSWPDLTAEKETQIHLQGDPEDLKWSE
                     YLQGNFPVSSVLHSQNQPLYGSEANSESHFGIEGLGLWHQNPQPQHQQHHQQPQQQAS
                     DLYGKEYQRISTLFGQI"
     assembly_gap    767772..769775
                     /estimated_length=2004
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            complement(793331..793504)
                     /locus_tag="MA16_Dca015428"
     mRNA            complement(793331..793504)
                     /locus_tag="MA16_Dca015428"
                     /product="hypothetical protein"
     CDS             complement(793331..793504)
                     /locus_tag="MA16_Dca015428"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKU60884.1"
                     /translation="MGVGSRRERAEDRTQTHVNDKVIYFFFQLNKVNLFLKTHRLWWK
                     LNSTVAPRTENWV"
     gene            complement(798143..801267)
                     /gene="PIF3"
                     /locus_tag="MA16_Dca015429"
     mRNA            complement(join(798143..798220,798978..799454,
                     799522..799587,799675..799740,799806..799907,
                     799998..801048,801131..801267))
                     /gene="PIF3"
                     /locus_tag="MA16_Dca015429"
                     /product="Transcription factor PIF3"
     CDS             complement(join(798143..798220,798978..799454,
                     799522..799587,799675..799740,799806..799907,
                     799998..801048,801131..801267))
                     /gene="PIF3"
                     /locus_tag="MA16_Dca015429"
                     /note="GO_function: GO:0046983 - protein dimerization
                     activity [Evidence IEA];
                     GO_process: GO:0006355 - regulation of transcription,
                     DNA-dependent [Evidence IEA]"
                     /codon_start=1
                     /product="Transcription factor PIF3"
                     /protein_id="PKU60885.1"
                     /db_xref="InterPro:IPR011598"
                     /db_xref="InterPro:IPR024097"
                     /db_xref="InterPro:IPR024102"
                     /translation="MESNFQDLVSQIMPISEVHHTSKKGKSESAHSMKMPNYSSDLSS
                     FMPELELVELLWENGQIVMQGQSNRTKKSTVGTEFAFNGRVEDKFGQNGAIDSVAHDL
                     PSTVPSSMNDQEDDAAPWLNYAIDDSIQNDYCSEFFSELTSVHMTSLSDTNSNLYTSN
                     KSTGCSQATKDSHIFRSSPGASDSSRSKFNNLLNMPHQCHNLSENAKPRVLEVGISSG
                     HFGDLNSTKFQKEHVGVQKPFHQSNSAGLMNFSHFSRPAALAKANLHSIDRLKSHDKS
                     CTAASNYPVESTVVESRDGLKSLNQPKVDSGSYGKTGVDDAEHVQSSTVVNRVSTSPN
                     CQASSFAASMAAERTEADKGTEAVVASSSVCSGYDAAAASNDLKHKSRKRAREVEESG
                     EESEDLEEELFTVKKPSSGQAKSGKRSRAAEVHNLSERRRRDRINEKMKALQELIPNC
                     NKVDKASMLDEAIEYLKTLQLQVQMMSMGNGLFMHPMMLPAGMNFQHLRAPSISHFSP
                     LGLGMGMGLGFGMGMIDLNGSPGLIPVPPLMHGARFPCPLVPGLAGFHGMPPSSSIHS
                     LGVPGQRPPLSVPHAPLFNSQAGLFPQNPLKVSEKDPSSSNNQQQQCINSEAVENART
                     KESKGEASQAVCPLMQKESKELHVNPVVNSNKTT"
     assembly_gap    806962..809481
                     /estimated_length=2520
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            814593..818312
                     /gene="CYP71D55"
                     /locus_tag="MA16_Dca015430"
     mRNA            join(814593..815531,817695..818312)
                     /gene="CYP71D55"
                     /locus_tag="MA16_Dca015430"
                     /product="Premnaspirodiene oxygenase"
     CDS             join(814593..815531,817695..818312)
                     /gene="CYP71D55"
                     /locus_tag="MA16_Dca015430"
                     /note="GO_function: GO:0005506 - iron ion binding
                     [Evidence IEA];
                     GO_function: GO:0009055 - electron carrier activity
                     [Evidence IEA];
                     GO_function: GO:0016705 - oxidoreductase activity, acting
                     on paired donors, with incorporation or reduction of
                     molecular oxygen [Evidence IEA];
                     GO_function: GO:0020037 - heme binding [Evidence IEA];
                     GO_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Premnaspirodiene oxygenase"
                     /protein_id="PKU60886.1"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="InterPro:IPR002401"
                     /translation="MEQLLLILLFSLLVLVVTLTLIIKSSNSSSRSSSTYIFPAPLPP
                     GPSQLPIIGHLHHVLSGDPIPHISLRNLSSLHGPIMLLRLGQVNYTVISSREAAEEIL
                     RTHDLCFASRPEINRSRAMTYGFRDIAMAPYGPSWRLLRKICITELLTVKRVASFASI
                     RNEAVSALVESIGAVAGRNVAVNLKQKLEETTNDIVTKAAFSRECRQGRKEEFLRLLR
                     DMLSLSSGLDLGDLFPWLGFLDTVLGVKDRIEGHLRRLDAILDEIIGEHEARLRLMKS
                     EGIDDGNFDLLDVLLRVRYEEQFDQSISVEHVKAVALELFFAGIDTTSSTMQWAMSEL
                     MRNPKAMEKVQREIRQVATMGGKRKLEEEDLNKLNYLKQVIKETLRLHPSLPLLLPRL
                     CRETCQVQGFTVPAGTRVLVNVWALGRDSRYWDDPEEFLPERFDEKMVDFRGANFEFL
                     PFGAGRRICPGMNFGLANVELTLANLLLCFDWDLPDGMKASNLDMSETIGSTSARKVD
                     LCLLATTYTI"
     gene            825579..830129
                     /gene="CYP71D55"
                     /locus_tag="MA16_Dca015431"
     mRNA            join(825579..826517,829509..830129)
                     /gene="CYP71D55"
                     /locus_tag="MA16_Dca015431"
                     /product="Premnaspirodiene oxygenase"
     CDS             join(825579..826517,829509..830129)
                     /gene="CYP71D55"
                     /locus_tag="MA16_Dca015431"
                     /note="GO_function: GO:0005506 - iron ion binding
