LOCUS       AM747721             3217062 bp    DNA     circular BCT 06-FEB-2015
DEFINITION  Burkholderia cenocepacia J2315 chromosome 2, complete genome.
ACCESSION   AM747721
VERSION     AM747721.1
DBLINK      BioProject:PRJNA339
            BioSample:SAMEA1705928
KEYWORDS    am0001 gene; sigma factor.
SOURCE      Burkholderia cenocepacia J2315
  ORGANISM  Burkholderia cenocepacia J2315
            Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
            Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
REFERENCE   1  (bases 1 to 3217062)
  AUTHORS   Holden M.T.G.
  JOURNAL   Submitted (20-JUN-2007) to the INSDC. Holden M.T.G., The Pathogen
            Sequencing Unit, The Wellcome Trust Sanger Institute, The Wellcome
            Trust Genome Campus, CB10 1SA, UNITED KINGDOM.
REFERENCE   2
  AUTHORS   Holden M.T., Seth-Smith H.M., Crossman L.C., Sebaihia M.,
            Bentley S.D., Cerdeno-Tarraga A.M., Thomson N.R., Bason N.,
            Quail M.A., Sharp S., Cherevach I., Churcher C., Goodhead I.,
            Hauser H., Holroyd N., Mungall K., Scott P., Walker D., White B.,
            Rose H., Iversen P., Mil-Homens D., Rocha E.P., Fialho A.M.,
            Baldwin A., Dowson C., Barrell B.G., Govan J.R., Vandamme P.,
            Hart C.A., Mahenthiralingam E., Parkhill J.
  TITLE     The genome of Burkholderia cenocepacia J2315, an epidemic pathogen
            of cystic fibrosis patients
  JOURNAL   J. Bacteriol. 191(1), 261-277(2009).
   PUBMED   18931103
FEATURES             Location/Qualifiers
     source          1..3217062
                     /organism="Burkholderia cenocepacia J2315"
                     /chromosome="2"
                     /strain="J2315"
                     /mol_type="genomic DNA"
                     /country="United Kingdom:Edinburgh"
                     /isolation_source="cystic fibrosis patient"
                     /note="representative of the ET12 epidemic lineage"
                     /db_xref="taxon:216591"
     CDS             230..829
                     /transl_table=11
                     /locus_tag="BCAM0001"
                     /product="putative sigma factor"
                     /db_xref="EnsemblGenomes-Gn:BCAM0001"
                     /db_xref="EnsemblGenomes-Tr:CAO00537"
                     /db_xref="GOA:B3KYE4"
                     /db_xref="InterPro:IPR007627"
                     /db_xref="InterPro:IPR013324"
                     /db_xref="InterPro:IPR013325"
                     /db_xref="InterPro:IPR014284"
                     /db_xref="InterPro:IPR014289"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="InterPro:IPR039425"
                     /db_xref="UniProtKB/TrEMBL:B3KYE4"
                     /protein_id="CAO00537.1"
                     /translation="MPSAYDDPTYLAQLRRDLLRFARLQLRDADAAEDAVQEALAAAW
                     SHAGDFAGQSAHKTWVFGILRNKLIDVLRARQRMVSLTALDAELDGESVLDRELFKDN
                     GHWAAHAKPRPWPKPETLLQQQQFWTLFQACLDQLPEQIGRVFMMREFLDVEIVDICS
                     ELTLTTNHCSVLLYRARTRLRTCLSEKGLTTEDAAGEMY"
     misc_feature    257..463
                     /locus_tag="BCAM0001"
                     /note="HMMPfam hit to PF04542, Sigma-70 region, score
                     1.7e-12"
                     /inference="protein motif:HMMPfam:PF04542"
     misc_feature    596..628
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     misc_feature    608..769
                     /locus_tag="BCAM0001"
                     /note="HMMPfam hit to PF08281, Sigma-70, region, score
                     5.8e-05"
                     /inference="protein motif:HMMPfam:PF08281"
     CDS             831..1022
                     /transl_table=11
                     /locus_tag="BCAM0001A"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0001A"
                     /db_xref="EnsemblGenomes-Tr:CAR53855"
                     /db_xref="InterPro:IPR027383"
                     /db_xref="UniProtKB/TrEMBL:B4EFY6"
                     /protein_id="CAR53855.1"
                     /translation="MTRLLSDALDRRLTLHERLQVRVHLPTCSGCRAYRGQIALLRTA
                     AKAAAGREPDGDDGSSGGG"
     CDS             complement(1160..1516)
                     /transl_table=11
                     /locus_tag="BCAM0002"
                     /product="ArsC family arsenate reductase"
                     /db_xref="EnsemblGenomes-Gn:BCAM0002"
                     /db_xref="EnsemblGenomes-Tr:CAR53856"
                     /db_xref="GOA:B4EFY7"
                     /db_xref="InterPro:IPR006659"
                     /db_xref="InterPro:IPR006660"
                     /db_xref="InterPro:IPR036249"
                     /db_xref="UniProtKB/TrEMBL:B4EFY7"
                     /protein_id="CAR53856.1"
                     /translation="MITIYHNPRCSKSRETLALVESLNTAGAPLNVVEYLKTPPTVEE
                     LDTLHKQLGRPVRDMLRDGEEPYKALNLARADLTDAEAYGAIVAHPVLLQRPIVVYRG
                     KAAIGRPPESVKALFE"
     misc_feature    complement(1163..1504)
                     /locus_tag="BCAM0002"
                     /note="HMMPfam hit to PF03960, ArsC family, score 2.1e-34"
                     /inference="protein motif:HMMPfam:PF03960"
     CDS             2538..3200
                     /transl_table=11
                     /locus_tag="BCAM0003"
                     /product="putative partition protein ParA"
                     /db_xref="EnsemblGenomes-Gn:BCAM0003"
                     /db_xref="EnsemblGenomes-Tr:CAR53857"
                     /db_xref="InterPro:IPR002586"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B4EFY8"
                     /protein_id="CAR53857.1"
                     /translation="MAAEIIAVTQQKGGVGKSTIAMHLGAAFHEKGKRVLVIDADRQN
                     TLVHWSSASGDSDNGIPFPVVNLAEADGQIHREIKKFINDYDIIVVDCPPSITEKVSG
                     VVLLAASIAVIPTSSSPADYWSSVGLVKLIQQAQVMNEDLRAVFLLNKTEEKRMLTRE
                     LKRALEELGFPLLKTQIPTREAYKQAMALGQTVLQMNDRGGKLAAAEIRACADEIVAM
                     LP"
     misc_feature    2553..3092
                     /locus_tag="BCAM0003"
                     /note="HMMPfam hit to PF01656, CobQ/CobB/MinD/ParA
                     nucleotide binding domai, score 9.2e-18"
                     /inference="protein motif:HMMPfam:PF01656"
     CDS             3224..4285
                     /transl_table=11
                     /locus_tag="BCAM0004"
                     /product="putative partitioning protein ParB"
                     /note="Similar to Ralstonia solanacearum putative
                     partitioning protein parB SWALL:Q8XTV0 (EMBL:AL646076)
                     (334 aa) fasta scores: E(): 4.7e-19, 28.71% id in 310 aa;
                     homology does not extend to the N terminus"
                     /db_xref="EnsemblGenomes-Gn:BCAM0004"
                     /db_xref="EnsemblGenomes-Tr:CAR53858"
                     /db_xref="GOA:B4EFY9"
                     /db_xref="InterPro:IPR003115"
                     /db_xref="InterPro:IPR004437"
                     /db_xref="InterPro:IPR036086"
                     /db_xref="UniProtKB/TrEMBL:B4EFY9"
                     /protein_id="CAR53858.1"
                     /translation="MKPSQFAKGFQARPDITTSEKRTALDRLNAIDGIVKSETPTPAP
                     TKSAKKDIAPPPAPEFTIDPSIDESQQYRAWRLENRYAPGQVIELPLKAIKHSPFNPR
                     HFYLKSSIAELAVNLAKQGQQQAIHVIPDYDNPGTYFVSDGGRRVRALKEANKESVKA
                     IVIDVPIGIQSYKLGYDLNVQRDSQTVFDNAVVWRRFLDDKHFQSQKELSEHLGLDES
                     TVAVALSIGKLPEAIMQEMVARPDRFGSNMAYQVGRYHNARGTEATLRLINKIVSDDL
                     STRQVSDIVKGRVAAQETPKPAGRQRYAQRLEIKLGGKSVGDLKSYGEDRIELRLRGL
                     PKDKRDAILEQLERMLLSE"
     misc_feature    3482..3763
                     /locus_tag="BCAM0004"
                     /note="HMMPfam hit to PF02195, ParB-like nuclease domain,
                     score 1.4e-11"
                     /inference="protein motif:HMMPfam:PF02195"
     misc_feature    3833..3898
                     /note="Predicted helix-turn-helix motif with score
                     1577.000, SD 4.56 at aa 204-225, sequence
                     QSQKELSEHLGLDESTVAVALS"
                     /inference="protein motif:helixturnhelix:EMBOSS"
     CDS             complement(4378..5745)
                     /transl_table=11
                     /locus_tag="BCAM0005"
                     /product="putative replication protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0005"
                     /db_xref="EnsemblGenomes-Tr:CAR53859"
                     /db_xref="GOA:B4EFZ0"
                     /db_xref="InterPro:IPR000525"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="InterPro:IPR036390"
                     /db_xref="UniProtKB/TrEMBL:B4EFZ0"
                     /protein_id="CAR53859.1"
                     /translation="MATTKRAKKTDVDVVSASSAELRKAVEAIAIQPKSGKITLLTRK
                     LFNVLLAVAQQADDSGDTYRALLSDIVANSAFDSNDTALVKEHLRRMVSVQVEWSTGT
                     SSQKPGRKWGISTLIADAEILEDPTTRRVWVEFSFAPKIKKKLLDPVQYARLSLQFQS
                     QLRSSAGLALYEICVRYLTNPSHLTMREPWEWWRPILSGTPDTEAGDEAKREYKYFKR
                     DYLRPAIAEVNAVTNIFVELIEHREGRRVAEIQFRVTERKQPMLALDEHPNVFDSTLV
                     DRMVKLGIPLKEAQTLYADSEENRIRAALQMTEQRMRSTTLPPVRSAPALFKDALKKG
                     YAPPVESVDALPAGTPSAKVAAAQPDDLKARLLSEFAAFRRKEAKVLYEEQGDAEREV
                     ARESFESEALPTMGSHLRDDWRKRGLDSKLAETAFFDWLAQKTWGEPTDGDLLSFTLN
                     QSRAA"
     CDS             complement(6784..6996)
                     /transl_table=11
                     /locus_tag="BCAM0005A"
                     /product="hypothetical protein"
                     /note="no significant database hits"
                     /db_xref="EnsemblGenomes-Gn:BCAM0005A"
                     /db_xref="EnsemblGenomes-Tr:CAR53860"
                     /db_xref="UniProtKB/TrEMBL:B4EFZ1"
                     /protein_id="CAR53860.1"
                     /translation="MEPALCLTAQFSACADIGENLQDPLHAPILPIFWADLAKGEVSR
                     DSTGICCEDFREANAILHSKSALGGL"
     CDS             7550..8731
                     /transl_table=11
                     /locus_tag="BCAM0006"
                     /product="conserved hypothetical protein"
                     /note="Contains coiled-coiled domains, residues 112 to
                     296"
                     /db_xref="EnsemblGenomes-Gn:BCAM0006"
                     /db_xref="EnsemblGenomes-Tr:CAR53861"
                     /db_xref="InterPro:IPR021104"
                     /db_xref="UniProtKB/TrEMBL:B4EFZ2"
                     /protein_id="CAR53861.1"
                     /translation="MTLDEMRQVIREELESLRASGARRQELSLHACKRLFFDLGIRPS
                     AANVRDLTQTGSASDIPKDIDHFWERIRSASKIRLDGAAIPKAVEEKAGALLGALYEE
                     ALKAARDSLDGDREQVRADMAEAEQRLRDATVRQETLEGALARGEARNEQLQARVTEL
                     EVQLASQTTHGSASEATLLTTVARLEKELAAAAGRIEAEQAQNAALRDRIDALQAELQ
                     QRTEHYAQQIKDAVAEAERRVKPMLVELDSLRSMASTYQSGLRDVQRKEFDFLQQLSS
                     AKARADRLEEQLRTQSDELERATRDVSSLRANRGMNPEIAALIRRLAEAGQLDADAYA
                     AIGTALDHEIPAPTQCPHCDGEPELSHGDEGFEVACPECEHASGTWPSRFEAVARFAH
                     T"
     CDS             complement(8868..9887)
                     /transl_table=11
                     /locus_tag="BCAM0007"
                     /product="putative phage integrase"
                     /db_xref="EnsemblGenomes-Gn:BCAM0007"
                     /db_xref="EnsemblGenomes-Tr:CAR53862"
                     /db_xref="GOA:B4EFZ3"
                     /db_xref="InterPro:IPR002104"
                     /db_xref="InterPro:IPR010998"
                     /db_xref="InterPro:IPR011010"
                     /db_xref="InterPro:IPR013762"
                     /db_xref="UniProtKB/TrEMBL:B4EFZ3"
                     /protein_id="CAR53862.1"
                     /translation="MSLPAAPDTAAHPEEKDLFDRDASDWVASPEAAFDAWLAMQDYR
                     RSSADVYRAQWGAFLAWMRAHQKNLATVDTPTIANFVGELPIKKTQRMRYLRLIERVL
                     DHIRRTEYASTNPARFIAQDGEANWRKARDNEPTGFLTPAERATLLAYLFSPIGVSGS
                     AYWKERRDRALVAAFLGAGIKTGEARSLTISCINTSGTSLRIESTHPDYSRETHLASF
                     AIALLEAWLTERKRQEIPGELVFPASHAGRPMHKATMLRAIDAIVESAGLTSSRTARA
                     SPQTLRNTYAAELFEHDVPPERVGKWLGFMRPISSNRLHRAWKNWRDGLADHNGDASD
                     RDETH"
     misc_feature    complement(8919..9437)
                     /locus_tag="BCAM0007"
                     /note="HMMPfam hit to PF00589, Phage integrase family,
                     score 0.00032"
                     /inference="protein motif:HMMPfam:PF00589"
     CDS             complement(9990..10367)
                     /transl_table=11
                     /locus_tag="BCAM0008"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0008"
                     /db_xref="EnsemblGenomes-Tr:CAR53863"
                     /db_xref="InterPro:IPR018894"
                     /db_xref="UniProtKB/TrEMBL:B4EFZ4"
                     /protein_id="CAR53863.1"
                     /translation="MTEEQDLAALSFKAAAHDLELIVRHIAGRYIRQRVPLTWRLLHA
                     IEAEALADLGFASRHDAGMRQLFERPSDMTFPETDDPIDFGRSNALPAVFSFAVLAYE
                     AAATAHDTARPARALRPSKAWGD"
     CDS             complement(10509..11120)
                     /transl_table=11
                     /locus_tag="BCAM0009"
                     /product="putative DNA-binding protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0009"
                     /db_xref="EnsemblGenomes-Tr:CAR53864"
                     /db_xref="GOA:B4EFZ5"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="InterPro:IPR010982"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR013096"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="UniProtKB/TrEMBL:B4EFZ5"
                     /protein_id="CAR53864.1"
                     /translation="MASSSGSRRPPAAAAPQPPAATPPRVGEQIQRLRNERKLTLDDL
                     SRAAGVSKSMLSEIERDKANPTIAVAWRLTNALGITLDELFSQPKAPETIRVDGPHDI
                     PTLAGHDGRYQLRVWGPIDLAGKFEWYELTLPGGGALVSNAHEPGTREHLTVLQGAME
                     IEAAAASRRLKTGDTARYPADEPHAIRNPGKAEARALLIVIHR"
     misc_feature    complement(10521..10736)
                     /locus_tag="BCAM0009"
                     /note="HMMPfam hit to PF07883, Cupin domain, score
                     1.4e-11"
                     /inference="protein motif:HMMPfam:PF07883"
     misc_feature    complement(10869..11033)
                     /locus_tag="BCAM0009"
                     /note="HMMPfam hit to PF01381, Helix-turn-helix, score
                     5.1e-17"
                     /inference="protein motif:HMMPfam:PF01381"
     misc_feature    complement(10941..11006)
                     /note="Predicted helix-turn-helix motif with score
                     1501.000, SD 4.30 at aa 39-60, sequence
                     LTLDDLSRAAGVSKSMLSEIER"
                     /inference="protein motif:helixturnhelix:EMBOSS"
     CDS             11279..12478
                     /transl_table=11
                     /gene="kbl"
                     /locus_tag="BCAM0010"
                     /product="2-amino-3-ketobutyrate coenzyme A ligase"
                     /EC_number="2.3.1.29"
                     /db_xref="EnsemblGenomes-Gn:BCAM0010"
                     /db_xref="EnsemblGenomes-Tr:CAR53865"
                     /db_xref="GOA:B4EFZ6"
                     /db_xref="InterPro:IPR001917"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR011282"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:B4EFZ6"
                     /protein_id="CAR53865.1"
                     /translation="MRDAFLAQVRGTLDQIRADGFYKTEREIASPQAAAVRLAGGAGV
                     LNFCANNYLGLANDPRLLDAAKAGLDQDGFGMASVRFICGTQTVHKQLESALAAFLGT
                     EDSILYSSCFDANGGLFETLLDENDAVISDELNHASIIDGIRLCKAKRFRYKNNDLAD
                     LEAKLKEADAAGARHKLIATDGVFSMDGIIADLKGICDLADRYGALVMVDDSHAVGFI
                     GTHGRGTPEHCGVEGRVDIITGTLGKALGGASGGYVAARHEVIELLRQRSRPYLFSNT
                     LTPSIAAASLKVLELLGSDEGAKLRERVRENGARFRKQMTEAGFTLVPGAHPIIPVML
                     GDAQLATNMADRLLGEGVYVIGFSFPVVPRGRARIRTQMSAAHTPEQIDQTVAAFVRV
                     GKSLGII"
     misc_feature    11363..12286
                     /gene="kbl"
                     /locus_tag="BCAM0010"
                     /note="HMMPfam hit to PF00202, Aminotransferase class-III,
                     score 0.02"
                     /inference="protein motif:HMMPfam:PF00202"
     misc_feature    11402..12445
                     /gene="kbl"
                     /locus_tag="BCAM0010"
                     /note="HMMPfam hit to PF00155, Aminotransferase class I
                     and II, score 2.4e-92"
                     /inference="protein motif:HMMPfam:PF00155"
     misc_feature    11444..12466
                     /gene="kbl"
                     /locus_tag="BCAM0010"
                     /note="HMMPfam hit to PF00464, Serine
                     hydroxymethyltransferase, score 0.00023"
                     /inference="protein motif:HMMPfam:PF00464"
     misc_feature    11999..12028
                     /note="PS00599 Aminotransferases class-II
                     pyridoxal-phosphate attachment site."