                     [Evidence IEA];
                     GO_function: GO:0009055 - electron carrier activity
                     [Evidence IEA];
                     GO_function: GO:0016705 - oxidoreductase activity, acting
                     on paired donors, with incorporation or reduction of
                     molecular oxygen [Evidence IEA];
                     GO_function: GO:0020037 - heme binding [Evidence IEA];
                     GO_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Premnaspirodiene oxygenase"
                     /protein_id="PKU60887.1"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="InterPro:IPR002401"
                     /translation="MDQLLPILLFPLLIIVVALTRITKSTNSSCKSSSPDIFVAPLPP
                     GPRPLPIIGQLHHLLSGDPLAHVSLRNLSSLHGPIILLRLGQLNLTVVSSREAAEEIL
                     RTQDLCFASRPQLIRSGAMTYGYNDIAMAPYGPNWRLLRKICVTELLTAKRVASFAAI
                     RKEAVSALVESIAAAAGRKEAVNLKQKLEETTNDIIMKAAFSRRCRQGRKEELLSMMR
                     EMISLTSGLNVAEFFPCLGFIDTMLGVKGQIERHFRRMDEILEELIGEHEDRLRLKKM
                     AGPESGDEDLLDVLLRARDEGHVDQSISTQNVKAIAADLFFAGTDTSSTTMQWAMSEL
                     IRNPKAMEKIQKEIRQVAATARKRQIEEEDLNQLDYLKQVIKETLRLHPSLPLLVPRL
                     CRQTCQVQGYTVPAGTRVLVNVWALGRDSRYWKQPEMFRPERFDEAVVDFKGANFEFL
                     PFGGGRRICPGMNFGMASVELVLANLLLCFDWELPDGRRAEDLDMREVSGSTTGRKVD
                     LCLLATPYVSS"
     gene            831880..832839
                     /locus_tag="MA16_Dca015432"
     mRNA            831880..832839
                     /locus_tag="MA16_Dca015432"
                     /product="Chitinase 2"
     CDS             831880..832839
                     /locus_tag="MA16_Dca015432"
                     /note="GO_function: GO:0004553 - hydrolase activity,
                     hydrolyzing O-glycosyl compounds [Evidence IEA];
                     GO_process: GO:0005975 - carbohydrate metabolic process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Chitinase 2"
                     /protein_id="PKU60888.1"
                     /db_xref="InterPro:IPR001223"
                     /translation="MPSKNLLFPFLIFQFLFINLQPPSSFSSPSAAAAAASAPAPQSS
                     LLFREYIGAEFNGVKFSDVPINPHVNFHFILSFAIDYTPDGNSSTNGLFNVFWDSQNL
                     SASQVNLIKQNHRNVVALSLGGDTVNGQFAYFNPICIDSWVSNAVSSLTKIIKEYNLD
                     GIDIDYEHFSADSYTFAECIGRLLKTLKCNKVISFASIAPYDYYDVQSHYIALWEKHG
                     EFIDYVNFQFYAYPSNTTISQFLNYFDIQSANYEGGKVLVSFSSDASSSGGLPPEKGF
                     FTACECLRREGKLHGIFVWSADDSVKYCFRYEEFYQNILAGYF"
     assembly_gap    836124..836223
                     /estimated_length=100
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            837309..837857
                     /gene="C/VIF2"
                     /locus_tag="MA16_Dca015433"
     mRNA            837309..837857
                     /gene="C/VIF2"
                     /locus_tag="MA16_Dca015433"
                     /product="Cell wall / vacuolar inhibitor of fructosidase
                     2"
     CDS             837309..837857
                     /gene="C/VIF2"
                     /locus_tag="MA16_Dca015433"
                     /note="GO_function: GO:0004857 - enzyme inhibitor activity
                     [Evidence IEA];
                     GO_function: GO:0030599 - pectinesterase activity
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Cell wall / vacuolar inhibitor of fructosidase
                     2"
                     /protein_id="PKU60889.1"
                     /db_xref="InterPro:IPR006501"
                     /translation="MASLSNSFFLLHLLLLLLHLSSSFSTTFIETTCKSTSYPDFCVT
                     AISSTSPQTSTTADTRGLSSIFLSLALSNATNSSSYATSLAASSITEEPIRPLLRACS
                     LKYAAAGDALSWALRELSAESYDNAFVHASAAAEYPIACRMLFAQQRRKPAALYPPEL
                     GRMEEELRRLCTVAVEIISLLD"
     assembly_gap    840507..840516
                     /estimated_length=10
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            844433..847934
                     /gene="PME51"
                     /locus_tag="MA16_Dca015434"
     mRNA            join(844433..845339,847243..847934)
                     /gene="PME51"
                     /locus_tag="MA16_Dca015434"
                     /product="putative pectinesterase/pectinesterase inhibitor
                     51"
     CDS             join(844433..845339,847243..847934)
                     /gene="PME51"
                     /locus_tag="MA16_Dca015434"
                     /note="GO_component: GO:0005618 - cell wall [Evidence
                     IEA];
                     GO_function: GO:0004857 - enzyme inhibitor activity
                     [Evidence IEA];
                     GO_function: GO:0030599 - pectinesterase activity
                     [Evidence IEA];
                     GO_process: GO:0042545 - cell wall modification [Evidence
                     IEA]"
                     /codon_start=1
                     /product="putative pectinesterase/pectinesterase inhibitor
                     51"
                     /protein_id="PKU60890.1"
                     /db_xref="InterPro:IPR000070"
                     /db_xref="InterPro:IPR006501"
                     /translation="MATTLLSLFLLLAAVSSSAAADSSLLPVILNACKASRFPDSCAD
                     RLCNSTPPIPPNASASYIILTIFNTSLSDLFTASSTVQSILDSSASNLNRTNAARICL
                     EVLSYSTHRLSAAASSDLLSPDSRTWAGASLLYQYDCWSALKYVNGTSQVAAAMTFLT
                     DLSNRTSDGLSMLAALHRYGANTSLWGPPQTERDGYWDSPSEIPAIDGYRGVPVDLPA
                     NFTVCKDEGCDYKTVQAAVDAAPAYVSGGRFVIWIKAGVYDEIVRVPIEKTNLVFVGD
                     GMSKTVITGDLNADQVGVTTYSTATVAVAGDGFMARDLTFQNTAGPDAHQAVAFRADG
                     DFTVLDTVELSGHQDTLYAHSLRQYYKSCIISGTVDFIFGNSAAVFDDCLIIIVTRQF
                     SPTKGESDTVTAHGRTDPAQPTGFVFHNCQLNASEEYWSLYKKNPSLHRVYLGRPWKE
                     YSRTVFISCYLEEFLKPEGWLPWSGDFALETLYYGEFESRGPGANAAARVPWSSQIPA
                     EHVGVYSVENFIQGDQWIPTASSR"
     gene            complement(850632..883715)
                     /gene="GUX1"
                     /locus_tag="MA16_Dca015435"
     mRNA            complement(join(850632..851659,851748..852394,
                     883495..883715))
                     /gene="GUX1"
                     /locus_tag="MA16_Dca015435"
                     /product="UDP-glucuronate:xylan
                     alpha-glucuronosyltransferase 1"
     CDS             complement(join(850632..851659,851748..852394,
                     883495..883715))
                     /gene="GUX1"
                     /locus_tag="MA16_Dca015435"
                     /note="GO_function: GO:0016757 - transferase activity,
                     transferring glycosyl groups [Evidence IEA]"
                     /codon_start=1
                     /product="UDP-glucuronate:xylan
                     alpha-glucuronosyltransferase 1"
                     /protein_id="PKU60891.1"
                     /db_xref="InterPro:IPR002495"
                     /translation="MWTYHSDDATKRRHMRSRDFNDVSKFIVSFHEKSLCCKLRSLKP
                     ILLIILCGTFLTFIFAPVAYNEHSPHSSSRSRFVDVGWIWESPVSDSRYLSDVNVNWT
                     QISKAVTKLNGRKRKLEVGLLNFNITEINSWQQLLPRAELLALQLDSAKTNLTWENLY
                     PEWIDEEEENEVPTCADLPDPRVTRSASFDLIAAKLPCNKTSKNWSRDVARFHLQLAA
                     AKLASQSSVGQLQTHVILLTDCFPIPNLFSCKNLVIREGNAWLYRPDPRNLGEKLQLP
                     VGSCKLAVPLITDVRPHSESGRQREAYATILHSAHIYVCGAIVAAQSIRLSGSTRDLV
                     ILVDETISSHHRDGLADAGWKVRTIQRIRNPKAERDAYNEWNYSKFRLWQLTEYDKII
                     FIDADLLILRNIDFLFAMPEVTAIGNNATLFNSGVMVIEPSNCTFHMLMDHINEIESY
                     NGGDQGYLNEIFTWWHRIPKHMNFLKHFWIGDEEEIKEKKIRLFGAEPPVLYVLHYLG
                     LKPWLCFRDYDCNWNVDILQEFASDVAHARWWRVHDTMAENLQSFCLLRSKQKAALEW
                     DRRQAEKAKYVDGHWKRNITDPRLHICFEEFCFWESMLWHWGETNGTENSSSVANGKP
                     IAALPSL"
     gene            complement(895377..898466)
                     /gene="SAR1A"
                     /locus_tag="MA16_Dca015436"
     mRNA            complement(join(895377..895697,898072..898203,
                     898338..898466))
                     /gene="SAR1A"
                     /locus_tag="MA16_Dca015436"
                     /product="GTP-binding protein SAR1A"
     CDS             complement(join(895377..895697,898072..898203,
                     898338..898466))
                     /gene="SAR1A"
                     /locus_tag="MA16_Dca015436"
                     /note="GO_component: GO:0005622 - intracellular [Evidence
                     IEA];
                     GO_function: GO:0005525 - GTP binding [Evidence IEA];
                     GO_process: GO:0006886 - intracellular protein transport
                     [Evidence IEA];
                     GO_process: GO:0007264 - small GTPase mediated signal
                     transduction [Evidence IEA]"
                     /codon_start=1
                     /product="GTP-binding protein SAR1A"
                     /protein_id="PKU60892.1"
                     /db_xref="InterPro:IPR006687"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR024156"
                     /translation="MFLIDWFYGVLASLGLWQKEAKILFLGLDNAGKTTLLQMLKDER
                     LVQHQPTQHPTSEELSIGKIKFKAFDLGGHLIARRVWKDYYAKVDAVVFLVDAADKER
                     FAESKKELDALLSDDLLANVPFLILGNKIDLVYAASEEELRFHLGLSNFTTGKGKVNL
                     VDTNVRPLEVFMCSIVRKMGYGDGFKWISQYIK"
     gene            complement(901683..902748)
                     /locus_tag="MA16_Dca015437"
     mRNA            complement(join(901683..901764,901879..901997,
                     902353..902459,902547..902748))
                     /locus_tag="MA16_Dca015437"
                     /product="Universal stress protein A-like protein"
     CDS             complement(join(901683..901764,901879..901997,
                     902353..902459,902547..902748))
                     /locus_tag="MA16_Dca015437"
                     /note="GO_process: GO:0006950 - response to stress
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Universal stress protein A-like protein"
                     /protein_id="PKU60893.1"
                     /db_xref="InterPro:IPR006015"
                     /db_xref="InterPro:IPR006016"
                     /translation="MGRSIVVAVDGGEESIHALTWCLQNIVVVGTTADEASSDSGGGV
                     TGDTVVLLYARPSPSVYPAMDGSGYLFSSDIIASMDNYAKHLADTVTQKAKMVCSSYP
                     NLKVEIKVQNGDPRDVICEMVEKLGADMLVMGSHGYGPLKRAFIGSVSSYCAQNVKCP
                     VLIVKKPKN"
     assembly_gap    904175..904295
                     /estimated_length=121
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            905594..905878
                     /locus_tag="MA16_Dca015438"
     mRNA            905594..905878
                     /locus_tag="MA16_Dca015438"
                     /product="hypothetical protein"
     CDS             905594..905878
                     /locus_tag="MA16_Dca015438"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKU60894.1"
                     /translation="MSPNQRFEALLGGSNRNLNYQTVSDFDELILESNGSTRRIQRAQ
                     DHQIPKSLRPSNVQRTVHDRRIRYRPSIRITPNSPLISRLFTGCATPEKL"
     gene            907126..907952
                     /locus_tag="MA16_Dca015439"
     mRNA            join(907126..907275,907390..907461,907605..907681,