                     /inference="protein motif:Prosite:PS00599"
     misc_feature    12440..12463
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
                     /inference="protein motif:Prosite:PS00017"
     CDS             12492..13520
                     /transl_table=11
                     /gene="tdh"
                     /locus_tag="BCAM0011"
                     /product="threonine 3-dehydrogenase"
                     /EC_number="1.1.1.103"
                     /db_xref="EnsemblGenomes-Gn:BCAM0011"
                     /db_xref="EnsemblGenomes-Tr:CAR53866"
                     /db_xref="GOA:B4EFZ7"
                     /db_xref="InterPro:IPR002328"
                     /db_xref="InterPro:IPR004627"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR020843"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="UniProtKB/Swiss-Prot:B4EFZ7"
                     /protein_id="CAR53866.1"
                     /translation="MKALAKLERGPGLTLTRVKRPEVGHNDVLIKIRRTAICGTDIHI
                     WKWDDWAQKTIPVPMHVGHEYVGEIVEMGQEVRGFAIGDRVSGEGHITCGFCRNCRAG
                     RRHLCRNTVGVGVNREGAFAEYLAIPAFNAFKIPPEISDDLASIFDPFGNATHTALSF
                     NLVGEDVLITGAGPIGIMAVAIAKHVGARNVVITDINDYRLELARKMGATRAVNVARE
                     SLRDVMADLHMTEGFDVGLEMSGVPSAFTSLLEAMNHGGKVALLGIPPAQTAIDWNQV
                     IFKGLEIKGIYGREMFETWYKMVAMLQSGLDLSPIITHRFAADDYEQGFAAMLSGESG
                     KVILDWTV"
     misc_feature    12564..12896
                     /gene="tdh"
                     /locus_tag="BCAM0011"
                     /note="HMMPfam hit to PF08240, Alcohol dehydrogenase
                     GroES-like domain, score 3.2e-43"
                     /inference="protein motif:HMMPfam:PF08240"
     misc_feature    12675..12719
                     /note="PS00059 Zinc-containing alcohol dehydrogenases
                     signature."
                     /inference="protein motif:Prosite:PS00059"
     misc_feature    12978..13403
                     /gene="tdh"
                     /locus_tag="BCAM0011"
                     /note="HMMPfam hit to PF00107, Zinc-binding dehydrogenase,
                     score 9.4e-42"
                     /inference="protein motif:HMMPfam:PF00107"
     CDS             complement(13918..14322)
                     /transl_table=11
                     /locus_tag="BCAM0012"
                     /product="putative membrane protein"
                     /note="no significant database hits"
                     /db_xref="EnsemblGenomes-Gn:BCAM0012"
                     /db_xref="EnsemblGenomes-Tr:CAR53867"
                     /db_xref="GOA:B4EFZ8"
                     /db_xref="UniProtKB/TrEMBL:B4EFZ8"
                     /protein_id="CAR53867.1"
                     /translation="MRKRDDDDDRARLAIRQARVRAALRLRGVMKLTIVTIAVAHVLT
                     FAFEGVLAAAGFAPDAAAVLLFRFATCALVSFWLQADALRAYRYAAQHGFVTAPGAHG
                     DPLDVAPQCPKRWLVVLSLQLDPRGSNGERIK"
     misc_feature    complement(join(14089..14157,14185..14253))
                     /locus_tag="BCAM0012"
                     /note="2 probable transmembrane helices predicted for
                     BCAM0012 by TMHMM2.0 at aa 24-46 and 56-78"
                     /inference="protein motif:TMHMM:2.0"
     CDS             complement(14331..14969)
                     /transl_table=11
                     /locus_tag="BCAM0013"
                     /product="putative acetyltransferase-GNAT family"
                     /note="Poor database matches. C-terminal region is similar
                     to Chromobacterium violaceum hypothetical protein
                     SWALL:Q7NWH5 (EMBL:AE016917) (161 aa) fasta scores: E():
                     8.3e-13, 35.06% id in 154 aa"
                     /db_xref="EnsemblGenomes-Gn:BCAM0013"
                     /db_xref="EnsemblGenomes-Tr:CAR53868"
                     /db_xref="GOA:B4EFZ9"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:B4EFZ9"
                     /protein_id="CAR53868.1"
                     /translation="MQRPESARPARAYAAYAKRLDGRVIVRRFDPCSDSYDTLTALLH
                     RAFAPLGALGFNCPCVDQPAAATRERVLTGECFVALGNAHLVATMTMRSHDPDSRCDP
                     YRSRRVATLEQLAVDPVWQDRGIGRALLAFAQRRAAARGATHLALDAPYAAARLIAFY
                     RRDGFQPVDVVRFPGHNYDSTILCKAVGGADGSTRAHGTMQIDVARQAGAAS"
     misc_feature    complement(14472..14741)
                     /locus_tag="BCAM0013"
                     /note="HMMPfam hit to PF00583, Acetyltransferase (GNAT)
                     family, score 3.2e-15"
                     /inference="protein motif:HMMPfam:PF00583"
     CDS             15152..15757
                     /transl_table=11
                     /locus_tag="BCAM0014"
                     /product="TetR family regulatory protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0014"
                     /db_xref="EnsemblGenomes-Tr:CAR53869"
                     /db_xref="GOA:B4EG00"
                     /db_xref="InterPro:IPR001647"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR036271"
                     /db_xref="UniProtKB/TrEMBL:B4EG00"
                     /protein_id="CAR53869.1"
                     /translation="MNTLLDSSGEPGVRDRLLDAAEALIYSGGIHATGVDAIVKRSGA
                     ARKSFYSHFESKEALVVAALERRDERWMRWFVDATLARGKTPRAQLLGMFDVLCDWFG
                     QPDFHGCAFLNTAGEIPDADDPVRVVARMHKARLLAFVRERFDACADETGIERRGLAR
                     IARQWLVLIDGAIGVALVSGDANAARDARATAELLLDAVSR"
     misc_feature    15200..15340
                     /locus_tag="BCAM0014"
                     /note="HMMPfam hit to PF00440, Bacterial regulatory
                     proteins, tetR family, score 8.3e-15"
                     /inference="protein motif:HMMPfam:PF00440"
     misc_feature    15383..15406
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
                     /inference="protein motif:Prosite:PS00017"
     CDS             15822..16301
                     /transl_table=11
                     /locus_tag="BCAM0015"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0015"
                     /db_xref="EnsemblGenomes-Tr:CAR53870"
                     /db_xref="InterPro:IPR009783"
                     /db_xref="InterPro:IPR032710"
                     /db_xref="UniProtKB/TrEMBL:B4EG01"
                     /protein_id="CAR53870.1"
                     /translation="MSASPEVRPPVPPFTLDTARQKVRAAEDAWNTRDPQRVSLAYTP
                     QSRWRNRAEFVTGRDEIVGLLQRKWARELDYRLIKELWAFDGNRIAVRFAYEWHDDAG
                     NWFRSYGNENWAFDENGLMAHRHASINDLPIREADRLYHWPLGRRPDDHPGLSDLGL"
     misc_feature    15843..16271
                     /locus_tag="BCAM0015"
                     /note="HMMPfam hit to PF07080, Protein of unknown function
                     (DUF1348), score 2.8e-95"
                     /inference="protein motif:HMMPfam:PF07080"
     CDS             complement(16765..17850)
                     /transl_table=11
                     /locus_tag="BCAM0016"
                     /product="tartrate dehydrogenase"
                     /EC_number="1.1.1.93"
                     /db_xref="EnsemblGenomes-Gn:BCAM0016"
                     /db_xref="EnsemblGenomes-Tr:CAR53871"
                     /db_xref="GOA:B4EG02"
                     /db_xref="InterPro:IPR011829"
                     /db_xref="InterPro:IPR019818"
                     /db_xref="InterPro:IPR024084"
                     /db_xref="UniProtKB/TrEMBL:B4EG02"
                     /protein_id="CAR53871.1"
                     /translation="MTDRTYRIAVIPGDGIGREVMPEGLRVLAAVTARFGVRFDFVEI
                     DWASCDYYARHGKMMPDDWKAQLSDMDAILFGAVGWPATVPDHISLWGSLLKFRREFD
                     QYINLRPARLFDGVPSPLAGRRAGDIDFMIVRENTEGEYSSVGGTMFEGTEREVVMQQ
                     SVFTRHGTERVLKFAFELAQRRAKRVTVATKSNGIAISMPWWDARAAEMAERYPEIAV
                     DKQHIDILCARFVLQPDRFDVVVASNLFGDILSDLGPACTGTIGIAPSANLNPDRTFP
                     SLFEPVHGSAPDIAGQYIANPVAMIWSAAMMLDFLGNGTGRERDAHDAIVAAIEDVLR
                     TGPHTRDLGGHAGTQEVGEAIAARVAG"
     misc_feature    complement(16786..17832)
                     /locus_tag="BCAM0016"
                     /note="HMMPfam hit to PF00180, Isocitrate/isopropylmalate
                     dehydrogenase, score 7.2e-103"
                     /inference="protein motif:HMMPfam:PF00180"
     misc_feature    complement(17062..17121)
                     /note="PS00470 Isocitrate and isopropylmalate
                     dehydrogenases signature."
                     /inference="protein motif:Prosite:PS00470"
     CDS             17966..18889
                     /transl_table=11
                     /locus_tag="BCAM0017"
                     /product="LysR family regulatory protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0017"
                     /db_xref="EnsemblGenomes-Tr:CAR53872"
                     /db_xref="GOA:B4EG03"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="InterPro:IPR036390"
                     /db_xref="UniProtKB/TrEMBL:B4EG03"
                     /protein_id="CAR53872.1"
                     /translation="MNKSPNLDDLRVFSLVVRLASFSAAAEQLAVSPAYVSKRIAMLE
                     AQLGTRLLHRSTRRMTVTEAGERVFARAEKILDDVDHLVEDVSTTRTVPRGTLRLSSS
                     FGFGRHVVAPALLDFSARYPQLNVRLDLFDRLVDVAGEGYDLDVRIGDEIADHLIARR
                     LATNHRVLCASPDYLARRGTPRSLADLASHDCLAIKERDHPFGVWRLTVRGETATVKV
                     GGALSTNHGEVAVQWALAGRGIVLRSIWEAGPLIERGALCRVLPDALQPANIWAVYPE
                     RVAASAKVRVCVDFLVETLAGLNAVASDDTA"
     sig_peptide     17966..18043
                     /locus_tag="BCAM0017"
                     /note="Signal peptide predicted for BCAM0017 by SignalP
                     2.0 HMM (Signal peptide probability 0.966) with cleavage
                     site probability 0.857 between residues 26 and 27"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    17984..18163
                     /locus_tag="BCAM0017"
                     /note="HMMPfam hit to PF00126, Bacterial regulatory
                     helix-turn-helix, score 4e-18"
                     /inference="protein motif:HMMPfam:PF00126"
     misc_feature    18023..18088
                     /note="Predicted helix-turn-helix motif with score
                     1242.000, SD 3.42 at aa 20-41, sequence
                     ASFSAAAEQLAVSPAYVSKRIA"
                     /inference="protein motif:helixturnhelix:EMBOSS"
     misc_feature    18233..18853
                     /locus_tag="BCAM0017"
                     /note="HMMPfam hit to PF03466, LysR substrate binding
                     domain, score 5.9e-45"
                     /inference="protein motif:HMMPfam:PF03466"
     CDS             complement(18955..19896)
                     /transl_table=11
                     /gene="argC"
                     /locus_tag="BCAM0018"
                     /product="N-acetyl-gamma-glutamyl-phosphate reductase"
                     /EC_number="1.2.1.38"
                     /db_xref="EnsemblGenomes-Gn:BCAM0018"
                     /db_xref="EnsemblGenomes-Tr:CAR53873"
                     /db_xref="GOA:B4EG04"
                     /db_xref="InterPro:IPR000534"
                     /db_xref="InterPro:IPR010136"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="UniProtKB/Swiss-Prot:B4EG04"
                     /protein_id="CAR53873.1"
                     /translation="MSFPTVFIDGDQGTTGLQIHARLRDRTDVRLLTLPAAERKDPAR
                     RADALNACDIAVLCLPDAAAREAVGFIRNPAVRVIDASSAHRTQPDWVYGFPEMADGH
                     AQDIAHAKRVTNPGCYPTGAIGLLRPLLQAGLLPRDYPVSIHAVSGYSGGGRAAVDAF
                     ESADAATPPLPLQVYGLALEHKHVPEIRQHAGLAHRPFFVPAYGAYRQGIVLTIPIEL
                     RLLPAGVTGERLHACLAHHYADARHVDVTPLADAAAATHLDPQALNGTNDLRLGVFVN
                     EARGQVLLSAVFDNLGKGASGAAVQNLDLMLGASSAA"
     misc_feature    complement(19570..19884)
                     /gene="argC"
                     /locus_tag="BCAM0018"
                     /note="HMMPfam hit to PF01118, Semialdehyde dehydrogenase,
                     NAD bindin, score 9.8e-11"
                     /inference="protein motif:HMMPfam:PF01118"
     CDS             20018..20902
                     /transl_table=11
                     /locus_tag="BCAM0019"
                     /product="LysR family regulatory protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0019"
                     /db_xref="EnsemblGenomes-Tr:CAR53874"
                     /db_xref="GOA:B4EG05"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="InterPro:IPR036390"
                     /db_xref="UniProtKB/TrEMBL:B4EG05"
                     /protein_id="CAR53874.1"
                     /translation="MREISLDRLRTLVAIADQGSFVAAAQWLHLAPPTVSLHVAELES
                     RVGAPLLSRTRGNVRPSVIGEVLVERARRLLAEVEATLDDVQRQVQGLSGRVRLGAST
                     GAIAHLLPQAVAGLRAQHPDIDVQIAVLTSQDTLARIAQGTLDVGLVALPQAPVAGLS
                     IRPWRRDPVMAFLPADWPLPARVTPAYLAARPLILNDATTRLSRLTTEWFALGGHRPE
                     PRIELNYNDAIKSLVAAGYGATLLPHEAGAPLPDARIVMRPLRPALWRELGIAHRAGP
                     VERATQHVLDALWALGAR"
     misc_feature    20018..20029
                     /note="PS00228 Tubulin-beta mRNA autoregulation signal."
                     /inference="protein motif:Prosite:PS00228"
     misc_feature    20033..20212
                     /locus_tag="BCAM0019"
                     /note="HMMPfam hit to PF00126, Bacterial regulatory
                     helix-turn-helix, score 1.7e-15"
                     /inference="protein motif:HMMPfam:PF00126"
     misc_feature    20072..20137
                     /note="Predicted helix-turn-helix motif with score
                     1158.000, SD 3.13 at aa 19-40, sequence
                     GSFVAAAQWLHLAPPTVSLHVA"
                     /inference="protein motif:helixturnhelix:EMBOSS"
     misc_feature    20075..20167
                     /note="PS00044 Bacterial regulatory proteins, lysR family
                     signature."