                     907784..907952)
                     /locus_tag="MA16_Dca015439"
                     /product="E3 ubiquitin-protein ligase MARCH6"
     CDS             join(907126..907275,907390..907461,907605..907681,
                     907784..907952)
                     /locus_tag="MA16_Dca015439"
                     /note="GO_function: GO:0008270 - zinc ion binding
                     [Evidence IEA]"
                     /codon_start=1
                     /product="E3 ubiquitin-protein ligase MARCH6"
                     /protein_id="PKU60895.1"
                     /db_xref="InterPro:IPR011016"
                     /translation="MEFANSEEIRATASSSSSSFLLCLCRICHEEEEQGTTSMESPCA
                     CSGTLKFAHRGCIQRWCDEKGNTVCEICLEKFEPGYTVTAPSPAIPHMIEVVITIRGS
                     LEAARINNEIQNPAMVALSSNRHEQEHAGQSPASYNSKSCFQSVVLMVSSAIF"
     gene            complement(914646..935557)
                     /gene="ABCB26"
                     /locus_tag="MA16_Dca015440"
     mRNA            complement(join(914646..914726,915434..915494,
                     915561..915625,915702..915983,916059..916133,
                     918633..918707,918828..918910,920230..920333,
                     920560..920809,920870..921050,921735..922031,
                     923315..923457,923642..923767,923850..923970,
                     924364..924437,929690..929792,929939..929971,
                     930061..930115,932897..933000,933080..933229,
                     933337..933377,933440..933482,935290..935386,
                     935499..935557))
                     /gene="ABCB26"
                     /locus_tag="MA16_Dca015440"
                     /product="ABC transporter B family member 26,
                     chloroplastic"
     CDS             complement(join(914646..914726,915434..915494,
                     915561..915625,915702..915983,916059..916133,
                     918633..918707,918828..918910,920230..920333,
                     920560..920809,920870..921050,921735..922031,
                     923315..923457,923642..923767,923850..923970,
                     924364..924437,929690..929792,929939..929971,
                     930061..930115,932897..933000,933080..933229,
                     933337..933377,933440..933482,935290..935386,
                     935499..935557))
                     /gene="ABCB26"
                     /locus_tag="MA16_Dca015440"
                     /note="GO_component: GO:0016021 - integral to membrane
                     [Evidence IEA];
                     GO_function: GO:0000166 - nucleotide binding [Evidence
                     IEA];
                     GO_function: GO:0005524 - ATP binding [Evidence IEA];
                     GO_function: GO:0016887 - ATPase activity [Evidence IEA];
                     GO_function: GO:0017111 - nucleoside-triphosphatase
                     activity [Evidence IEA];
                     GO_function: GO:0042626 - ATPase activity, coupled to
                     transmembrane movement of substances [Evidence IEA];
                     GO_process: GO:0006810 - transport [Evidence IEA];
                     GO_process: GO:0055085 - transmembrane transport [Evidence
                     IEA]"
                     /codon_start=1
                     /product="ABC transporter B family member 26,
                     chloroplastic"
                     /protein_id="PKU60896.1"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017940"
                     /translation="MICNARKKFRRLVADLEVVPTANRRCLESRTAVCLAEISWTEAV
                     NMQDSKHEWIAELLLWHCKYDIGRNELDFLSWCRLNYSFFWPPYQEMALFDEETVGDL
                     TSRLGSDCQQVSRVIGNDLNLICRNVVQGTGALIALFIISWPLALSMVLICASLATVL
                     FFYGRFQKWVAKLTQDFAARANEVSQETFSLIRTIQDMAREIVGCKLATKRGIWILEF
                     NLQLLLPFYQGRQLQKLIGRIEFVDVSFHYPSRLMDKLYTYVPGKKYTKENFVGKFAE
                     RCGLRKFGLGLPAALIFYKTLPRKFHHLTLKVDGGGMDDGPDQDPMVPSSRAIVVPGL
                     LRFDVTKGRIGSGHNQYFVVPFGGKTTRFRGLRVIITVYPAVPFGGKPSAISVLVPTV
                     VRCTYDVSTIVIHKYSFAGDRCIHYDLLEMFVEGSFTSVSYPPFTNLRWFADCTYLQG
                     MGLLLSFAVLPSQGMGLLLSFAVFPSQSIGKLHPGISPVWEKYRGAGPSHHATRACMV
                     GVLRHRGRTNFLPTKVEQSEGAEEACEQKENYLRRKAVGGAKSGSHAGAEEAMLAIST
                     PLAKYRSRTTTKGEKERARKSGNERKRPKAAFPMLFNDARSCVVGEMSRTCVRRAAAE
                     SSMIVFTSVNIHYIFQIRIRSLFITMAKNFQKKLTLGLVFIDVEQFPAVEHIDLSIQP
                     NKVLAIVGRSGSGKSTIANLLLRLYEPTNGAILVDGIPIEDLDIKWLREKIGFVGQEP
                     PLFRMDVTSNIRYGCTRETTQEEVEWAAKQAFAHEFILSLPDGYSTLVDNALLSGGQK
                     QRIAIARAILRDPTILILDEATSALDAESEHYIKELLLSDRNVSGEKRTVIVIAHRLS
                     TIQAADTIVVMDVGRIVEVGNHKQLLHKNGLYASLARRQSDAFV"
     gene            complement(948913..951754)
                     /locus_tag="MA16_Dca015441"
     mRNA            complement(join(948913..950877,951308..951754))
                     /locus_tag="MA16_Dca015441"
                     /product="hypothetical protein"
     CDS             complement(join(948913..950877,951308..951754))
                     /locus_tag="MA16_Dca015441"
                     /note="GO_function: GO:0005515 - protein binding [Evidence
                     IEA];
                     GO_function: GO:0008270 - zinc ion binding [Evidence IEA]"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKU60897.1"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR002035"
                     /translation="MGTGWRRAFCTSIPRDPENAVATEKRQDHRRVRQQLSASSSPSN
                     PSHSPGSCAKFGVFSGGGSSNSSSLRLRCRTGEASSEHPLLSPALDSMSGHHCKNGDF
                     TTPCTPPPPSSAGVKGSPRLLLTRSNPASPRSPSRFALLKATLRLSRSRCGICSQSVR
                     TGQRTAVFTAECSHSFHFPCISTHVRNQSRNQAGCLSCPVCSASWREVPLLSSAHSQA
                     APLPPSSTNKDFNNFSHTSKARIQRGGENDLKQSGNNKLYDDDEPLLLSSTTQGGGGH
                     HFNPIPEADLEDEAEGGISCGRNGVEVGGCGVEVVVLPEAALVSADRNHQSYVILLRV
                     KAPAFAQRSVSKVAASVLDPSCRAPIDLVTVLDVSGSMTSTAKLQMLKRAMRLLISSL
                     GSSDRLSIVAFSAGAKRLLPLVRMSRQGQRSARQIVDRLIVCGSGGGRGDNGVQGDCR
                     CIGHALRKATKVLEDRRERNPVATIMLLSDSHQEQKRGKEGSSDSSPRLREEETDMEK
                     HLRNPIPSSTDNVATRFAHLEIPIGCSTELGSGGVNHVEDVFSKCVSGLVSLVLQDVH
                     LQLTFPSAFVSSIYSHGTPGGGGGGGGEGCVGLAISQGQGGNGAISVRLGDFYADEKR
                     ELLVELRLPAAAPQQQRNDFLFYKCCYRDPTSRELVLCQERSLVLPSLRQISPMAVNS
                     RELRNLFITTRALVESRRLADHNDLETAAHLLSTARTLLLQSNSVPSHHQKYVTSLEL
                     RLSEIQRRHRRQQLPSSSSMARPSDQLTPTSAWRAAEQLAKVAILRKSMSRVGDLHGF
                     ENARF"
     gene            955750..958692
                     /locus_tag="MA16_Dca015442"
     mRNA            955750..958692
                     /locus_tag="MA16_Dca015442"
                     /product="Putative ribonuclease H protein"
     CDS             955750..958692
                     /locus_tag="MA16_Dca015442"
                     /note="GO_function: GO:0003723 - RNA binding [Evidence
                     IEA];
                     GO_function: GO:0003964 - RNA-directed DNA polymerase
                     activity [Evidence IEA];
                     GO_process: GO:0006278 - RNA-dependent DNA replication
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Putative ribonuclease H protein"
                     /protein_id="PKU60898.1"
                     /db_xref="InterPro:IPR000477"
                     /db_xref="InterPro:IPR026960"
                     /translation="MLINSSFLDIFPLAYYKVDSHSGSDHAPIILLANPVKKGASRFM
                     FKEFWLSIDIFWDELLTAFDRPLAASPIASLYDSLAALKNAIKKKNWFSSNYLSYNIM
                     LLKNQQALSLEQIQNDPLNPELNISLKNTNEQLALAHVAWSSWISQRAKAYWLSHGED
                     DLGFLFAKIRARTNKNLIKELATDTGILTSHAEISKALVDHFQSLFNAPAPPLQSSYN
                     IPTGNTVPSTALAALIAPITNDEIKKVVFGGVASSTPGPDGYSFAFYQKTWLISGHRL
                     CSAVKHFFSTGLMSRGAKSTVITLIPKGSHSSSISDYRPISLCNVFYKIVAKIIANRM
                     KPILPLIINKSQSGFVAKRSSTDYIILASEILRDFRCSKGSFCAKLDVRKAFDSVSRS
                     FLLHRLSQKGFPDIFVNWIKGCISDVHFSISVNGVLEGYFKSSSGLRQGCPLSPLLFC
                     IAMDALSSSLDDNLGSHFIGISNRNCNLSHLMYADDLLVIGKATRDNALALKDILLYF
                     SKASGLFINTAKSTLIFSKSVNASLVSTVAGCLGISNVAEVITYLGLPISATRLRMSH
                     FQPLIDKIFGMLEGWKIKFLSFAGRVQFLKFTISNTIAYWIRGSIIPKACCKSISKMC
                     AKFLFFGNVKDKKLHLISWNTVVSPKSKGGLGLPSFDVLYHNLACSFIFRMYNSDNIL
                     GLWFREKFCSPWKPYPPSASKFWKLCCLKAVEIKEHISLVPNSNSNFSFFWDPWCNKK
                     ALVELSCPHHFSNLMITDVMANNTWNLPLAIPEEIASTVMRIDLSSLPHCISWDGVAS
                     PNNKTFSKLFYSNLEDIGWAKFIWHKGYALRYASYSWMAMHRKLKTADLLILKGIPVV
                     SSCSFCDATWENHAHLYFECDFTFSLLSALLPSLRNFYLRPNLHQVYDFLGSMRHFSS
                     LELNFCYLTISVTVYWIWRERNGRKFASLTKNISELKEVITQAIRAKVINWKHYDSLK
                     LHFQEILA"
     assembly_gap    969214..970602
                     /estimated_length=1389
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            complement(973746..990114)
                     /gene="PCKA"
                     /locus_tag="MA16_Dca015443"
     mRNA            complement(join(973746..973889,974235..974403,
                     974621..974969,975218..975283,975370..975543,
                     975624..975922,976345..976445,976538..976622,
                     977121..977274,977944..978122,979910..980265,
                     983949..984159,989969..990114))
                     /gene="PCKA"
                     /locus_tag="MA16_Dca015443"
                     /product="Phosphoenolpyruvate carboxykinase [ATP]"
     CDS             complement(join(973746..973889,974235..974403,
                     974621..974969,975218..975283,975370..975543,
                     975624..975922,976345..976445,976538..976622,
                     977121..977274,977944..978122,979910..980265,
                     983949..984159,989969..990114))
                     /gene="PCKA"
                     /locus_tag="MA16_Dca015443"
                     /note="GO_function: GO:0004612 - phosphoenolpyruvate
                     carboxykinase (ATP) activity [Evidence IEA];
                     GO_function: GO:0005524 - ATP binding [Evidence IEA];
                     GO_process: GO:0006094 - gluconeogenesis [Evidence IEA]"
                     /codon_start=1
                     /product="Phosphoenolpyruvate carboxykinase [ATP]"
                     /protein_id="PKU60899.1"
                     /db_xref="InterPro:IPR001272"
                     /translation="MMKVSKPSDATERQRMPAVLINGELAGVGEVGGCPAIFHDHVGC
                     CSLVTTLASVDGLAEFSSSSGDLAEFRPLGDGPAKVRASSDGLARVRTSSCGPMKVRA
                     LSGGPTKLRASSGGSAKEDLKRMATDGQASNMDNNLANGSSVAASAQPPRRGVLPRIQ
                     TRITTMAASKPYKAENNICHDDSSRPVKAQTIDELHSLQKKRSAPSTPIKQEVTAQSP
                     TAFSTISEEERQRLQLQSISASLASLTRESGPKVVKGDPKRKLETPKAHEQHHQYFTP
                     NISTSDSALKFTHILYNLSPAELYEQAIKYEHGSFITSSGALATLSGAKTGRSPRDKR
                     VVIDENTTDELWWGKGSPNIEMDEHTFLVNRERAVDYLNSLDKVFVNDQFLNWDSENQ
                     IKVRIVSARAYHSLFMHNMCIRPTPEELENFGTPDFTIYNAGQFPCNRYTHYMTSSTS
                     IDINLARKEMVILGTQYAGEMKKGLFSVMHYLMPKRGILSLHSGCNMGKDGDVALFFG
                     LSGTGKTTLSTDHNRLLIGDDEHCWSDNGVSNIEGGCYAKCIDLSHEKEPDIFNAIKF