                     /inference="protein motif:Prosite:PS00044"
     misc_feature    20282..20896
                     /locus_tag="BCAM0019"
                     /note="HMMPfam hit to PF03466, LysR substrate binding
                     domain, score 8.5e-40"
                     /inference="protein motif:HMMPfam:PF03466"
     CDS             complement(20953..21471)
                     /transl_table=11
                     /locus_tag="BCAM0020"
                     /product="putative membrane protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0020"
                     /db_xref="EnsemblGenomes-Tr:CAR53875"
                     /db_xref="GOA:B4EG06"
                     /db_xref="UniProtKB/TrEMBL:B4EG06"
                     /protein_id="CAR53875.1"
                     /translation="MQRAGMLHAPARPPFRFDMSIFIALFALIALGWGAVHLFHVIAA
                     QFGQPVAIAAAVLAAALLVALIAWWLKRRRDIAPNTKEEGWTHVVHRAWGELRVSATQ
                     GLLWLSHDGADGRYTLSQLDGCEAAPIDGRWHLVVRVRDAVRGEWKLPMMDKRDAQRW
                     ARVLTLAKDNRL"
     misc_feature    complement(join(21262..21330,21343..21411))
                     /locus_tag="BCAM0020"
                     /note="2 probable transmembrane helices predicted for
                     BCAM0020 by TMHMM2.0 at aa 21-43 and 48-70"
                     /inference="protein motif:TMHMM:2.0"
     CDS             complement(21478..22662)
                     /transl_table=11
                     /locus_tag="BCAM0021"
                     /product="putative patatin-like phospholipase"
                     /db_xref="EnsemblGenomes-Gn:BCAM0021"
                     /db_xref="EnsemblGenomes-Tr:CAR53876"
                     /db_xref="GOA:B4EG07"
                     /db_xref="InterPro:IPR002641"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="InterPro:IPR021095"
                     /db_xref="UniProtKB/TrEMBL:B4EG07"
                     /protein_id="CAR53876.1"
                     /translation="MDAADLHHEAGAPAAARSLPYETIALVLQGGGALGAYQAGVFEG
                     LHEAGIPLDWIAGISIGALNTALIAGNAPEHRVERLREFWETICQPAFFPTIPAAFEF
                     ALFNSIDQVRTFFTASQAASAMMQGQQGFFVPRFPPPLPGVSDHPEKISWYDTSALRA
                     TLLKLCDFDRINSGETRVSVGAVNVGTGNFVYFDNSRIRLAPEHFMASGALPPAFPPV
                     EIDGEYYWDGGVVSNTPLMEVLRARPRRDTLAFQVDLWSARGPLPRTMADVAERTKDV
                     QYSSRTRFVTDTLQREQRYRNVLRHVLEQVPEEQRKNDPWCVEAEAMSSGKKYNIQHL
                     IYQQKAYEHHYKDYQFGLSTMRDHWSAGLDDIRKTLAVKDGLALPVNDAGFVTHDIHR
                     RR"
     misc_feature    complement(21943..22587)
                     /locus_tag="BCAM0021"
                     /note="HMMPfam hit to PF01734, Patatin-like phospholipase,
                     score 1.4e-21"
                     /inference="protein motif:HMMPfam:PF01734"
     CDS             complement(22692..23477)
                     /transl_table=11
                     /locus_tag="BCAM0022"
                     /product="putative D-beta-hydroxybutyrate dehydrogenase"
                     /db_xref="EnsemblGenomes-Gn:BCAM0022"
                     /db_xref="EnsemblGenomes-Tr:CAR53877"
                     /db_xref="GOA:B4EG08"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR011294"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="PDB:4TRR"
                     /db_xref="UniProtKB/TrEMBL:B4EG08"
                     /protein_id="CAR53877.1"
                     /translation="MSNLNGKTAVVTGAASGIGKEIALELAKAGAAVAIADLNQDGAN
                     AVADEINKAGGKAIGVAMDVTNEEAVNTGIDKVAEAFGSVDILVSNAGIQIVNPIENY
                     SFADWKKMQAIHVDGAFLTTKAALKHMYKDDRGGVVIYMGSVHSHEASPLKSAYVTAK
                     HGLLGLARVLAKEGAKHNVRSHVVCPGFVRTPLVDKQIPEQAKELGISEEEVIKKVML
                     GNTVDGVFTTVQDVAQTVLFLSAFPSAALTGQSFIVSHGWFMQ"
     misc_feature    complement(22953..23459)
                     /locus_tag="BCAM0022"
                     /note="HMMPfam hit to PF00106, short chain dehydrogenase,
                     score 5.9e-30"
                     /inference="protein motif:HMMPfam:PF00106"
     misc_feature    complement(22965..23051)
                     /note="PS00061 Short-chain dehydrogenases/reductases
                     family signature."
                     /inference="protein motif:Prosite:PS00061"
     CDS             complement(23530..24270)
                     /transl_table=11
                     /gene="adc"
                     /locus_tag="BCAM0023"
                     /product="acetoacetate decarboxylase"
                     /EC_number="4.1.1.4"
                     /db_xref="EnsemblGenomes-Gn:BCAM0023"
                     /db_xref="EnsemblGenomes-Tr:CAR53878"
                     /db_xref="GOA:B4EG09"
                     /db_xref="InterPro:IPR010451"
                     /db_xref="InterPro:IPR023375"
                     /db_xref="InterPro:IPR023653"
                     /db_xref="UniProtKB/Swiss-Prot:B4EG09"
                     /protein_id="CAR53878.1"
                     /translation="MKPSDVRSKAFAMPLTSPAFPMGPYRFVDREFLIITYRTDPDRL
                     REIVPEPLQVTEPLVHYEFIRMADSTGFGDYTESGQVIPVEYNGQAGGYTLAMYLDDH
                     PPIAGGRELWGFPKKLASPTLHVNTDHILGTLDYGKVRVATGTMGYKHKELDIDEQTK
                     RLAGPNFLLKIIPHVDGTARVCELVRYYMQDIKMKGAWTGPASLELAPHALAPVADLP
                     VLEIVEARHLVADLTLGLGEVVYDYLAQ"
     misc_feature    complement(23539..24246)
                     /gene="adc"
                     /locus_tag="BCAM0023"
                     /note="HMMPfam hit to PF06314, Acetoacetate decarboxylase
                     (ADC), score 5.2e-159"
                     /inference="protein motif:HMMPfam:PF06314"
     CDS             24705..25286
                     /transl_table=11
                     /locus_tag="BCAM0024"
                     /product="putative undecaprenyl-diphosphatase"
                     /EC_number="3.6.1.27"
                     /db_xref="EnsemblGenomes-Gn:BCAM0024"
                     /db_xref="EnsemblGenomes-Tr:CAR53879"
                     /db_xref="GOA:B4EG10"
                     /db_xref="InterPro:IPR000326"
                     /db_xref="InterPro:IPR033879"
                     /db_xref="InterPro:IPR036938"
                     /db_xref="UniProtKB/TrEMBL:B4EG10"
                     /protein_id="CAR53879.1"
                     /translation="MQNLNLALFSAINAGGAPHPGVARLAIFAADWLVYALPAMLLLT
                     WIFGARPARHQAIEAGVGVCVALVLAQMLGHVWFSPRPFMAGVGTQLIPHAPDSSFPS
                     DHMTFAWSMAVGLLLGGTTRVTGFVMAAMAVAIAWGRVYAGVHWPFDMAGGVLVGTVG
                     ALAAHLYGQRVTALLERLGDSVHAVVMGRRQAP"
     sig_peptide     24705..24773
                     /locus_tag="BCAM0024"
                     /note="Signal peptide predicted for BCAM0024 by SignalP
                     2.0 HMM (Signal peptide probability 0.618) with cleavage
                     site probability 0.453 between residues 23 and 24"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    join(24783..24851,24870..24938,25023..25091,25128..25196)
                     /locus_tag="BCAM0024"
                     /note="4 probable transmembrane helices predicted for
                     BCAM0024 by TMHMM2.0 at aa 27-49, 56-78, 107-129 and
                     142-164"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    24867..25223
                     /locus_tag="BCAM0024"
                     /note="HMMPfam hit to PF01569, PAP2 superfamily, score
                     3.6e-19"
                     /inference="protein motif:HMMPfam:PF01569"
     CDS             complement(25311..25544)
                     /transl_table=11
                     /locus_tag="BCAM0025"
                     /product="putative membrane protein"
                     /note="no significant database hits"
                     /db_xref="EnsemblGenomes-Gn:BCAM0025"
                     /db_xref="EnsemblGenomes-Tr:CAR53880"
                     /db_xref="GOA:B4EG11"
                     /db_xref="UniProtKB/TrEMBL:B4EG11"
                     /protein_id="CAR53880.1"
                     /translation="MTKESHASPFLRHLKIAGYCGLAAVVLALFVAMCAILKESALDR
                     DAARHPADTPELHDAGGSPSASAESARTSGSSG"
     misc_feature    complement(25431..25499)
                     /locus_tag="BCAM0025"
                     /note="1 probable transmembrane helix predicted for
                     BCAM0025 by TMHMM2.0 at aa 37-59"
                     /inference="protein motif:TMHMM:2.0"
     CDS             complement(25696..26517)
                     /transl_table=11
                     /locus_tag="BCAM0026"
                     /product="putative siderophore-interacting protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0026"
                     /db_xref="EnsemblGenomes-Tr:CAR53881"
                     /db_xref="GOA:B4EG12"
                     /db_xref="InterPro:IPR007037"
                     /db_xref="InterPro:IPR013113"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="InterPro:IPR039261"
                     /db_xref="InterPro:IPR039374"
                     /db_xref="UniProtKB/TrEMBL:B4EG12"
                     /protein_id="CAR53881.1"
                     /translation="MQNTSERTVTRVRHPLKFRLLQVLRVHPVTPHLLRVTLGGPDLA
                     DFESASFDDHVKIFFPPPGAERPALPTLGANGPEFPAGEPKPVARDFTPRRFDRAARE
                     LDLEFVLNHPGPASQWAAQARVGQWLGIGGPRGSFVVPTGFDWHLLIGDDTALPAVAR
                     RLSELPAGARAAVVLEVADRTAQISFDTRADVHEIWRFRAEADAADGDALLNAVRDLP
                     LPSSGDGYVWAAGEALSMRAVRQHLTGERGVDKSRIRAAAYWKRGAAAVHETLED"
     misc_feature    complement(25729..26091)
                     /locus_tag="BCAM0026"
                     /note="HMMPfam hit to PF04954, Siderophore-interacting
                     protein, score 9.6e-42"
                     /inference="protein motif:HMMPfam:PF04954"
     misc_feature    complement(26107..26454)
                     /locus_tag="BCAM0026"
                     /note="HMMPfam hit to PF08021, Siderophore-interacting
                     FAD-binding dom, score 1.9e-55"
                     /inference="protein motif:HMMPfam:PF08021"
     CDS             complement(26556..27263)
                     /transl_table=11
                     /locus_tag="BCAM0027"
                     /product="PadR family regulatory protein"
                     /note="Similar to Rhodopseudomonas palustris
                     transcriptional regulator, padr family SWALL:Q6NB15
                     (EMBL:BX572596) (196 aa) fasta scores: E(): 1.3e-16,
                     42.07% id in 183 aa; homology does not extend to the N
                     terminus"
                     /db_xref="EnsemblGenomes-Gn:BCAM0027"
                     /db_xref="EnsemblGenomes-Tr:CAR53882"
                     /db_xref="InterPro:IPR005149"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="InterPro:IPR036390"
                     /db_xref="UniProtKB/TrEMBL:B4EG13"
                     /protein_id="CAR53882.1"
                     /translation="MRHNHFRGHARCDGHGAHDHPEGFAGLWYAIGRHRRGHDAFGGG
                     PFGGRGGRGFGDFGDDGMPRGRQFSSDDLQLLLLALVAEQPSHGYELIKALDTRSNGF
                     YSPSPGMVYPALTYLEEVGFVASQAEGNRKRYALTDAGRAHLDAQRERVDTLFARLTH
                     LARKMEFMRRAFAGESAGNEAQDESQAGWLPEFVEARLALKRALLHKSAADADEQRRI
                     AAIMRRATAEIEGGAGA"
     misc_feature    complement(26823..27065)
                     /locus_tag="BCAM0027"
                     /note="HMMPfam hit to PF03551, Transcriptional regulator
                     PadR-like family, score 1.5e-28"
                     /inference="protein motif:HMMPfam:PF03551"
     CDS             28013..29074
                     /transl_table=11
                     /locus_tag="BCAM0028"
                     /product="putative FHA-domain protein"
                     /note="no significant database matches"
                     /db_xref="EnsemblGenomes-Gn:BCAM0028"
                     /db_xref="EnsemblGenomes-Tr:CAR53883"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="UniProtKB/TrEMBL:B4EG14"
                     /protein_id="CAR53883.1"
                     /translation="MPGSVDASLERSGRIRHGAAMAILKNDASGDACLLRAYHVFGRD
                     DARCDTVIRDGSVSRVHAHIRWVGGLWELHDHSSNGTSVSGVSLRDGEHAVLQQGDVI
                     RFGRAGIAPWRVESLDDPADTLWPIRGAAAPIVLAPCQILPAPAAQPVTIVRSPAGEW
                     LCDDTLPPRALHDGDEVSTGDFAWRLALARHGSTVMLAAPADPAAPAQLLEFFVSRDE
                     EHVRMLLHVRGGVVDLGERAHHYSLVTLARARSADMQAGYDAATQGWIELDRLARMLG
                     IDASHVNVQIHRARSQFAALPGLGASQLVERRRGSVRFGDVPFRIMRGEHLECESVPA
                     VGPRLGVPRAVPGPVVHCP"
     misc_feature    28127..28327
                     /locus_tag="BCAM0028"
                     /note="HMMPfam hit to PF00498, FHA domain, score 7e-13"
                     /inference="protein motif:HMMPfam:PF00498"
     misc_feature    28808..28873
                     /note="Predicted helix-turn-helix motif with score
                     1097.000, SD 2.92 at aa 266-287, sequence
                     IELDRLARMLGIDASHVNVQIH"
                     /inference="protein motif:helixturnhelix:EMBOSS"
     CDS             29092..33123
                     /transl_table=11
                     /locus_tag="BCAM0029"
                     /product="putative protein kinase"
                     /note="no significant database matches"
                     /db_xref="EnsemblGenomes-Gn:BCAM0029"
                     /db_xref="EnsemblGenomes-Tr:CAR53884"
                     /db_xref="GOA:B4EG15"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR023889"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029787"
                     /db_xref="InterPro:IPR041664"
                     /db_xref="UniProtKB/TrEMBL:B4EG15"
                     /protein_id="CAR53884.1"
                     /translation="MLPTASHPAVRPDAPEPSKRAAPFATLAGKWHYRLGALLGEGGN
                     GVVFRATCDETGHAVALKLMRDDAALVAPERMRRRARFRRETSLCEALRHPNIVALLD
                     QGEAPDGRLFAVFELVEGRTVRDRLAADGPLSAIDTGRLMTQVLDALAAAHRRGIVHR
                     DLKPQNIVIAMADDGPHAKLLDFGIGALLPGTEDIARQTATLATEVLGSPPYCAPEQL
                     RNEPPTPASDLYAWGLIVIECLTGEVVMQGASVAEILYQQLSPVDVALPPSIAALPLG
                     AVLRHALNKNPRQRAASAEALAAQFRALNFAALVGQFDAGRAGRHARSRPLAPRGETI
                     AEVGEYRQITTLCCCVTIAGEGRRRHAGTEHGMVLDGYEEQWLTKCADIAVGYGAHVG
                     GRLGDTLLFHFGLQGDIDRPARRAVRAALDMVRVAERARLPVPPAAGGRAAAGAEEGW
                     RVEVAAAIHVGQVLAQASHMSGVSTPAAASRLLRLAGPGQILISDDARLVLERHADSR
                     PTALRLARAGVVSQPVHELLGERHADTPFDSLDAGRRTPMVGRARELDALLRAWQDTH
                     ERHRRARRGEPAPPGVPRLVIGDAGFGKSRLVHELCEAVRTRGHAFAQCGCLPERENH
                     ALFPVLRFIAAHWQVDADRAPGAALAAIDAMIAPLDCDHAAARVALATWLGLPCDANG
                     LLWSSAREQHALFDVLEQLIVSLGNGAPVLLVIEDVQWLDRSTEEFLAYLQHSPRAAA
                     LCIVLTSRPDKLARWRGATDRVVLRRLPRDDAQRLMSAHLGPGAFDPVWLDRLADRTA
                     GIPLFIEAVARELKVSGADGPLAGPAATDPYPLPLSLGGMLGLAFDRIDDARDTAQLA
                     ATIGLEVDAQLLADASPHDRVTLDAHLRLLLEERIVYAQHRRDRVFYAFRHALIRDAA
                     YESMPPAVRRGNHARIGRALLAQADRGAGAHAFGVAGHFARAGACADAIAHGIDAARR
                     ALERSRYDDAIRYGQAVLDWLATADHAQREHDRARIRATLTHATMARFGWADAQVREH
                     AEQLLRQTQTLDDPELEISALWTLSTYYHVAGDRATVRRIGKRLDTLATERGEAGVQV
                     AADAMRGMSLWVDGDYARARAAFDAVLAGYDVRRDAGHRRILGLDTRAWTMASLASVR
                     WCMDDDPQPALAMAHEAVYRATCLDHLPTLGVTMMYLARTHQLAGDRDAARAVSEAIL
                     RLADAHRLRAVGHYAAIIHAWTQRDRAGVVAHLDAQRQSGGLLGLTYYASLLAELDAE
                     RGDHDAALAQIGQCLAWCESSGERYYEAQLLLKQSEYLCRADPRCGGVAALDACRRAV
                     EIATTAGMGRIARLAEATLQSLP"
     misc_feature    29188..29994
                     /locus_tag="BCAM0029"
                     /note="HMMPfam hit to PF00069, Protein kinase domain,
                     score 4.1e-45"
                     /inference="protein motif:HMMPfam:PF00069"
     misc_feature    29206..29277
                     /note="PS00107 Protein kinases ATP-binding region
                     signature."