                     GAVLENVVFDEHTREVDYSDKSVTENTRASYPIEYIPNAKIPCVGPHPKNVILLACDA
                     FGVLPPVSKLTMAQTMYHFITGYTALVAGTEDGIKEPQATFSACFGAAFIMLHPTKYA
                     AMLAEKMKKYGATGWLVNTGWCGGRYGVGSRIKLPYTRNIINAIHSGVLLNTEYTKTE
                     VFGLEIPTVVEGVPSEILNPMNAWENKKVYKETLLKLAGLFKQNFEVFSKYKIGSDNK
                     LTEEILAAGPNI"
     assembly_gap    1054991..1055762
                     /estimated_length=772
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            complement(1101137..1101451)
                     /locus_tag="MA16_Dca015444"
     mRNA            complement(1101137..1101451)
                     /locus_tag="MA16_Dca015444"
                     /product="hypothetical protein"
     CDS             complement(1101137..1101451)
                     /locus_tag="MA16_Dca015444"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKU60900.1"
                     /translation="MADPELEGGLVFDVYGDIHILRSPFFDEGFDHDDTIEDYLDQIL
                     PTLVHVIDGQFSDYDWTFNGHPPASPPSPPPLPSPPLRIVCAIYLGVISFLVWFFFLR
                     QS"
     gene            1136263..1149651
                     /gene="FKBP20-2"
                     /locus_tag="MA16_Dca015445"
     mRNA            join(1136263..1136308,1140292..1140355,1140452..1140684,
                     1146163..1146272,1147322..1147430,1147513..1147589,
                     1149532..1149651)
                     /gene="FKBP20-2"
                     /locus_tag="MA16_Dca015445"
                     /product="Peptidyl-prolyl cis-trans isomerase FKBP20-2,
                     chloroplastic"
     CDS             join(1136263..1136308,1140292..1140355,1140452..1140684,
                     1146163..1146272,1147322..1147430,1147513..1147589,
                     1149532..1149651)
                     /gene="FKBP20-2"
                     /locus_tag="MA16_Dca015445"
                     /note="GO_process: GO:0006457 - protein folding [Evidence
                     IEA]"
                     /codon_start=1
                     /product="Peptidyl-prolyl cis-trans isomerase FKBP20-2,
                     chloroplastic"
                     /protein_id="PKU60901.1"
                     /db_xref="InterPro:IPR001179"
                     /db_xref="InterPro:IPR023566"
                     /translation="MTSVLLLNGPHHVLSGKLPATEVAPGTYMTQMIHTKSFLKDEKE
                     NACLPDSIVTCTRRVILRLPVISSVLFFSYSANGKVKTTTPFNDKRLLEQNKKIQEAN
                     QAPKDFPNFIREGFQVKVVTSDKYVRRRSGLIYLDIEVGNGDCPKDGQQVTFHYIGYN
                     ESGRRIDSTYSQGSPAKIRLGNNALVPGFEEGIHDMKPGGKRRIIIPPELGPPVGPST
                     FFSSKQYEVFDVELLNVKDCQRRTIAFYSDVVCN"
     assembly_gap    1142444..1142598
                     /estimated_length=155
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            1151658..1159337
                     /gene="LOG2"
                     /locus_tag="MA16_Dca015446"
     mRNA            join(1151658..1152196,1157268..1157766,1159182..1159337)
                     /gene="LOG2"
                     /locus_tag="MA16_Dca015446"
                     /product="putative E3 ubiquitin-protein ligase LOG2"
     CDS             join(1151658..1152196,1157268..1157766,1159182..1159337)
                     /gene="LOG2"
                     /locus_tag="MA16_Dca015446"
                     /note="GO_function: GO:0005515 - protein binding [Evidence
                     IEA];
                     GO_function: GO:0008270 - zinc ion binding [Evidence IEA]"
                     /codon_start=1
                     /product="putative E3 ubiquitin-protein ligase LOG2"
                     /protein_id="PKU60902.1"
                     /db_xref="InterPro:IPR001841"
                     /translation="MGNTGSSGGGGAGGGGGAGRRRNHGHHHQHHAPSILPPPAPQSV
                     PPAPSPEVSAGNRYVFAAATPYPQYPNPNSPQYYQYVGSYPPPPPMPAPMPAPFDHYQ
                     RGAGGDHPAYHPGWASAPRYPYCPAPPPPPTPFVEHQKAVTIRNDVNLKKETLRIVPD
                     EENPGRYLVTFTFDATVSGSISVFFFAKEGLDCNLIPTKDGLLSPVTVSFNDGLGQKF
                     KQPSSTGIDLSMFEEAELIKEGETDAYPLAIKAEACHVDKQGLEGSHGTVTPNSQITQ
                     AVFEKKENGEYQVRVVKQILWVNGTRYELQEIYGIGNSVDGDYDGNDPGKECVICLSE
                     PRDTTVLPCRHMCMCSGCAKVLRYQTNRCPICRQPVERLLEIKVNNRGEDEQNARAET
                     SDLKA"
     gene            1162221..1169199
                     /locus_tag="MA16_Dca015447"
     mRNA            join(1162221..1162386,1163571..1163721,1163816..1163892,
                     1163965..1164074,1164324..1164407,1164547..1164639,
                     1164901..1164981,1165071..1165202,1165361..1165463,
                     1165631..1165725,1168856..1168940,1169048..1169199)
                     /locus_tag="MA16_Dca015447"
                     /product="Chorismate synthase, chloroplastic"
     CDS             join(1162221..1162386,1163571..1163721,1163816..1163892,
                     1163965..1164074,1164324..1164407,1164547..1164639,
                     1164901..1164981,1165071..1165202,1165361..1165463,
                     1165631..1165725,1168856..1168940,1169048..1169199)
                     /locus_tag="MA16_Dca015447"
                     /note="GO_function: GO:0004107 - chorismate synthase
                     activity [Evidence IEA];
                     GO_process: GO:0009073 - aromatic amino acid family
                     biosynthetic process [Evidence IEA]"
                     /codon_start=1
                     /product="Chorismate synthase, chloroplastic"
                     /protein_id="PKU60903.1"
                     /db_xref="InterPro:IPR000453"
                     /translation="MAAAGASISSQAFLKGRRSDGGFGLGFSPSDLGGLSSPAVVQIC
                     LRRLPHPSRRLEVKAIGNVFGNYFKVATYGESHGGGVGCTISGCPPRLPLSEADMQAE
                     LDRRRPGQSRITTPRKETDTCKILSGISEVLVCTDQGAEWGDTICAGMTTGTPIHVFV
                     PNTDQRSHDYSEMSIAYRPSHADATYDFKYGIRSVQGGGRSSARETIGRVAAGAVAKK
                     ILRIKSGVEILAYVSQVHKVVLPDGVIDYDSVTVDQIESNIVRCPDPEYAQKMIDAID
                     AVRVKGDSVGGVVTCIARNVPRGLGSPVFDKLEAEFAKAMMSLPATRGVEFGSGFSGA
                     LMMGSQHNDEFYTDDNGIIRTRTNRSGGIQKKQNTVTRNREETELLARGRHDPCVLPR
                     AVPMVEAMAALVLVDQLMAQIAQCEMFPINLDLQRSVAEPINGSVKVPSV"
     gene            complement(1185812..1193475)
                     /gene="PDIL1-4"
                     /locus_tag="MA16_Dca015448"
     mRNA            complement(join(1185812..1185979,1186092..1186148,
                     1186893..1187027,1187237..1187317,1187409..1187477,
                     1189468..1189542,1189640..1189726,1189862..1189942,
                     1190049..1190167,1190258..1190423,1191497..1191626,
                     1192916..1193475))
                     /gene="PDIL1-4"
                     /locus_tag="MA16_Dca015448"
                     /product="Protein disulfide isomerase-like 1-4"
     CDS             complement(join(1185812..1185979,1186092..1186148,
                     1186893..1187027,1187237..1187317,1187409..1187477,
                     1189468..1189542,1189640..1189726,1189862..1189942,
                     1190049..1190167,1190258..1190423,1191497..1191626,
                     1192916..1193475))
                     /gene="PDIL1-4"
                     /locus_tag="MA16_Dca015448"
                     /note="GO_function: GO:0009055 - electron carrier activity
                     [Evidence IEA];
                     GO_function: GO:0015035 - protein disulfide oxidoreductase
                     activity [Evidence IEA];
                     GO_process: GO:0006662 - glycerol ether metabolic process
                     [Evidence IEA];
                     GO_process: GO:0045454 - cell redox homeostasis [Evidence
                     IEA]"
                     /codon_start=1
                     /product="Protein disulfide isomerase-like 1-4"
                     /protein_id="PKU60904.1"
                     /db_xref="InterPro:IPR005746"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /translation="MSSRAILLAFLLSALLLHGFATSATKGTADDADEDISFLLEGDD
                     EDAARGFPSHDHALQGEDDHDDFDEDEQDQGDFSDLDEGSYEAPPALDEKDVVVLTEG
                     NFSEFIEKNRHVMVEFYAPWCGHCRALAPEYAAAATALKAEDVVLAKIDATEENELAQ
                     KYDVQGFPTVYFFVDGDHKPYPGQRAKDAIVTWIKKRIGPAVQNITTTEEAEKILASE
                     TKLVLGFFDSLVGADSLELAAASKLEDDVNFYQTVSPDVAALFHIDPKAKRPSLVLLK
                     KEAEKLTYFDGQFTKSAIGDFIFANKLPLVTTFTRETAPLIFESQIKKQLLLFAQSKD
                     SEKILSVFQEAAKLFKGKLIFVHVEMDNEDVGKPVSDYFGVTGDGPKLLAYSGNEDGR
                     KYILDGEVTHENIKAFGEDYLEDKLKPFYKSDQIPQTNDGDVKIVVGNNFDEIVLDES
                     KDVLLEIYAPWCGHCQALEPTYNKLAKHLRGIESLVIAKMDGTTNEHPRAKSDGFPTL
                     LFFPAGNKSFDPITVDTERTVVAFYKFLKKNASIPFKLQKPAAATKTEAVSEPKQEGQ
                     AKTDLKDEL"
     gene            1208562..1208960
                     /locus_tag="MA16_Dca015449"
     mRNA            1208562..1208960
                     /locus_tag="MA16_Dca015449"
                     /product="hypothetical protein"
     CDS             1208562..1208960
                     /locus_tag="MA16_Dca015449"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKU60905.1"
                     /translation="MASAKLLFFIFFLPTIQIHAAQPRFLHGLFSENPMAFPPSAYQF
                     FNLYSTPPAAQVAPAPQGVVRGSADCAAPLKVRANGEKLLLFVLIVVIVVVVAVFYLR
                     ARRRANARLAQLPFNGALTYQKEGRPKDSS"
     gene            complement(1212101..1213852)
                     /locus_tag="MA16_Dca015450"
     mRNA            complement(1212101..1213852)
                     /locus_tag="MA16_Dca015450"
                     /product="Retrovirus-related Pol polyprotein from
                     transposon TNT 1-94"
     CDS             complement(1212101..1213852)
                     /locus_tag="MA16_Dca015450"
                     /codon_start=1
                     /product="Retrovirus-related Pol polyprotein from
                     transposon TNT 1-94"
                     /protein_id="PKU60906.1"
                     /db_xref="InterPro:IPR013103"
                     /translation="MPTSSTTKLPQSTNSSVQSPSHNTGANSTIPAISILPTQTNANL
                     PSHPMQTRLKSGITKPKQILSLIATTPPTSTPNTYAQAVKHSHWRQAMSDEFHALQKQ
                     STWTLVPPPANTPILGCKWTFKTKLLPNGTVDKFKARLVAQGYDQQYGINYQETFSPV
                     AKMTTIRILLTLAINRNWQIIQLDISNAFLHGDLTENIYMRQPPGFINAASPSYVCKL
                     HKSLYGLKQAPRQWFEKLTSFLQTQGFRFTRSDPSLLSYRLNHTQIFFLIYVDDILIT
                     GNNSAAITALLAKLHSQFSLKQSNQLSLFLGIKISQQPNGLFLSQQHYAERLLKDAGL
                     AECKPAVTPLSPKSKHNVSTSQPFHDPTLYRRLAGSLQYLSITRPDIAFATNQVCQHM
                     HQPTTQDFQDLKRLLRYVKGTISFGLPLQTGDLILRTYTDADWASDSSDRKSISGFCS
                     FLGPNLISWSVKKQVTVAKSSTEAEYRALSAATSDVIWLRRLVEELDIPQHSPTTIHC
                     DSTSAIALARNPVFHARTKHIEIDYQFIRQHIKNGAISLTHIPSEDQIADILTKSFSA
                     VRFHNLRRKLTIRTQND"
     gene            1216211..1223913
                     /locus_tag="MA16_Dca015451"
     mRNA            join(1216211..1216484,1223810..1223913)
                     /locus_tag="MA16_Dca015451"
                     /product="hypothetical protein"
     CDS             join(1216211..1216484,1223810..1223913)
                     /locus_tag="MA16_Dca015451"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKU60907.1"