                     /inference="protein motif:Prosite:PS00107"
     misc_feature    29560..29598
                     /note="PS00108 Serine/Threonine protein kinases
                     active-site signature."
                     /inference="protein motif:Prosite:PS00108"
     misc_feature    30853..30876
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
                     /inference="protein motif:Prosite:PS00017"
     misc_feature    32353..32430
                     /locus_tag="BCAM0029"
                     /note="HMMPfam hit to PF07721, Tetratricopeptide repeat,
                     score 0.079"
                     /inference="protein motif:HMMPfam:PF07721"
     misc_feature    32620..32697
                     /locus_tag="BCAM0029"
                     /note="HMMPfam hit to PF07721, Tetratricopeptide repeat,
                     score 0.024"
                     /inference="protein motif:HMMPfam:PF07721"
     misc_feature    32839..32916
                     /locus_tag="BCAM0029"
                     /note="HMMPfam hit to PF07721, Tetratricopeptide repeat,
                     score 0.058"
                     /inference="protein motif:HMMPfam:PF07721"
     CDS             33157..33501
                     /transl_table=11
                     /locus_tag="BCAM0030"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0030"
                     /db_xref="EnsemblGenomes-Tr:CAR53885"
                     /db_xref="GOA:B4EG16"
                     /db_xref="InterPro:IPR022261"
                     /db_xref="InterPro:IPR036648"
                     /db_xref="UniProtKB/TrEMBL:B4EG16"
                     /protein_id="CAR53885.1"
                     /translation="MSKDLRLPTYEQFLEYRATVIRAIALAWHSPAFLDKLEADPVHA
                     LREQFDYHFPFKLDLKVQLKSSEWTPTVNGDWTAGQKNRLTLYLPPAPADETQFAQAL
                     AAYNADHITIME"
     CDS             33518..33880
                     /transl_table=11
                     /locus_tag="BCAM0031"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0031"
                     /db_xref="EnsemblGenomes-Tr:CAR53886"
                     /db_xref="GOA:B4EG17"
                     /db_xref="InterPro:IPR022261"
                     /db_xref="InterPro:IPR036648"
                     /db_xref="UniProtKB/TrEMBL:B4EG17"
                     /protein_id="CAR53886.1"
                     /translation="MAKDNANPTLESMLEFQKVYLRAIALSWRDPAFKTELLDRPLDT
                     LAKYFGYQCPWIIDIDIEKTGGDHGWTSDGKGGGSWNLPRNVMTVGIPEQPAHLDEEA
                     VALAAYCDAGPCYLFTCC"
     CDS             33974..36214
                     /transl_table=11
                     /locus_tag="BCAM0032"
                     /product="conserved hypothetical protein"
                     /note="Similar to Streptomyces galilaeus AknN SWALL:Q9L4V1
                     (EMBL:AF264025) (662 aa) fasta scores: E(): 1.3e-37,
                     35.36% id in 673 aa; homology does not extend to termini"
                     /db_xref="EnsemblGenomes-Gn:BCAM0032"
                     /db_xref="EnsemblGenomes-Tr:CAR53887"
                     /db_xref="InterPro:IPR003776"
                     /db_xref="InterPro:IPR022291"
                     /db_xref="InterPro:IPR027624"
                     /db_xref="UniProtKB/TrEMBL:B4EG18"
                     /protein_id="CAR53887.1"
                     /translation="MLDDLSRVLRFKPHLLVLDAGPDTLFVVDEFKRAMLSGAIFVRI
                     AACLRARMTIAEIVASLAGTFGEWDVLARLDHLVRRGYVRADPPHGDDAARGYFERAG
                     LDGDAACARVAQLRVAVETFGADGAPLRRALDTACIGIAKEAELTVAIVDTHDRDDLA
                     ACAARVAARGGALLVVAAGGVQTLIGPLLAGGVDALADAPCVECVRYWIRVNRPVEAL
                     LARHHGRDAKHVPPAASRAGAAAAAALVAATVEQIAVNRAVAERSQTHIVAQRLDTLT
                     VERHRVVRRPQCPCCGHPLWMREQAARAPRLAAPAPLARADGGYRTADPQQVFARHAH
                     LISPVSGAIAYLHPMPKRHAGLRKVYASGFLVCPAAVPDSNRFDRLCSGKGRTDEQAR
                     TSALCEALERFSSVYQGDEATVTGSIDGLRADPACDAEPIHVNALQQFSERQFDARDA
                     INALTRDVRKQVPPRFTSRDVIDWTPAWSLVDGRRRLVPLSYCYAETPDSARAPAACV
                     HNPNGCAAGSSLDEAMLQGMLELIERDAVAIWWYNRIERPGIELASFADPYFDALVHE
                     YAAFGWRVWALDITTDLTVPTVAALAENLQDGRFSIGFGCHPDGRIAVQRALTEVNQL
                     LDIAADAPDPWDRDMLSSTGFLYPAPGTPATTHSTWQPLDIASLPAAIAHCVGRIAAA
                     GMDVLVVDKTRPDIGLSVVQVIAPGLCHFWPRFGARRLYSVPVALGWRARPCDETALN
                     PALLFL"
     misc_feature    35012..36103
                     /locus_tag="BCAM0032"
                     /note="HMMPfam hit to PF02624, YcaO-like family, score
                     7.8e-60"
                     /inference="protein motif:HMMPfam:PF02624"
     CDS             complement(36282..37373)
                     /transl_table=11
                     /locus_tag="BCAM0033"
                     /product="putative outer membrane protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0033"
                     /db_xref="EnsemblGenomes-Tr:CAR53888"
                     /db_xref="GOA:B4EG19"
                     /db_xref="InterPro:IPR023614"
                     /db_xref="InterPro:IPR033900"
                     /db_xref="UniProtKB/TrEMBL:B4EG19"
                     /protein_id="CAR53888.1"
                     /translation="MTKKTFLALAVCTLPAAAFAQSSVTMFGLMDAGISYVSNQGGHG
                     AAKFDDNIFFPNLLGFEGKEDLGAGTRAIFRLVNQYSLGNGSIIGGGLFARTAYVGLQ
                     NDRYGTLTLGNQYEFMVDALAASGSEIAQDLVGLYGFRNGPFDRLALPNNPTGAFDWD
                     RVAGSNRVANSVKYTSPSLSGLTVGALYGFGNVAGSIGANNTVSIGASYDRGPFGAGA
                     AYTNQKYGAAGGLPPTSVRNWGAGVHYTVGTVTGKALVTTVHNARNGAGAWSAEAGAA
                     WRPSPVWVIGASYTYMKGNDTLDNAHAHQLLAAVQYWLSKRTMVYVAGVHQRASHGSN
                     AQINGVMDANGASSGALQSIARVGFSTRF"
     misc_feature    complement(37287..37355)
                     /locus_tag="BCAM0033"
                     /note="1 probable transmembrane helix predicted for
                     BCAM0033 by TMHMM2.0 at aa 7-29"
                     /inference="protein motif:TMHMM:2.0"
     sig_peptide     complement(37314..37373)
                     /locus_tag="BCAM0033"
                     /note="Signal peptide predicted for BCAM0033 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.988 between residues 20 and 21"
                     /inference="protein motif:SignalP:2.0"
     CDS             complement(37551..38273)
                     /transl_table=11
                     /locus_tag="BCAM0034"
                     /product="putative short-chain dehydrogenase"
                     /db_xref="EnsemblGenomes-Gn:BCAM0034"
                     /db_xref="EnsemblGenomes-Tr:CAR53889"
                     /db_xref="GOA:B4EG20"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="UniProtKB/TrEMBL:B4EG20"
                     /protein_id="CAR53889.1"
                     /translation="MNRQWAFDGQSVVVTGGTSGIGARTALRFAQAGASVVALGLDAA
                     GPHAPVHDRIRCVELDVADGAALTRTIAGLPRLGALVNGVGISRHADEYRMDQFEHVL
                     NVNLTSVMRASDAALPALAATGGSIVNIASMYTYFGSKDRPAYSASKGGIAQLTRSLA
                     QAWADHGIRVNAVAPGWIDTPLSSTLMADTQASRRIVERTPLGRWGTTDEVAEVILFL
                     CSPGASFVTGAVVPVDGGYSTV"
     misc_feature    complement(37572..38240)
                     /locus_tag="BCAM0034"
                     /note="HMMPfam hit to PF01370, NAD dependent
                     epimerase/dehydratase family, score 0.00015"
                     /inference="protein motif:HMMPfam:PF01370"
     misc_feature    complement(37782..38246)
                     /locus_tag="BCAM0034"
                     /note="HMMPfam hit to PF00106, short chain dehydrogenase,
                     score 6.6e-15"
                     /inference="protein motif:HMMPfam:PF00106"
     misc_feature    complement(37794..37880)
                     /note="PS00061 Short-chain dehydrogenases/reductases
                     family signature."
                     /inference="protein motif:Prosite:PS00061"
     CDS             complement(38251..39372)
                     /transl_table=11
                     /locus_tag="BCAM0035"
                     /product="putative zinc-binding dehydrogenase"
                     /db_xref="EnsemblGenomes-Gn:BCAM0035"
                     /db_xref="EnsemblGenomes-Tr:CAR53890"
                     /db_xref="GOA:B4EG21"
                     /db_xref="InterPro:IPR002328"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR020843"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="UniProtKB/TrEMBL:B4EG21"
                     /protein_id="CAR53890.1"
                     /translation="MRALQWHGPRDVRLVEIDTPHVGPGDVRIAVEYCGICGSDLHEY
                     ADGPHAIPVDVPHPLSRRTAPLTLGHEFCGTVVEVGAGVTTLRAGDRVAVEPEYRCSQ
                     CAYCRAGSYNLCVSMGFAGLMGDGGMADFAVVPAYMLHRLPDGVSLEQAAVMEPAAVA
                     LHALRRGELRLGETCAVFGLGPIGLLLIMLAKRQGATTIVAVDVSPERLAAATRFGAT
                     HAFDARGLDASALQDAIRATTGGLGVDASFEAAGLQATFESAMRALRKGGRVVMVGLM
                     PHAGFDAFRAVNDELTFTASVGYRHAYEDLLRIVASGALDLTSIVTRTVSLEDAVADG
                     FDALLADRTQIKILVSPAQRPARRATTIGSAEHESSVGV"
     misc_feature    complement(38437..38862)
                     /locus_tag="BCAM0035"
                     /note="HMMPfam hit to PF00107, Zinc-binding dehydrogenase,
                     score 2.5e-42"
                     /inference="protein motif:HMMPfam:PF00107"
     misc_feature    complement(38947..39303)
                     /locus_tag="BCAM0035"
                     /note="HMMPfam hit to PF08240, Alcohol dehydrogenase
                     GroES-like domain, score 1.1e-46"
                     /inference="protein motif:HMMPfam:PF08240"
     misc_feature    complement(39124..39168)
                     /note="PS00059 Zinc-containing alcohol dehydrogenases
                     signature."
                     /inference="protein motif:Prosite:PS00059"
     CDS             complement(39374..40678)
                     /transl_table=11
                     /locus_tag="BCAM0036"
                     /product="Major Facilitator Superfamily protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0036"
                     /db_xref="EnsemblGenomes-Tr:CAR53891"
                     /db_xref="GOA:B4EG22"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="UniProtKB/TrEMBL:B4EG22"
                     /protein_id="CAR53891.1"
                     /translation="MTSPSSSRPAWTYENRLLLILFMTFGFVFFDRLALSFLFPFMSA
                     ELHLTNTQLGMVSSALALTWALSGAATGAWSDARGTRKPLLIAAVLGFSVCSALSGLV
                     GGFASLIAFRALMGIAEGPVLPLSQSLMVESSTPSRRGLNMGLLQGSAAGLLGAMIGP
                     PVVIGIATAYGWREAFYVSCIPGFLIAFCIWRWVREVPPGGVRHAQADTTAAPAAGGA
                     TVSRWALLKERNILLCVLISCFFLTWFVVIISFAPVFLVESRHLSPADMGVVMTCLGA
                     AWVFWGFAVPAISDRIGRKPTMIAFALIAAVCPVVLIHVGSVWALGALVFVTYTGLGC
                     FTLFMATIPAETVPPRAIASALGLIMGAGELIGGFVAPTVAGFAADKYGLQFAMWTST
                     TGAILACVLSFGLVETAPAVLRKRALAGAAAGRLDTQNLGGR"
     misc_feature    complement(39419..40624)
                     /locus_tag="BCAM0036"
                     /note="HMMPfam hit to PF00083, Sugar (and other)
                     transporter, score 8.4e-05"
                     /inference="protein motif:HMMPfam:PF00083"
     misc_feature    complement(join(39461..39529,39557..39625,39659..39727,
                     39740..39793,39812..39880,39923..39991,40097..40156,
                     40169..40237,40361..40429,40457..40516,40553..40621))
                     /locus_tag="BCAM0036"
                     /note="11 probable transmembrane helices predicted for
                     BCAM0036 by TMHMM2.0 at aa 20-42, 55-74, 84-106, 148-170,
                     175-194, 230-252, 267-289, 296-313, 318-340, 352-374 and
                     384-406"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    complement(39482..39514)
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     misc_feature    complement(39539..40618)
                     /locus_tag="BCAM0036"
                     /note="HMMPfam hit to PF07690, Major Facilitator
                     Superfamily, score 5.9e-55"
                     /inference="protein motif:HMMPfam:PF07690"
     misc_feature    complement(39677..39709)
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     misc_feature    complement(40262..40339)
                     /note="PS00217 Sugar transport proteins signature 2."
                     /inference="protein motif:Prosite:PS00217"
     sig_peptide     complement(40496..40678)
                     /locus_tag="BCAM0036"
                     /note="Signal peptide predicted for BCAM0036 by SignalP
                     2.0 HMM (Signal peptide probability 0.880) with cleavage
                     site probability 0.692 between residues 61 and 62"
                     /inference="protein motif:SignalP:2.0"
     CDS             complement(40697..41230)
                     /transl_table=11
                     /gene="dad"
                     /locus_tag="BCAM0037"
                     /product="2,4'-dihydroxyacetophenone dioxygenase"
                     /EC_number="1.13.11.41"
                     /db_xref="EnsemblGenomes-Gn:BCAM0037"
                     /db_xref="EnsemblGenomes-Tr:CAR53892"
                     /db_xref="GOA:B4EG23"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR013096"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="UniProtKB/TrEMBL:B4EG23"
                     /protein_id="CAR53892.1"
                     /translation="MVDKAVSEFWQNIPAIANPFKPDALPEAYIPNAATDDERYYVPF
                     TETVSSRPLWISPSQNKWCDILMAKEAGLVNRHYHPHEVFAYTLSGKWGYLEHEWTAT
                     RGDFVYETPGEGHTLVAFDHPEPMRAFFIVKGPLIWLDDEGNPDGYFDVHSYIAMCKA
                     HYEKVGLGAQAIEKLFR"
     misc_feature    complement(40835..41044)
                     /gene="dad"
                     /locus_tag="BCAM0037"
                     /note="HMMPfam hit to PF07883, Cupin domain, score
                     2.4e-05"
                     /inference="protein motif:HMMPfam:PF07883"
     CDS             41410..42390
                     /transl_table=11
                     /locus_tag="BCAM0038"
                     /product="AraC family regulatory protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0038"
                     /db_xref="EnsemblGenomes-Tr:CAR53893"
                     /db_xref="GOA:B4EG24"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR018060"
                     /db_xref="InterPro:IPR018062"
                     /db_xref="InterPro:IPR020449"
                     /db_xref="InterPro:IPR035418"
                     /db_xref="UniProtKB/TrEMBL:B4EG24"
                     /protein_id="CAR53893.1"
                     /translation="MTNSTVFSRTRGSTADVPARDRMAYWDAFNAATLVGLRCSSLSP
                     AGLEVEKTDIALPGLGIADISGQDHVIERSPALVRQLPKESLFACQILSGRAYFIQRD
                     RCLLAEAGDVVVYDTRVPYLFGFLTPMRQLLIDIPITTLDDRLDAELAALPLRIAPKP
                     GAGAMLGATLRASVERFMKAPVERDAARFAEHTRTLIAALVDAEVNGVGASRASLSYL
                     LTAKQYIATHLGEPELGPQAVADAVGLSLRHLGRLFAAEGESITQHIWSERLSHAHRE
                     LTDARLRKTSIGEIAFRWGFSSQAHFSRAIRERYGASPMALRDAARDAAG"
     misc_feature    42109..42174
                     /note="Predicted helix-turn-helix motif with score
                     1307.000, SD 3.64 at aa 234-255, sequence
                     LGPQAVADAVGLSLRHLGRLFA"
                     /inference="protein motif:helixturnhelix:EMBOSS"
     misc_feature    42214..42351
                     /note="PS00041 Bacterial regulatory proteins, araC family
                     signature."
                     /inference="protein motif:Prosite:PS00041"
     misc_feature    42223..42366
                     /locus_tag="BCAM0038"
                     /note="HMMPfam hit to PF00165, Bacterial regulatory
                     helix-turn-helix protei, score 3.9e-08"
                     /inference="protein motif:HMMPfam:PF00165"
     CDS             complement(42486..44051)
                     /transl_table=11
                     /locus_tag="BCAM0039"
                     /product="putative alcohol dehydrogenase"
                     /note="Similar to Pseudomonas oleovorans alcohol
                     dehydrogenase [acceptor] alkJ SWALL:ALKJ_PSEOL
                     (SWALL:Q00593) (558 aa) fasta scores: E(): 1.4e-76, 41.69%
                     id in 530 aa; contains C terminal 30 amino acid
                     truncation"
                     /db_xref="EnsemblGenomes-Gn:BCAM0039"
                     /db_xref="EnsemblGenomes-Tr:CAR53894"
                     /db_xref="GOA:B4EG25"
                     /db_xref="InterPro:IPR000172"
                     /db_xref="InterPro:IPR007867"
                     /db_xref="InterPro:IPR012132"
                     /db_xref="InterPro:IPR027424"
                     /db_xref="InterPro:IPR036188"
                     /db_xref="UniProtKB/TrEMBL:B4EG25"
                     /protein_id="CAR53894.1"
                     /translation="METYDHIVVGGGSAGCTVAHRLVKAGRRVLLLEDGPKDDSLFIR
                     IPATFIRVLGTQRTVTFESEPQPGAAGRKTYVPQGRTLGGGSSVNAMLYVRGTRDDYD
                     DWAALGCTGWGWDDVLPVFKRAESHLRLSEPFHGTDGPLKVGDTRFRHPLSLAFVKAA
                     QEAGIAYNDDFNGAAQHGVGFYHTTIFDGQRGSTAATYLADAIADPNLRVLTGCRVTR
                     IRFDGRRASGVEWRTASGATGAAVARADVVLAAGALSTPKLLMLSGIGPGAHLHAHGI
                     DVLHDSRDVGAHYQDHLEVSIYGRTQAPVSLLGEDRGWRALRHGLQWMLCRSGLLTSN
                     VVESGAFVDTTGGGRPDIQFHVLPTLVGDVDRAPLPGHGLSINPCLLRPRSRGAVQLR
                     GNDPAAPILFDSGALSDPADVEGLVRGVRLARQILRAPSLARLVREAETLTDAALADY
                     VRRRAKTVYHPAGTCRMGSDAHAVVTPRLAVQGVDGLRICDASVMPRIVSGNTNAPTI
                     MIAERCAAFMLTA"
     misc_feature    complement(42510..42926)
                     /locus_tag="BCAM0039"
                     /note="HMMPfam hit to PF05199, GMC oxidoreductase, score
                     1.2e-43"
                     /inference="protein motif:HMMPfam:PF05199"
     misc_feature    complement(42984..44039)
                     /locus_tag="BCAM0039"
                     /note="HMMPfam hit to PF01266, FAD dependent
                     oxidoreductase, score 0.00025"
                     /inference="protein motif:HMMPfam:PF01266"
     misc_feature    complement(43131..44042)
                     /locus_tag="BCAM0039"
                     /note="HMMPfam hit to PF00732, GMC oxidoreductase, score
                     5.2e-90"
                     /inference="protein motif:HMMPfam:PF00732"
     misc_feature    complement(43254..43298)
                     /note="PS00624 GMC oxidoreductases signature 2."
                     /inference="protein motif:Prosite:PS00624"
     misc_feature    complement(43470..43517)
                     /note="PS00225 Crystallins beta and gamma 'Greek key'
                     motif signature."
                     /inference="protein motif:Prosite:PS00225"
     misc_feature    complement(43746..43817)
                     /note="PS00623 GMC oxidoreductases signature 1."
                     /inference="protein motif:Prosite:PS00623"
     misc_feature    complement(44004..44036)
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     CDS             complement(44210..45178)
                     /transl_table=11
                     /locus_tag="BCAM0040"
                     /product="AraC family regulatory protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0040"
                     /db_xref="EnsemblGenomes-Tr:CAR53895"
                     /db_xref="GOA:B4EG26"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR018060"
                     /db_xref="InterPro:IPR020449"
                     /db_xref="InterPro:IPR035418"
                     /db_xref="UniProtKB/TrEMBL:B4EG26"
                     /protein_id="CAR53895.1"
                     /translation="MPDTSTEIATISTRAVRGAERVDFWVDHVARTLVRIECSGKSSE
                     GIDASLRKRDLGLFRACDIVANRHAVVRTSHNIHADQRDAVFICLMHEGHGYTFQDVD
                     CMQHGPGDLVLYDTSMPYGHGFPADMAMTVLDVPRDVFEARVGPWRYRSLVKIDRDDG
                     VASWAVRQVVALLAAPQEPTPDARERRAAAILELVQSMLRLRDGDASPTKSTVHTLSR
                     AKAFIDSHLADDDLDSRSVSRAINLSPRQLARVFEIEGTPLTRYILARRLERCRADLR
                     DRSLKHLTVSEIAFRWGFNNSAHFSRSYRARFGETPSDTRAPADTR"
     misc_feature    complement(44228..44371)
                     /locus_tag="BCAM0040"
                     /note="HMMPfam hit to PF00165, Bacterial regulatory
                     helix-turn-helix protei, score 3e-06"
                     /inference="protein motif:HMMPfam:PF00165"
     misc_feature    complement(44420..44485)
                     /note="Predicted helix-turn-helix motif with score
                     1078.000, SD 2.86 at aa 232-253, sequence
                     LDSRSVSRAINLSPRQLARVFE"
                     /inference="protein motif:helixturnhelix:EMBOSS"
     CDS             complement(45382..46185)
                     /transl_table=11
                     /locus_tag="BCAM0041"
                     /product="putative lipoprotein"
                     /note="Similar to Erwinia carotovora putative exported
                     protein SWALL:Q6D2K7 (EMBL:BX950851) (253 aa) fasta
                     scores: E(): 2.1e-21, 37.61% id in 218 aa"
                     /db_xref="EnsemblGenomes-Gn:BCAM0041"
                     /db_xref="EnsemblGenomes-Tr:CAR53896"
                     /db_xref="UniProtKB/TrEMBL:B4EG27"
                     /protein_id="CAR53896.1"
                     /translation="MIHLARRSRAARHVRPLATTIAALLACAPAVSFAGWYEIANYTG
                     TIGNAPVHVSLQTYDAINHNDAGRWRVDGSYYYDAHRKPIPLRGQREPDGRLTLCEAS
                     SPASNADAPVVPAASPSRPKPCPIALTVSGKAATGTWDDGRKTLPITLNEVGRLNDTD
                     DPHPQLDGSVDIPMWYRTKTHMLVGVYALSDKCGVAMQSLRAVNIATGRVDRTIALDC
                     DAGMVMTSIYANVTGAHWADHVSVEFRDGKMGYAEDVSLGLPSSSSKPK"
     misc_feature    complement(46066..46125)
                     /locus_tag="BCAM0041"
                     /note="1 probable transmembrane helix predicted for
                     BCAM0041 by TMHMM2.0 at aa 21-40"
                     /inference="protein motif:TMHMM:2.0"
     sig_peptide     complement(46084..46185)
                     /locus_tag="BCAM0041"
                     /note="Signal peptide predicted for BCAM0041 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.908 between residues 34 and 35"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    complement(46105..46137)
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     CDS             complement(46349..47296)
                     /transl_table=11
                     /locus_tag="BCAM0042"
                     /product="putative aldo/keto reductase"
                     /db_xref="EnsemblGenomes-Gn:BCAM0042"
                     /db_xref="EnsemblGenomes-Tr:CAR53897"
                     /db_xref="GOA:B4EG28"
                     /db_xref="InterPro:IPR020471"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="InterPro:IPR036812"
                     /db_xref="UniProtKB/TrEMBL:B4EG28"
                     /protein_id="CAR53897.1"
                     /translation="MAHRTLGTSGIQVSPLAFGGNVFGWTVDENASFALLDALADTGI
                     NFIDTADVYSAWVPGNHGGESETIIGKWLKRSGKREQVVIATKVGLLDARAGLSKDNI
                     LKAVDDSLRRLQTDYIDLYFSHRDLVDTAPLEETLGAYQTLIDAGKVRIIGASNYSGA
                     RLREAAAISARDGLPAYQVIQPEYNLLDRADYERDLEPVVRDLKLGVVNYYALASGFL
                     SGKYRSEADLKKSVRGDRVAGYLNARGLRILAALDAVSAKHNTQPAAIALAWQIARPT
                     ITAPIASATSLAQLALLGEAIRVTLDQDDIRRIDEASAP"
     misc_feature    complement(46355..47278)
                     /locus_tag="BCAM0042"
                     /note="HMMPfam hit to PF00248, Aldo/keto reductase family,
                     score 2.6e-51"
                     /inference="protein motif:HMMPfam:PF00248"
     CDS             47652..50156
                     /transl_table=11
                     /locus_tag="BCAM0043"
                     /product="conserved hypothetical protein"
                     /note="Similar to Ralstonia solanacearum putative
                     vgr-related protein rs03020 SWALL:Q8XTK5 (EMBL:AL646076)
                     (885 aa) fasta scores: E(): 6.7e-86, 51.59% id in 814 aa;
                     homology does not extend to C terminus"
                     /db_xref="EnsemblGenomes-Gn:BCAM0043"
                     /db_xref="EnsemblGenomes-Tr:CAR53898"
                     /db_xref="InterPro:IPR006533"
                     /db_xref="InterPro:IPR017847"
                     /db_xref="InterPro:IPR018769"
                     /db_xref="InterPro:IPR028244"
                     /db_xref="InterPro:IPR037026"
                     /db_xref="UniProtKB/TrEMBL:B4EG29"
                     /protein_id="CAR53898.1"
                     /translation="MADLAAFIRTPFFLQDKRLLALSFPHDDAPSVTDAYGRQRPARL
                     VAERLVAHEGLGIDFTFDVTLLSSEAGITLADMLGKLLAVSMVRPDGGLRYFTGYCTA
                     FSLVRNDDSIAEYRAVLRPWSHFLRTRVNNRLFLGQSLQQQIGTLLADYQGLAPSWEW
                     RVRGDDPARTMNVQGGGLGESDWNYIVRHLEAVGFLYWWEHDEKGLKLIVGDDSTVQC
                     PAVDGRSPVIRFQTHDGPMAADAISQWSAVRSLSAGSYSATAFDFKAPHAAHAQIPTL
                     HPPGVAPQVEHHEYVGHYGFAKQTRAGDALARVRMEEIEAAATRFDAAGNHHGILPGR
                     WFQLSDHFSAASGSPQDHEYLILEARHEAANNYLQADGKPEYRNRFVAGHRRTPWRPG
                     RGFNSEPVRVLAPQTATVAGAKGAGSVDVDEYGRVCIVYHWDRAAQISARIRVAAGWA
                     GGEKGMIAHPRVGSEVLVMCLDGNPDRPVVSGTTYNAERMPPWALPDQHVLTGLRSRE
                     LSGDSGNAAGGRSNHVLLDDTPQQLQLKLRSDTDASELTLGHNVRIDATQGRTDQRAR
                     GFELRTDAHGAVRAAKGLLVTSEARYDARAHATDIGETVARLDKAHDLHESLSGSAHD
                     VKAQESGDQDAVHQALRTQNDGLRGSGGNPQQGEFPEFAQPFLALASPAGILATTTGS
                     THVASDQHVALTSGAHTSIGAGKSMLVSAQQAVRVAAFEKGIRLVAAAADIDIQALKD
                     SINVLAKLDVKVDANRITITAKEEVLINGGTSYTRWNGSGIVHGTKGEFTAHAASHTF
                     IGPDSLPVPARAFPGTACAPCMVNAASMASPFAAKA"
     misc_feature    48864..49091
                     /locus_tag="BCAM0043"
                     /note="HMMPfam hit to PF04524, Protein of unknown
                     function, DUF586, score 4.8e-21"
                     /inference="protein motif:HMMPfam:PF04524"
     CDS             50170..51072
                     /transl_table=11
                     /locus_tag="BCAM0044"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0044"
                     /db_xref="EnsemblGenomes-Tr:CAR53899"
                     /db_xref="InterPro:IPR025391"
                     /db_xref="UniProtKB/TrEMBL:B4EG30"
                     /protein_id="CAR53899.1"
                     /translation="MTNDPTAAQAADALQAALSSQDGLRAYVLIDGALLDTLPDDEKA
                     SWPAFVAASLLDDADDEARIVGPLLFEWQPGADGADAADAIEARSIPWPAASVLVSPL
                     SLARLAAHLAPMVDVQLEQMESVMLMRFFDPRVLPFWLDMLPAAHRAYLAQGVRHWIH
                     RDTALQLRTADIAAPADVRQAAEFPLQLTQAEEDELLAACYPYTMLERLRVEKPGLLA
                     SLPAARHYDFVRDQLARCRAHGADSAASLLIYCELALRYGARFDEDPAMAAVFDAVAQ
                     GQAFPEALARVPAEDWRRMQEAAA"
     CDS             51129..51806
                     /transl_table=11
                     /locus_tag="BCAM0045"
                     /product="putative lipoprotein"
                     /note="no significant database matches"
                     /db_xref="EnsemblGenomes-Gn:BCAM0045"
                     /db_xref="EnsemblGenomes-Tr:CAR53900"
                     /db_xref="UniProtKB/TrEMBL:B4EG31"
                     /protein_id="CAR53900.1"
                     /translation="MNRCWITLLSVMVFSTAACSKSVNDAEKDSLAPGEVNKWNDPNY
                     DVITAGSFNYTDYDIYGVYLLPPDKNSLDDAASADGAHATPRNAKYWSGGGGSRPSLA
                     WDFRWKTPKTFKVWWERVVDKRAMEASSANYDPYTHRETQPGMAWCEGEITVTRPPVK
                     DKSGGIVLHFFPDGRVEGDMDFEVDGPDPKVALSKRDAQHKLADRACLKEIPNPFYGR
                     KKPAQWN"
     sig_peptide     51129..51188
                     /locus_tag="BCAM0045"
                     /note="Signal peptide predicted for BCAM0045 by SignalP
                     2.0 HMM (Signal peptide probability 0.988) with cleavage
                     site probability 0.600 between residues 20 and 21"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    51153..51185
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     CDS             51843..53576
                     /transl_table=11
                     /locus_tag="BCAM0046"
                     /product="hypothetical protein"
                     /note="Weakly similar to Chromobacterium violaceum
                     hypothetical protein SWALL:Q7P249 (EMBL:AE016910) (512 aa)
                     fasta scores: E(): 2.5e-11, 30.85% id in 512 aa"
                     /db_xref="EnsemblGenomes-Gn:BCAM0046"
                     /db_xref="EnsemblGenomes-Tr:CAR53901"
                     /db_xref="InterPro:IPR018712"
                     /db_xref="UniProtKB/TrEMBL:B4EG32"
                     /protein_id="CAR53901.1"
                     /translation="MSNPPLIRRITDITPVEDSIRHAHREALDPLRVEQCKECPKPVW
                     FTAFFDGTGNNYGEDGNGSTDVARTKYSNIAKLAMFAHVPFNKANPRTMGRYVEGVGT
                     PCSKVGDSGKGLDGVLGMAAASKGEARIRWMLRELEKHVTNHMPAVSQINVAAFGFSR
                     GATEARAFVRMLTEQLAENIGGRLWWNKKNMKGMRPEVVVYFMGILDTVASTGFGGSR
                     LEKAAPYIVGAILGPVYGGVLHGIDKGGHAEWANDIRIPDYVRQCVHYVASHEVREKF
                     PGDSVREDQKLPANCREVYYPGMHSDVGGGYERNYQEGRTNELANVALNNLFIEAWKA
                     GVPFREPKDVMETAGGLFAISRELEAAWNVYMGQGNERRAGVASNSDRLESQIIWHMN
                     RYYQWRASRSRRLHDGRLKPPGGVDPHMAITDGEWNEDADAVRRANGGILTRTISEQY
                     KAIDAATRVTGNWLGGIDPAARATFDRFFDHYVHDSIAGFKKQMEDGYAGFAEASRWS
                     VNRQYFMGKRGKKFLYWRYEGDKAEQAATQLAKADPAKQQDPMAANEPQLASNQPAAV
                     GGTLPDATSTA"
     CDS             complement(53657..54277)
                     /transl_table=11
                     /locus_tag="BCAM0047"
                     /product="putative transporter-LysE family"
                     /db_xref="EnsemblGenomes-Gn:BCAM0047"
                     /db_xref="EnsemblGenomes-Tr:CAR53902"
                     /db_xref="GOA:B4EG33"
                     /db_xref="InterPro:IPR001123"
                     /db_xref="UniProtKB/TrEMBL:B4EG33"
                     /protein_id="CAR53902.1"
                     /translation="MNWLAFSHGAALCASLIVTIGAQNAFVLRQGIMRSHVGKIVLLC
                     AVSDMILIGAGVGGASVLVERYPTFVHAVLYVGLAYLAWFGINALRRAFKPGHDTLDV
                     RGDAVAPPPQSALAIVLMTLAFTWLNPHVYLDTFLLIGTAGAREPEGGRLAFAIGAMT
                     ASVVWFLGLGYGARLLAPWFRKAVAWRVLDGAIGSMVLFLAAVQLR"
     misc_feature    complement(join(53663..53731,53750..53818,53846..53914,
                     54011..54079,54092..54160,54197..54265))
                     /locus_tag="BCAM0047"
                     /note="6 probable transmembrane helices predicted for
                     BCAM0047 by TMHMM2.0 at aa 5-27, 40-62, 67-89, 122-144,
                     154-176 and 183-205"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    complement(53663..54238)
                     /locus_tag="BCAM0047"
                     /note="HMMPfam hit to PF01810, LysE type translocator,
                     score 4.1e-44"
                     /inference="protein motif:HMMPfam:PF01810"
     sig_peptide     complement(54197..54277)
                     /locus_tag="BCAM0047"
                     /note="Signal peptide predicted for BCAM0047 by SignalP
                     2.0 HMM (Signal peptide probability 0.930) with cleavage
                     site probability 0.410 between residues 27 and 28"
                     /inference="protein motif:SignalP:2.0"
     CDS             54388..55281
                     /transl_table=11
                     /locus_tag="BCAM0048"
                     /product="LysR family regulatory protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0048"
                     /db_xref="EnsemblGenomes-Tr:CAR53903"
                     /db_xref="GOA:B4EG34"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="InterPro:IPR017685"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="InterPro:IPR036390"
                     /db_xref="UniProtKB/TrEMBL:B4EG34"
                     /protein_id="CAR53903.1"
                     /translation="MLDYALLDALAAVIRHGSFERAAKELNVTPSAVSQRVKLLEERV
                     GSVLVKRGQPCVATTSGALLCRHTERVQLLEAELGGRMPALPGQIASAWPTLRVAVND
                     DSVATWFIDAVGPFCTERETLLDLVIDDQDYTASRIRDGSVQGAVTAQAEPIQGCRSE
                     RLGRIRYRAVCSPAFYARYFDAGITRDALRRAPCVMFNPKDGLQARFIRRVTRADLDP
                     PQHWIPHVAGYLRACETGLGWGMCPDRMVDRQLAAGELIDMSRGRTIDIDLYWQSWRL
                     SIGWLDDFSAALKARAALFLD"
     misc_feature    54397..54576
                     /locus_tag="BCAM0048"
                     /note="HMMPfam hit to PF00126, Bacterial regulatory
                     helix-turn-helix, score 1.5e-14"
                     /inference="protein motif:HMMPfam:PF00126"
     misc_feature    54436..54501
                     /note="Predicted helix-turn-helix motif with score
                     2002.000, SD 6.01 at aa 17-38, sequence
                     GSFERAAKELNVTPSAVSQRVK"
                     /inference="protein motif:helixturnhelix:EMBOSS"
     misc_feature    54439..54531
                     /note="PS00044 Bacterial regulatory proteins, lysR family
                     signature."