                     /translation="MHLWPSQKIRNYYSCAYVSKFEWNLKQLRQSKAATSVCASDDRC
                     VIREALISSSSPMPSSLEQRKDAVDPFSKIIRLVLLSCCCCCCFFCTGLLVNSSISLR
                     VTCELKYFLSEDLQACKNIFSEI"
     gene            complement(1226000..1226257)
                     /locus_tag="MA16_Dca015452"
     mRNA            complement(1226000..1226257)
                     /locus_tag="MA16_Dca015452"
                     /product="hypothetical protein"
     CDS             complement(1226000..1226257)
                     /locus_tag="MA16_Dca015452"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKU60908.1"
                     /translation="MESSNSSSNLEMTEMASKEAAEIDILPQLKFLTKNLKSIFHTRQ
                     KITLPSILKCLKYSKLTGLKVTLMVLSPVLASISSIQMAGL"
     gene            complement(1246319..1251801)
                     /gene="HEMA1"
                     /locus_tag="MA16_Dca015453"
     mRNA            complement(join(1246319..1247452,1247594..1247835,
                     1251552..1251801))
                     /gene="HEMA1"
                     /locus_tag="MA16_Dca015453"
                     /product="Glutamyl-tRNA reductase 1, chloroplastic"
     CDS             complement(join(1246319..1247452,1247594..1247835,
                     1251552..1251801))
                     /gene="HEMA1"
                     /locus_tag="MA16_Dca015453"
                     /note="GO_function: GO:0008883 - glutamyl-tRNA reductase
                     activity [Evidence IEA];
                     GO_function: GO:0050661 - NADP binding [Evidence IEA];
                     GO_process: GO:0033014 - tetrapyrrole biosynthetic process
                     [Evidence IEA];
                     GO_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Glutamyl-tRNA reductase 1, chloroplastic"
                     /protein_id="PKU60909.1"
                     /db_xref="InterPro:IPR006151"
                     /db_xref="InterPro:IPR015895"
                     /db_xref="InterPro:IPR015896"
                     /translation="MAASSTTAFTASLACARPDSLIFLRRSAGGFGIRSIAMPLRSRR
                     LWRGRIRSEAATDIGVKSASNSRASSISALEQFKALGSDRYMKERSSIAVIGLSVHTA
                     PVEMREKLAVPEALWSRAIGELCNLNHIEEAAVLSTCNRMEIYVVALSWHRGIREVME
                     WMSKTSGIPVSELRDHLFMLRDSDATRHLFEVAAGLDSLVLGEGQILAQVKQVVKVAQ
                     SSGGLGKNIDRLFKDAISTGKKVRTETNISSGAVSVSSAAVELALMKLPASYALSARM
                     LLVGAGKMGKLVIKHLAAKGCKSVVVVNPSIAKVDAIREELEDIEIIYKPLTEMLSSA
                     AEADVVFTSTASETPLFLKEHVENLPPVSENFGGFRLFVDISVPRNVGSCVSEVKTAR
                     LYNVDDLKEVVEANKEDRLRKAMEAQAIITKELKSFEAWRDSLETVPTIKKLRSYAER
                     IKSAELEKCIQKMGDDVLTKKVRRAVEDLASGIVNKLLHGPLQHLRCDGSDSRTLDET
                     LENMHALNRMFSLDTEKAILEQKIKAKVEKVQS"
     gene            complement(1255750..1260426)
                     /gene="DRB6"
                     /locus_tag="MA16_Dca015454"
     mRNA            complement(join(1255750..1256462,1256592..1256811,
                     1260181..1260426))
                     /gene="DRB6"
                     /locus_tag="MA16_Dca015454"
                     /product="Double-stranded RNA-binding protein 6"
     CDS             complement(join(1255750..1256462,1256592..1256811,
                     1260181..1260426))
                     /gene="DRB6"
                     /locus_tag="MA16_Dca015454"
                     /codon_start=1
                     /product="Double-stranded RNA-binding protein 6"
                     /protein_id="PKU60910.1"
                     /db_xref="InterPro:IPR014720"
                     /translation="MYKNQLQELAQRSCFNLPSYTCIREGPDHAPRFKATVNFNGEVF
                     ESPTFCSTLRQAEHAAAEVALAALSHGGPSHSLAARILDETGVYKNLLQEISRRVGAP
                     LPSYTTIRSGLGHQPVFTCNVELAGITFTGGPAKNKKQAEKNAAMAAWHLLKKLAKEA
                     ASSSSEPDNNEEQDQITIARALLNYHLKEKMVMANNPHATPFPKKFAQLAERKPTYVQ
                     QAPLTGSKILPLLQPKSISRTDGATLLSPTTMLNENKPRPQKFPAAGALRYVPVRNYG
                     VPFHAVAQPVTIRTAVPVFSAPPLPPPSQAPPFEKASPVSVRPVVPVFASPPSNVIKE
                     PVSAVMASAESPPPTTLQKKEFEHTAALQEVKETNDNAVALPAQVKELSLDIMSCPQL
                     "
     gene            1274341..1275519
                     /locus_tag="MA16_Dca015455"
     mRNA            join(1274341..1274613,1275436..1275519)
                     /locus_tag="MA16_Dca015455"
                     /product="hypothetical protein"
     CDS             join(1274341..1274613,1275436..1275519)
                     /locus_tag="MA16_Dca015455"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKU60911.1"
                     /translation="MADEPSVEVSNDQKANRTNRTGSLWLSLVVLLLNGSWAIYYFQY
                     NNLPMPLTAEQAGKRGFSEALSLVHVKNLTGFGPHPVGSDTLDLAIQTVPHGLVQPVL
                     PGLALAYLRWNRLPPI"
CONTIG      join(JSDN02169539.1:1..25836,gap(2537),JSDN02169540.1:1..24531,
            gap(784),JSDN02169541.1:1..106645,gap(100),JSDN02169542.1:1..70967,
            gap(100),JSDN02169543.1:1..45765,gap(4114),JSDN02169544.1:1..56698,
            gap(148),JSDN02169545.1:1..125417,gap(148),JSDN02169546.1:1..4869,
            gap(100),JSDN02169547.1:1..58003,gap(100),JSDN02169548.1:1..41917,
            gap(100),JSDN02169549.1:1..161038,gap(100),JSDN02169550.1:1..37754,
            gap(2004),JSDN02169551.1:1..37186,gap(2520),
            JSDN02169552.1:1..26642,gap(100),JSDN02169553.1:1..4283,gap(10),
            JSDN02169554.1:1..63658,gap(121),JSDN02169555.1:1..64918,gap(1389),
            JSDN02169556.1:1..84388,gap(772),JSDN02169557.1:1..86681,gap(155),
            JSDN02169558.1:1..135765)
//