                     /inference="protein motif:Prosite:PS00044"
     misc_feature    54529..54564
                     /note="PS00070 Aldehyde dehydrogenases cysteine active
                     site."
                     /inference="protein motif:Prosite:PS00070"
     misc_feature    54652..55266
                     /locus_tag="BCAM0048"
                     /note="HMMPfam hit to PF03466, LysR substrate binding
                     domain, score 9.1e-09"
                     /inference="protein motif:HMMPfam:PF03466"
     CDS             complement(55330..56076)
                     /transl_table=11
                     /locus_tag="BCAM0049"
                     /product="CRP family regulatory protein"
                     /note="Similar to Escherichia coli, Escherichia coli O6,
                     Escherichia coli O157:H7, and Shigella flexneri fumarate
                     and nitrate reduction regulatory protein fnR
                     SWALL:FNR_ECOLI (SWALL:P03019) (250 aa) fasta scores: E():
                     4.2e-35, 42.92% id in 226 aa; homology does not extend to
                     N terminus"
                     /db_xref="EnsemblGenomes-Gn:BCAM0049"
                     /db_xref="EnsemblGenomes-Tr:CAR53904"
                     /db_xref="GOA:B4EG35"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="InterPro:IPR012318"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR018335"
                     /db_xref="InterPro:IPR018490"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="InterPro:IPR036390"
                     /db_xref="UniProtKB/TrEMBL:B4EG35"
                     /protein_id="CAR53904.1"
                     /translation="MLTPVATRPAATPHAGSWAPRQAAHCSSCAMRHLCMPQGLAPEA
                     LSRLESVICAARPVKRGEALFREGDAFDNLYAVRSGSLKTVATRHDGREQVTGLHLAG
                     EALGLDGICDDTHPRTAVALEDSSVCVIPYSALKTLCSEAGSMQLRMHKLMSEQIVRE
                     TSQTMLLGSLNAEERVAAFLLDVSSRYLKRGYSPSEFNLRMTREDIGSYLGMTLETVS
                     RTLSKFQKRGLIEMQGRHVQIIDFDGLQHL"
     misc_feature    complement(55387..55482)
                     /locus_tag="BCAM0049"
                     /note="HMMPfam hit to PF00325, Bacterial regulatory
                     proteins, crp famil, score 8.8e-15"
                     /inference="protein motif:HMMPfam:PF00325"
     misc_feature    complement(55405..55476)
                     /note="PS00042 Bacterial regulatory proteins, crp family
                     signature."
                     /inference="protein motif:Prosite:PS00042"
     misc_feature    complement(55411..55476)
                     /note="Predicted helix-turn-helix motif with score
                     1625.000, SD 4.72 at aa 201-222, sequence
                     MTREDIGSYLGMTLETVSRTLS"
                     /inference="protein motif:helixturnhelix:EMBOSS"
     misc_feature    complement(55645..55914)
                     /locus_tag="BCAM0049"
                     /note="HMMPfam hit to PF00027, Cyclic nucleotide-binding
                     domain, score 4.9e-21"
                     /inference="protein motif:HMMPfam:PF00027"
     CDS             complement(56180..56647)
                     /transl_table=11
                     /locus_tag="BCAM0050"
                     /product="universal stress-related protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0050"
                     /db_xref="EnsemblGenomes-Tr:CAR53905"
                     /db_xref="InterPro:IPR006015"
                     /db_xref="InterPro:IPR006016"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:B4EG36"
                     /protein_id="CAR53905.1"
                     /translation="MYKRILVAVDGSDTSRHAFDAALALAKAHGAELQPFYVVENAAI
                     YYNVPGYDPSVLRDQLVAQGNTLAQDFAKRMQAAGVKGETRLNEATSLNDVSSLILDG
                     AKAFGADLLVLGTHGRRGFRRLVLGSIAEQCVRHATLPVLLIPAAANADEPAA"
     misc_feature    complement(56213..56647)
                     /locus_tag="BCAM0050"
                     /note="HMMPfam hit to PF00582, Universal stress protein
                     family, score 8.1e-24"
                     /inference="protein motif:HMMPfam:PF00582"
     CDS             complement(57156..57563)
                     /transl_table=11
                     /locus_tag="BCAM0050a"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0050a"
                     /db_xref="EnsemblGenomes-Tr:CAR53906"
                     /db_xref="InterPro:IPR021551"
                     /db_xref="UniProtKB/TrEMBL:B4EG37"
                     /protein_id="CAR53906.1"
                     /translation="MESSAQTGRAHPRSVELDNDDTHDSTVDTDGKHREASRLAGAGP
                     ISPDQITRSNASLVNAMPEAGDGFAGFDSRPDGNHPAFALRAGYRVIEKGFDTPPADD
                     APFGPVHRMYGSAYWPGHGRRPERVIELTAVPG"
     CDS             57842..58075
                     /transl_table=11
                     /locus_tag="BCAM0052"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0052"
                     /db_xref="EnsemblGenomes-Tr:CAR53907"
                     /db_xref="UniProtKB/TrEMBL:B4EG38"
                     /protein_id="CAR53907.1"
                     /translation="MQATTAFTHRGYLLNCAPARASDGSFKPYVVISRSSDGELVANR
                     FFPIELQFNDEGDAIAHARDWAVRWIDASSISM"
     CDS             58213..59133
                     /transl_table=11
                     /gene="srpH"
                     /locus_tag="BCAM0053"
                     /product="serine acetyltransferase"
                     /EC_number="2.3.1.30"
                     /db_xref="EnsemblGenomes-Gn:BCAM0053"
                     /db_xref="EnsemblGenomes-Tr:CAR53908"
                     /db_xref="GOA:B4EG39"
                     /db_xref="InterPro:IPR001451"
                     /db_xref="InterPro:IPR005881"
                     /db_xref="InterPro:IPR011004"
                     /db_xref="InterPro:IPR042122"
                     /db_xref="UniProtKB/TrEMBL:B4EG39"
                     /protein_id="CAR53908.1"
                     /translation="MSTSPARQWGLEEIVAGLRESREELHRTRHPRGIRELPSRDAIC
                     KIVTGLRASMFPTHYGAPDLTDESVDYYVGHTLESTLRILSEQIRRALPFLPEHVDTP
                     FAELDERAFEIAREFGRQLPAIRALLVSDIQAAYAGDPAAQHITEILLCYPGVLAMMH
                     HRLAHALHQLGVPLLARFINEIAHSATGIDIHPGAQIGPSFFIDHGTGVVIGETAIIG
                     ERVRVYQAVTLGAKSFPADGDGALVKGNARHPIVEDDVVIYAGATILGRVTIGRGSVI
                     GGNVWLTHSVPPGTSVAQGKVREGGSAEKP"
     misc_feature    58834..58887
                     /gene="srpH"
                     /locus_tag="BCAM0053"
                     /note="HMMPfam hit to PF00132, Bacterial transferase
                     hexapeptide (three rep, score 0.52"
                     /inference="protein motif:HMMPfam:PF00132"
     misc_feature    58957..59010
                     /gene="srpH"
                     /locus_tag="BCAM0053"
                     /note="HMMPfam hit to PF00132, Bacterial transferase
                     hexapeptide (three rep, score 11"
                     /inference="protein motif:HMMPfam:PF00132"
     misc_feature    59011..59064
                     /gene="srpH"
                     /locus_tag="BCAM0053"
                     /note="HMMPfam hit to PF00132, Bacterial transferase
                     hexapeptide (three rep, score 8.6"
                     /inference="protein motif:HMMPfam:PF00132"
     CDS             complement(59296..60099)
                     /transl_table=11
                     /locus_tag="BCAM0054"
                     /product="putative short-chain dehydrogenase"
                     /db_xref="EnsemblGenomes-Gn:BCAM0054"
                     /db_xref="EnsemblGenomes-Tr:CAR53909"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="UniProtKB/TrEMBL:B4EG40"
                     /protein_id="CAR53909.1"
                     /translation="MEQTKQTAHAPVVLVTGAARRAGRAFAEYFAAHGYRTAVHYDRS
                     ADAAQAAARAIAERGHDSVALQADLSDAAQITTLIDQVYARFGRLDVLVNNASVFWQD
                     HFPSFDLAAFDQAWAVNCRAPILLTRAFYERARAAGTQGVVVNVVDQKIKENFHRDHF
                     SYTVAKAALGNLTQMLALSSAPVLRVNAVFPGLMLPSDDQTQADFEHASRASTPLARI
                     AGPDDVASAILLLTGNAYNGVDFVVDAGQNLIRVDQDVLYKHRSPDGKH"
     misc_feature    complement(59557..60069)
                     /locus_tag="BCAM0054"
                     /note="HMMPfam hit to PF00106, short chain dehydrogenase,
                     score 1e-07"
                     /inference="protein motif:HMMPfam:PF00106"
     CDS             complement(60099..60734)
                     /transl_table=11
                     /gene="folE"
                     /locus_tag="BCAM0055"
                     /product="GTP cyclohydrolase I"
                     /EC_number="3.5.4.16"
                     /db_xref="EnsemblGenomes-Gn:BCAM0055"
                     /db_xref="EnsemblGenomes-Tr:CAR53910"
                     /db_xref="GOA:B4EG41"
                     /db_xref="InterPro:IPR001474"
                     /db_xref="InterPro:IPR018234"
                     /db_xref="InterPro:IPR020602"
                     /db_xref="UniProtKB/TrEMBL:B4EG41"
                     /protein_id="CAR53910.1"
                     /translation="MGKGKKSARPEAVASRPSREEAEDAVRVLLRWAGDDPAREGLLD
                     TPARVVRAYEQFFAGYALDPRDILARTFSEVDGYDEMIVLKDIRFESYCEHHMVPIIG
                     RAHVAYLPNHRVVGISKLARLVDAFAKRLQIQEKMTVQIADTLFDVLQPKGVGVILEA
                     AHQCISTRGVHKPGVEMVTSRMLGTFRTDPSTRREFLSIVANPSSVNLTNT"
     misc_feature    complement(60183..60497)
                     /gene="folE"
                     /locus_tag="BCAM0055"
                     /note="HMMPfam hit to PF01227, GTP cyclohydrolase I, score
                     5.1e-44"
                     /inference="protein motif:HMMPfam:PF01227"
     misc_feature    complement(60447..60497)
                     /note="PS00859 GTP cyclohydrolase I signature 1."
                     /inference="protein motif:Prosite:PS00859"
     CDS             complement(60830..61756)
                     /transl_table=11
                     /locus_tag="BCAM0056"
                     /product="LysR family regulatory protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0056"
                     /db_xref="EnsemblGenomes-Tr:CAR53911"
                     /db_xref="GOA:B4EGI0"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="InterPro:IPR036390"
                     /db_xref="UniProtKB/TrEMBL:B4EGI0"
                     /protein_id="CAR53911.1"
                     /translation="MDALDLNLIPYLVALDDARNVSRAGDLLGVSQPRVSTALGRLRE
                     YFGDPLFVRTSRGMEPTPRALALLPAARDALAQIERGLVAPHDFDPAASTHTFSIALS
                     DVGEIVFLPKLLQAFATHAPHANLRSVSLAHDEVGRGLEAGSIDLAVGYFPDLDGNNF
                     FQQRLFTHRFVCLMRRGHPFEQTPPFTVEQFLACGHAVVRAEGRSQEVLEKYLAKQRM
                     QRRAVLETPHFMSLPFILSRTDLIATVPHAIGYAYAAEHAFIVPVEPPLALPRFDLKQ
                     HWHRKYHNDPRTAWLRGVVASLFNDEQDEWPK"
     misc_feature    complement(60857..61489)
                     /locus_tag="BCAM0056"
                     /note="HMMPfam hit to PF03466, LysR substrate binding
                     domain, score 3.5e-23"
                     /inference="protein motif:HMMPfam:PF03466"
     misc_feature    complement(61562..61741)
                     /locus_tag="BCAM0056"
                     /note="HMMPfam hit to PF00126, Bacterial regulatory
                     helix-turn-helix, score 1.4e-18"
                     /inference="protein motif:HMMPfam:PF00126"
     misc_feature    complement(61637..61702)
                     /note="Predicted helix-turn-helix motif with score
                     1285.000, SD 3.56 at aa 19-40, sequence
                     RNVSRAGDLLGVSQPRVSTALG"
                     /inference="protein motif:helixturnhelix:EMBOSS"
     CDS             61873..63105
                     /transl_table=11
                     /gene="pobA"
                     /gene_synonym="pobB"
                     /gene_synonym="phbH"
                     /locus_tag="BCAM0057"
                     /product="p-hydroxybenzoate hydroxylase"
                     /EC_number="1.14.13.2"
                     /db_xref="EnsemblGenomes-Gn:BCAM0057"
                     /db_xref="EnsemblGenomes-Tr:CAR53912"
                     /db_xref="GOA:B4EGI1"
                     /db_xref="InterPro:IPR002938"
                     /db_xref="InterPro:IPR012733"
                     /db_xref="InterPro:IPR036188"
                     /db_xref="UniProtKB/TrEMBL:B4EGI1"
                     /protein_id="CAR53912.1"
                     /translation="MRTQVAIIGAGPSGLLLSHLLRLQGVDSILVEARSREYCENRIR
                     AGVLEQGTVDTLNEAGLGDRMRREGLEHHGIELLFDGQRHRIDLSELTGGRAITVYSQ
                     HEVVRDLIAAGVEHGHQMHFEVSDVALHDVESERPFVTFKHADGRADRIDCDYIAGCD
                     GFHGIARQTIPADRLNTFERVYPFAWLGILADAAPSLDELVYAHHDNGFALFSMRSPT
                     VTRLYLQCKPDEDLAEWSDARIWDELHTRFSNDTGWTPTEGRITQKSVTPMRSFVSET
                     MQHGRLFLAGDAAHIVPPTGAKGMNLAVADVRALSRALGARYRTGDATPLERYSATCL
                     ERVWRAEHFSYFMTNMLHASPDDSPFVNRLKFAELKYVTRSRAAAQSLAENYVGLPFD
                     DATASEATRLDNALCATL"
     misc_feature    61876..62904
                     /gene="pobA"
                     /locus_tag="BCAM0057"
                     /note="HMMPfam hit to PF01494, FAD binding domain, score
                     5.7e-108"
                     /inference="protein motif:HMMPfam:PF01494"
     CDS             63250..63966
                     /transl_table=11
                     /gene="pcaI"
                     /locus_tag="BCAM0058"
                     /product="3-oxoadipate CoA-transferase subunit A"
                     /EC_number="2.8.3.6"
                     /db_xref="EnsemblGenomes-Gn:BCAM0058"
                     /db_xref="EnsemblGenomes-Tr:CAR53913"
                     /db_xref="GOA:B4EGI2"
                     /db_xref="InterPro:IPR004163"
                     /db_xref="InterPro:IPR004165"
                     /db_xref="InterPro:IPR012792"
                     /db_xref="InterPro:IPR037171"
                     /db_xref="UniProtKB/TrEMBL:B4EGI2"
                     /protein_id="CAR53913.1"
                     /translation="MVNKIFESLQSAVADVHDGATIMIGGFGTAGMPSELIDALIEQG
                     ARDLTIVNNNAGNGETGLAALLKAKKVRKIICSFPRQSDSQVFDALYRAGEIELELVP
                     QGNLAERIRAAGAGIGGFFTPTGYGTKLAEGKETRVIDGKPYVFETPIHADFALVKAY
                     KGDRWGNLVYRKTARNFGPIMASAAKVAIVQVSEVVPLGALNPEHIVTPGIFVQRIVE
                     VPQAAHAAELAAEHAASQAA"
     misc_feature    63265..63906
                     /gene="pcaI"
                     /locus_tag="BCAM0058"
                     /note="HMMPfam hit to PF01144, Coenzyme A transferase,
                     score 1.1e-93"
                     /inference="protein motif:HMMPfam:PF01144"
     misc_feature    63301..63348
                     /note="PS01273 CoA transferases signature 1."
                     /inference="protein motif:Prosite:PS01273"
     CDS             63986..64642
                     /transl_table=11
                     /gene="pcaJ"
                     /locus_tag="BCAM0059"
                     /product="3-oxoadipate CoA-transferase subunit B"
                     /EC_number="2.8.3.6"
                     /db_xref="EnsemblGenomes-Gn:BCAM0059"
                     /db_xref="EnsemblGenomes-Tr:CAR53914"
                     /db_xref="GOA:B4EGI3"
                     /db_xref="InterPro:IPR004164"
                     /db_xref="InterPro:IPR004165"
                     /db_xref="InterPro:IPR012791"
                     /db_xref="InterPro:IPR037171"
                     /db_xref="UniProtKB/TrEMBL:B4EGI3"
                     /protein_id="CAR53914.1"
                     /translation="MKRLTRDEMAKRVAQDIPEGAYVNLGIGVPTLVANHLDPSKEIF
                     LHSENGLLGMGPAPAPGEEDDELINAGKQHVTLLTGGAYFHHSDSFAMMRGGHLDYCV
                     LGAFQVSANGDLANWHTGAPDAIPAVGGAMDLAIGAKQVFVMMEHLTKQGESKIVAQC
                     SYPVTGVQCVSRIYTDLAVLDVTADGLAVSEIFTDLSFDELQKLTGVPLIDATQKAAA
                     "
     misc_feature    64001..64597
                     /gene="pcaJ"
                     /locus_tag="BCAM0059"
                     /note="HMMPfam hit to PF01144, Coenzyme A transferase,
                     score 2.7e-59"
                     /inference="protein motif:HMMPfam:PF01144"
     misc_feature    64118..64144
                     /note="PS01274 CoA transferases signature 2."
                     /inference="protein motif:Prosite:PS01274"
     CDS             64731..66089
                     /transl_table=11
                     /gene="pcaB"
                     /locus_tag="BCAM0060"
                     /product="3-carboxy-cis,cis-muconate cycloisomerase"
                     /EC_number="5.5.1.2"
                     /db_xref="EnsemblGenomes-Gn:BCAM0060"
                     /db_xref="EnsemblGenomes-Tr:CAR53915"
                     /db_xref="GOA:B4EGI4"
                     /db_xref="InterPro:IPR000362"
                     /db_xref="InterPro:IPR008948"
                     /db_xref="InterPro:IPR012789"
                     /db_xref="InterPro:IPR019468"
                     /db_xref="InterPro:IPR020557"
                     /db_xref="InterPro:IPR022761"
                     /db_xref="InterPro:IPR024083"
                     /db_xref="UniProtKB/TrEMBL:B4EGI4"
                     /protein_id="CAR53915.1"
                     /translation="MLEDSARLTSLICGTEPLNRIWSPRATIQRMLDVEAALARALAA
                     QQVIPAAAVAPIERACDAGRLDADALAHGAALGGNLAIPLVKQLTAQVKADDPEAAKF
                     VHWGATSQDIIDTATVLQLRDTLDVLDPLLDEACASLAALARTHRATPMIGRTWLQQA
                     LPITLGLKFAQWLDALLRHRARFAELRERALVLQFGGAAGTLASLREHAAGVSAALAA
                     DLKLAVPAVPWHTQRDRIAEAAACFGMLTGTLGKIARDVSLQMQTEIGELGEPAAAGK
                     GGSSTMPHKRNPVGCAAVLTAAVRAPNLVATVFAGMVQEHERALGGWQAEWDALPDLA
                     RLTGGALAQIAQIVAGLDVNTERLAANLELTHGLILGEAVMLALGDRIGRLDAHHVVE
                     HASKEAVRTGATLFDVLAADATVSAHLSRDALARLLDPAHYVGEAHAYVDAVLALHAG
                     AH"
     misc_feature    64773..65639
                     /gene="pcaB"
                     /locus_tag="BCAM0060"
                     /note="HMMPfam hit to PF00206, Lyase, score 1.9e-53"
                     /inference="protein motif:HMMPfam:PF00206"
     misc_feature    65562..65591
                     /note="PS00163 Fumarate lyases signature."
                     /inference="protein motif:Prosite:PS00163"
     CDS             66106..66891
                     /transl_table=11
                     /locus_tag="BCAM0061"
                     /product="putative 3-oxoadipate enol-lactonase I"
                     /note="family S33 serine peptidase"
                     /db_xref="EnsemblGenomes-Gn:BCAM0061"
                     /db_xref="EnsemblGenomes-Tr:CAR53916"
                     /db_xref="GOA:B4EGI5"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR026968"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:B4EGI5"
                     /protein_id="CAR53916.1"
                     /translation="MPFATVNGVKLHYRIDRAARDDAPWLVFSNSLGADLQMWAPQIR
                     PLTQHFNILRYDTRGHGHSDAPAGSYTIEQLAGDVIGLLDHVGIDCAHFCGISMGGLT
                     GAALAARYPSRIVRAVLSNTAAKIGSPEVWGPRAQKARAEGMAALADAVLPRWFTDAF
                     VEREPRLFDAIRDTFVHTDKDGYAANCDALNAADLREEVKGIALPVLVVTGAKDMSTP
                     PDQGRALAAAIPGALHVEFDAAHISNIECTGGFNRALLDFLTA"
     misc_feature    66253..66876
                     /locus_tag="BCAM0061"
                     /note="HMMPfam hit to PF00561, alpha/beta hydrolase fold,
                     score 8.7e-27"
                     /inference="protein motif:HMMPfam:PF00561"
     CDS             66902..67288
                     /transl_table=11
                     /gene="pcaC"
                     /locus_tag="BCAM0062"
                     /product="4-carboxymuconolactone decarboxylase"
                     /EC_number="4.1.1.44"
                     /db_xref="EnsemblGenomes-Gn:BCAM0062"
                     /db_xref="EnsemblGenomes-Tr:CAR53917"
                     /db_xref="GOA:B4EGI6"
                     /db_xref="InterPro:IPR003779"
                     /db_xref="InterPro:IPR012788"
                     /db_xref="InterPro:IPR029032"
                     /db_xref="UniProtKB/TrEMBL:B4EGI6"
                     /protein_id="CAR53917.1"
                     /translation="MDDQERYEAGMKVRRAVLGDAHVDRSIENRTEVTDEFQNLITRY
                     AWGEIWTRDGLPRHTRSLLTIAMMVALNRGEELALHLRAARNNGVTRDEIKEVLLQTA
                     IYCGVPAANSAFHLADKIFKEQDAAG"
     misc_feature    67004..67258
                     /gene="pcaC"
                     /locus_tag="BCAM0062"
                     /note="HMMPfam hit to PF02627, Carboxymuconolactone
                     decarboxylase family, score 7.5e-34"
                     /inference="protein motif:HMMPfam:PF02627"
     CDS             67483..68841
                     /transl_table=11
                     /locus_tag="BCAM0063"
                     /product="putative 4-hydroxybenzoate transporter"
                     /db_xref="EnsemblGenomes-Gn:BCAM0063"
                     /db_xref="EnsemblGenomes-Tr:CAR53918"
                     /db_xref="GOA:B4EGI7"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="UniProtKB/TrEMBL:B4EGI7"
                     /protein_id="CAR53918.1"
                     /translation="MNRAPVVDVQTFINEQPFGGFQWLVFLMCFVIVLLDGFDTAAIG
                     FIAPSLLGEWNLTKPDLAPVLSAALFGLACGALVSGPLSDRLGRRSLLLGSVFLFGVA
                     CLMSAFSNTIGHLTILRFITGVGLGAAMPNAVTMMGEFCPDKRRATVINLMFCGFPLG
                     AAFGGFLAAWMIPHFGWRSVLVLGGVTPLLLGVLLLLKMPESVRFMVATGQSVDKIRA
                     TLARISRDALNAGSFALTEAAPQTGGKGLGVVLSRSYIVGSVMLWLAYFMGLVIFYAS
                     INWMPILLKDAGLTPKSATLISALFPLGGVGAVLCGVLMDRFNANRVIAVCYALTAVS
                     VYAIGQAAGNVGLLVLVVFVAGVLMNTAQSSMPALAAAFYPTEGRGTGVAWMLGVGRF
                     GGIAGSFLVAELTRRHFSFAGVFATIAVAGVLACVALLIKQMARPHGVAQPAGKIESL
                     GH"
     misc_feature    67552..68835
                     /locus_tag="BCAM0063"
                     /note="HMMPfam hit to PF00083, Sugar (and other)
                     transporter, score 7.9e-07"
                     /inference="protein motif:HMMPfam:PF00083"
     misc_feature    join(67552..67620,67663..67731,67750..67818,67831..67890,
                     67927..67995,68005..68073,68245..68313,68356..68424,
                     68485..68553,68620..68688,68707..68775)
                     /locus_tag="BCAM0063"
                     /note="11 probable transmembrane helices predicted for
                     BCAM0063 by TMHMM2.0 at aa 24-46, 61-83, 90-112, 117-136,
                     149-171, 175-197, 255-277, 292-314, 335-357, 380-402 and
                     409-431"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    67567..68700
                     /locus_tag="BCAM0063"
                     /note="HMMPfam hit to PF07690, Major Facilitator
                     Superfamily, score 1.4e-48"
                     /inference="protein motif:HMMPfam:PF07690"
     misc_feature    67672..67704
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     misc_feature    67717..67767
                     /note="PS00216 Sugar transport proteins signature 1."
                     /inference="protein motif:Prosite:PS00216"
     misc_feature    67759..67791
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     misc_feature    68728..68760
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     CDS             complement(68974..69222)
                     /transl_table=11
                     /locus_tag="BCAM0064"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0064"
                     /db_xref="EnsemblGenomes-Tr:CAR53919"
                     /db_xref="UniProtKB/TrEMBL:B4EGI8"
                     /protein_id="CAR53919.1"
                     /translation="MKPMLRAGEHIEGMHWIAEYHPLTHDIRVLRENIEVGTYCAPPT
                     LFGDEAGMGAANHDDHRGREAALRAYLRNFVKEHDAEE"
     CDS             complement(69331..69948)
                     /transl_table=11
                     /locus_tag="BCAM0065"
                     /product="putative transporter-LysE family"
                     /db_xref="EnsemblGenomes-Gn:BCAM0065"
                     /db_xref="EnsemblGenomes-Tr:CAR53920"
                     /db_xref="GOA:B4EGI9"
                     /db_xref="InterPro:IPR001123"
                     /db_xref="UniProtKB/TrEMBL:B4EGI9"
                     /protein_id="CAR53920.1"
                     /translation="MEFLTLSALPAGMLFALVTTITPGPNNTMLLASGVNFGFRRTMP
                     HLFGISIGVAILMLCVGFGLGEAFKRLPLLYTLLEVASVAYLLYLAWRIGTSGEVKAH
                     GAKSRPMTFIEAAAFQWVNPKAWMMVLTAATTIRLSADYGMNAAWMAILFILIGFPCI
                     SLWAAFGLGLRRFLSNPRALRIFNVTMAVLLILSLYPLVAHLLPQ"
     misc_feature    complement(join(69337..69405,69442..69510,69670..69738,
                     69757..69825,69883..69942))
                     /locus_tag="BCAM0065"
                     /note="5 probable transmembrane helices predicted for
                     BCAM0065 by TMHMM2.0 at aa 3-22, 42-64, 71-93, 147-169 and
                     182-204"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    complement(69346..69900)
                     /locus_tag="BCAM0065"
                     /note="HMMPfam hit to PF01810, LysE type translocator,
                     score 4.8e-05"
                     /inference="protein motif:HMMPfam:PF01810"
     sig_peptide     complement(69901..69948)
                     /locus_tag="BCAM0065"
                     /note="Signal peptide predicted for BCAM0065 by SignalP
                     2.0 HMM (Signal peptide probability 0.797) with cleavage
                     site probability 0.340 between residues 16 and 17"
                     /inference="protein motif:SignalP:2.0"
     CDS             complement(70491..70733)
                     /pseudo
                     /transl_table=11
                     /locus_tag="BCAM0065A"
                     /product="insertion element hypothetical protein
                     (fragment)"
                     /note="Similar to the N-terminal region of Burkholderia
                     cepacia insertion element IS402 hypothetical 16.2 kDa
                     protein SWALL:YI22_BURCE (SWALL:P24537) (147 aa) fasta
                     scores: E(): 1e-07, 45.78% id in 83 aa"
     CDS             71131..73110
                     /transl_table=11
                     /locus_tag="BCAM0066"
                     /product="putative lipoprotein"
                     /note="Similar to Streptomyces avermitilis hypothetical
                     protein SWALL:Q82B80 (EMBL:BA000030) (654 aa) fasta
                     scores: E(): 3.7e-59, 35.8% id in 648 aa; homology does
                     not extend to far C terminus"
                     /db_xref="EnsemblGenomes-Gn:BCAM0066"
                     /db_xref="EnsemblGenomes-Tr:CAR53922"
                     /db_xref="InterPro:IPR036188"
                     /db_xref="InterPro:IPR038732"
                     /db_xref="UniProtKB/TrEMBL:B4EGJ0"
                     /protein_id="CAR53922.1"
                     /translation="MSTGRAPSTRKAVPFTIAVIGCGPRGISVLERIAARLANERNAS
                     PVIGDICIYVVDAHEIGGGRIWRPDQPSWLLMNTPAKETTIFSGPPDGGDVRPMAGPS
                     LAEWWAEVDSGNAEPNGLAPRYVYGKYLKFAFDRIINDLSRHADVRVIRGAVIDVQKS
                     DRRRTVMLSDRSTFDADKVVLATGHPVPELSASQLEFSLFARQHPGLRYIEGNSAADM
                     QLSAIQPGERVGVIGCGLAFYDVMASLTEGRGGRYETAADGDLVYIPSGKEPRIHAGS
                     RSGVPFPARATNEKAADYQYTPRLLTESRMQQIRLARVATKLDFRRDVLPWLEGEMQL
                     VYFACILRETRGRVYASGFVDAAVNNVGEDIDALLPKDIIRKTAESFGAHGIEGVDLE
                     KWSRPFAGKLFRNAKEYSGELEKWIRNDIENAGKGNVRGAVKAATDVLRDIRPILKYA
                     VDYAGLTPASHQHDFLGSFVGIYSMLSAGPPAVRLKQVLALIHANILTFAGPKAEFSV
                     SVAEKAFVVSSPQVSGDVFRASTLVDARIPPQNVHADSSPLFRNLLASGTVTSFTNSL
                     GQDTFDTGGVAVTRAPFNAMSREGPDSAIHVIGIPVEHTRWLMQFGSGRPGPWGQFTK
                     DADAVAESVIAAFLGALAATNTPVVADNEKEHVDV"
     misc_feature    71164..71196
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     misc_feature    72931..72960
                     /note="PS00215 Mitochondrial energy transfer proteins
                     signature."
                     /inference="protein motif:Prosite:PS00215"
     CDS             73112..73825
                     /transl_table=11
                     /locus_tag="BCAM0067"
                     /product="putative short chain dehydrogenase"
                     /db_xref="EnsemblGenomes-Gn:BCAM0067"
                     /db_xref="EnsemblGenomes-Tr:CAR53923"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="UniProtKB/TrEMBL:B4EGJ1"
                     /protein_id="CAR53923.1"
                     /translation="MKSRAEKQKILVVGGTSGIGLAAARAFATSGADVTVMSRSAASI
                     DRSLSIIGASASGAVVDVCDDESVADAIASLDAFDHVVVTTASTPLPTGSIKSIPLDR
                     AYGAMNSKFWGAYRIAREVKINQGGSLTFVSGILASRPTKNTALIGAINAALESLAKG
                     LALERAPVRVNVVSPGILGNASMLVHLNEEERKSIGARLPVEKIGTPELVADAIVFLA
                     NHKHITGTTLVVDGGGSLV"
     sig_peptide     73112..73195
                     /locus_tag="BCAM0067"
                     /note="Signal peptide predicted for BCAM0067 by SignalP
                     2.0 HMM (Signal peptide probability 0.998) with cleavage
                     site probability 0.775 between residues 28 and 29"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    73133..73609
                     /locus_tag="BCAM0067"
                     /note="HMMPfam hit to PF00106, short chain dehydrogenase,
                     score 5.8e-07"
                     /inference="protein motif:HMMPfam:PF00106"
     misc_feature    73139..73804
                     /locus_tag="BCAM0067"
                     /note="HMMPfam hit to PF01370, NAD dependent
                     epimerase/dehydratase family, score 0.0033"
                     /inference="protein motif:HMMPfam:PF01370"
     CDS             73803..75209
                     /transl_table=11
                     /locus_tag="BCAM0068"
                     /product="Major Facilitator Superfamily protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0068"
                     /db_xref="EnsemblGenomes-Tr:CAR53924"
                     /db_xref="GOA:B4EGJ2"
                     /db_xref="InterPro:IPR004638"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="UniProtKB/TrEMBL:B4EGJ2"
                     /protein_id="CAR53924.1"
                     /translation="MEEVPLSDNSLFTSVIEEADAQSREIVKSRALITVCIGFFMVSL
                     DATVVNVALNSLRLSLHVGLSGLQWTVDSYTLAFAALLLSAGALGDIFGPKKVFNVGL
                     IVFSLASALCGLSTSLGALLASRVLQGVGAALLVATSLSLLQKIFVEPADRARAFGVW
                     GGVGGVAVAAGPVLGGFLISMFGWPSVFLVNVPFGILGVILSARYLPKMPGEARRINF
                     GAQVLSAVALGALAFLFISAGAHGWSSRDVQIAAAAFAIATCLFLGIERFSANPMLPR
                     GIFRSRIFSAATTVGMIINFGFYGQLFVLSLYFQQICKYSTMETGLALLPQAIVCSLT
                     AFYCGRVTARTGPGFPMKVGLLAGALGLFGLTFANGNSSYVSVLIPMLAVGFGMSFTA
                     PATVAAGMSAAPAGQAGIVSGVINAARQSGSVMGIAVLGGLIGLSSNFEYGMHLAFWV
                     ASVLFAGALLVTALRIRK"
     misc_feature    join(73896..73964,74022..74081,74100..74168,74178..74231,
                     74268..74336,74346..74414,74448..74516,74544..74612,
                     74649..74717,74760..74819,74838..74906,74934..75002,
                     75063..75116,75126..75194)
                     /locus_tag="BCAM0068"
                     /note="14 probable transmembrane helices predicted for
                     BCAM0068 by TMHMM2.0 at aa 32-54, 74-93, 100-122, 126-143,
                     156-178, 182-204, 216-238, 248-270, 283-305, 320-339,
                     346-368, 378-400, 421-438 and 442-464"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    73905..75107
                     /locus_tag="BCAM0068"
                     /note="HMMPfam hit to PF07690, Major Facilitator
                     Superfamily, score 3.4e-54"
                     /inference="protein motif:HMMPfam:PF07690"
     CDS             75236..76918
                     /transl_table=11
                     /locus_tag="BCAM0069"
                     /product="conserved hypothetical protein"
                     /note="Similar to Streptomyces parvulus hypothetical
                     protein BorL SWALL:Q70HZ3 (EMBL:AJ580915) (556 aa) fasta
                     scores: E(): 1.8e-57, 35.79% id in 528 aa; homology does
                     not extend to N terminus"
                     /db_xref="EnsemblGenomes-Gn:BCAM0069"
                     /db_xref="EnsemblGenomes-Tr:CAR53925"
                     /db_xref="InterPro:IPR004993"
                     /db_xref="UniProtKB/TrEMBL:B4EGJ3"
                     /protein_id="CAR53925.1"
                     /translation="MRLIDMNSIPNEWMKYWESRKDAFSSECLAELQRFETATRDPQG
                     TQQDVLRDVISVSKGSLHWQECGYSSVSGVDDYRSTLPIMRYDDFVPLIDREIRTKGG
                     VLTCSPVMRWLKTSGTTGTPKRVPYTLHWVLNYRIPAMKAMWGTYSRLHPELLSNPYA
                     TLDTQTVRENAQDYIHGVPFQAVSNRHPRMNSMDWNPPWYEAPWFCENAPVSFEDKMY
                     CRVRHLVGKDLYFINAINPSTLLSLRDHIGTSKEKLVADVRNGTIDGQPLCNADPHEA
                     DRLEKVLANPGFTLKDIWPTLGLYACWLSASAGLYQQALEEIFPGVARLPFMSCGTEG
                     VVTIPVSEDAYSQPLAINQAFFEFVEDDVPLGELVERGEKPQTLLAHQLTAGKNYHVI
                     MSQANGLYRLWTGDIYHVDRVVDGTPWIHFLHRDGVFHSFTGEKLTEHQVTAALRRGF
                     AAADRQIGLYLCGPRWGQPPSYVVVAEARGADVTLGATLSRHVESALQDISIEYESKR
                     VSNRLGPIEVHVVPENSIQAFVERKRQKGNANQYKYKPFQKDTEFLGELSGQ"
     misc_feature    75323..76894
                     /locus_tag="BCAM0069"
                     /note="HMMPfam hit to PF03321, GH3 auxin-responsive
                     promoter, score 1.9e-09"
                     /inference="protein motif:HMMPfam:PF03321"
     CDS             76940..77818
                     /transl_table=11
                     /locus_tag="BCAM0070"
                     /product="putative hydrolase"
                     /note="Similar to Streptomyces parvulus hypothetical
                     protein BorF borF SWALL:Q70I05 (EMBL:AJ580915) (272 aa)
                     fasta scores: E(): 8.7e-27, 35.79% id in 257 aa; homology
                     does not extend to the N terminus"
                     /db_xref="EnsemblGenomes-Gn:BCAM0070"
                     /db_xref="EnsemblGenomes-Tr:CAR53926"
                     /db_xref="GOA:B4EGJ4"
                     /db_xref="InterPro:IPR022742"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:B4EGJ4"
                     /protein_id="CAR53926.1"
                     /translation="MLELKTHPSNLRREIRKIRRGPTELAMHAWLPENPKAAVFYFHG
                     LQSHAGWLWEAGRQFANNDVSVFVLDRRGSGISDGDRGDIPPAEVVVADYVAALKWVR
                     EFIGDDTPLCLFGHCLGGSFMAAVMHHPSFDVPYDAAIFCSTWLGKLHASLPESELEK
                     IAAESSDEMWDAGLRSSDFTDSRQYQAFIDEDDLAIREITKRSRRSLIEIERLYVDAQ
                     GDLPSVPMAYVSGTSDPIIDLESAHNAFLRMTQSRGSVLKLPTHKHYLFYTEVRRELI
                     DWASAFVLLQAREVYA"
     misc_feature    77129..77770
                     /locus_tag="BCAM0070"
                     /note="HMMPfam hit to PF00561, alpha/beta hydrolase fold,
                     score 0.00025"
                     /inference="protein motif:HMMPfam:PF00561"
     CDS             77811..78989
                     /transl_table=11
                     /locus_tag="BCAM0071"
                     /product="puatative mandelate racemase/muconate
                     lactonizing enzyme"
                     /db_xref="EnsemblGenomes-Gn:BCAM0071"
                     /db_xref="EnsemblGenomes-Tr:CAR53927"
                     /db_xref="GOA:B4EGJ5"
                     /db_xref="InterPro:IPR013342"
                     /db_xref="InterPro:IPR018110"
                     /db_xref="InterPro:IPR029017"
                     /db_xref="InterPro:IPR029065"
                     /db_xref="InterPro:IPR036849"
                     /db_xref="UniProtKB/TrEMBL:B4EGJ5"
                     /protein_id="CAR53927.1"
                     /translation="MHDVRVYHVQQPMRVGFGHPAATRTTSESVVLELDISGCVGLGE
                     CAPRSYVTGETCVTVCDALRSLPLARIIDELLSESPNDVLYRIKRLGIEAAFDFTAAN
                     NVVCIVELAILDWIGKRTRVSLDAMLRNGASLAESSAPIKISQVLDQNLTVDDFLRER
                     GPFHFVKIKAHRDRAKDLETVTEIRRAIGDDTPIVIDANMSWSLIEAVEHVRKLREAG
                     LTMVEEPFSKRSWTELHELRVQTGISIMLDESVSTLDDLRRAIGSDSCDAVNVRVSKC
                     GGVLRSIEMIELAKSFGIQFQIGVQVAECGPLIQAGRLLASLHRDAIAVEGGQADRFF
                     DSMIVSPDLSFDRARSTVPPPAGFGLGLSTSTEISKYLAFGYSRSADEWTATSHYTEA
                     "
     misc_feature    78192..78926
                     /locus_tag="BCAM0071"
                     /note="HMMPfam hit to PF01188, Mandelate racemase /
                     muconate lactonizing en, score 5.4e-08"
                     /inference="protein motif:HMMPfam:PF01188"
     misc_feature    78390..78485
                     /note="PS00909 Mandelate racemase / muconate lactonizing
                     enzyme family signature 2."
                     /inference="protein motif:Prosite:PS00909"
     CDS             78956..80734
                     /transl_table=11
                     /locus_tag="BCAM0072"
                     /product="putative thiamine pyrophosphate enzyme"
                     /note="no significant database matches"
                     /db_xref="EnsemblGenomes-Gn:BCAM0072"
                     /db_xref="EnsemblGenomes-Tr:CAR53928"
                     /db_xref="GOA:B4EGJ6"
                     /db_xref="InterPro:IPR011766"
                     /db_xref="InterPro:IPR012001"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:B4EGJ6"
                     /protein_id="CAR53928.1"
                     /translation="MDRDIPLYRGLTFDMKRYFSDLIVDFLKQQEIEYVAFNPGASFR
                     GIHDSLVHREDSPEILMACHEEIAVAMAHGYYKACNRHMAVFLHANVGLLHGSMAIFN
                     AWCDRVPLLLIGGNGPIDAAKRRPWIDWIHTSQNIESAVKDFVKWCDQPTSQRATVES
                     LYRAFKLMNTEMHAPCYVAIDFDVQEQEVESAAQLLPPTATTPSRLPAADAPFIENLT
                     ERLLSARMPVLIIDFSGRDPATVAPLISLAEQVGMAVIDRGNRFNFPNVHPLNVSNAP
                     PDMLKEADLVLAIEVQDLAGALGAFLPVTDGMPAIEDVTVVTLSTSDTLPSKWAADYQ
                     QFVPVNLGAIADTRTTVEALERAVADAADRHARPEREERVRALTVHHERVRREWDLDV
                     RQLRAEDNEIHVATAVREIFQVVQDRDWILTNTGSLTIDGWVKKLWDIERPGSYLGLN
                     GGAGLGYGLGASIGAAIAHRNDDVLCIDLQADGDFLYTPSALWTLSSYDVPLLVIIMN
                     NRLYLNSTQHAERIAKARNRVEDLSHVATSFFETPVDFVKIAEGFGIKSFPRIDRASE
                     IEQIVGEAAHYVVTQRKPALVEILMK"
     misc_feature    79004..79534
                     /locus_tag="BCAM0072"
                     /note="HMMPfam hit to PF02776, Thiamine pyrophosphate
                     enzyme, N-termina, score 1.6e-08"
                     /inference="protein motif:HMMPfam:PF02776"
     misc_feature    80225..80722
                     /locus_tag="BCAM0072"
                     /note="HMMPfam hit to PF02775, Thiamine pyrophosphate
                     enzyme, C-termina, score 3.1e-22"
                     /inference="protein motif:HMMPfam:PF02775"
     CDS             80783..81664
                     /transl_table=11
                     /locus_tag="BCAM0073"
                     /product="hypothetical protein"
                     /note="Central 170 amino acids similar to Caulobacter
                     crescentus hypothetical protein cc1419 SWALL:Q9A8D5
                     (EMBL:AE005816) (336 aa) fasta scores: E(): 2.3e-15,
                     35.59% id in 177 aa"
                     /db_xref="EnsemblGenomes-Gn:BCAM0073"
                     /db_xref="EnsemblGenomes-Tr:CAR53929"
                     /db_xref="GOA:B4EGJ7"
                     /db_xref="InterPro:IPR036663"
                     /db_xref="UniProtKB/TrEMBL:B4EGJ7"
                     /protein_id="CAR53929.1"
                     /translation="MTIKFMEGVLRGERFVGFVESGVTLPNELYRISLAKLCEATGGK
                     TDAVVAKEYLLKSASSVRFSDQDMIDFSPLPPLFPDAAGDAMASGFMQTHNVKIESAR
                     DDHGEIVLPNWFVKGLGSSVKLSGQPLRAPRQALALCEEAEVVLVYRSNADGRPEYCG
                     YTFGNDLTDIGRFKRHPGHLAYAKLCDAAVSSWFHIAPPPQSVQGEVSIERDGAVAWK
                     GNFKTGLDALGYRLADMVDHLFSYSALSHPGRIHYVFIGADRSSFHAGFSIKEGDRIV
                     LNFASHDVVISNQVQFA"
     CDS             81873..83000
                     /transl_table=11
                     /locus_tag="BCAM0074"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0074"
                     /db_xref="EnsemblGenomes-Tr:CAR53930"
                     /db_xref="GOA:B4EGJ8"
                     /db_xref="InterPro:IPR016084"
                     /db_xref="InterPro:IPR039068"
                     /db_xref="UniProtKB/TrEMBL:B4EGJ8"
                     /protein_id="CAR53930.1"
                     /translation="MLEEQYIRNAFPDIAAVPVPLLTSLSLPLDQAVSGLLDNMLLEE
                     QAELHPEWEEVFLQRVRDALERALIKRDTDAANAVHRTLFLLYELHVVDGASPRAANQ
                     FNPSLTRVRRCIERAWLDNEMRRVGDECPAHLDGSALTQRLKRLWVQHPVASHPLFDF
                     LERSASLEQIVAFFKSDSALNIRFFDLLVYSMIGSREGVRRELAQNFWDESGRGDAAR
                     SHVTLFRSLLSTVGVSSASDDHASELGWQGLAGYNLFMLSSVNRQHYFKLLGIMAMTE
                     LLDPSQYEKLARGCRRVGLGRDAELDYYDEHVTIDVIHGEGWLSNVIVPIVNETPTVA
                     KDILVGASLRMATCNDYYDALLARLIEMGQQQAGEQISMAA"
     CDS             complement(83007..83588)
                     /transl_table=11
                     /locus_tag="BCAM0075"
                     /product="TetR family regulatory protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0075"
                     /db_xref="EnsemblGenomes-Tr:CAR53931"
                     /db_xref="GOA:B4EGJ9"
                     /db_xref="InterPro:IPR001647"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR036271"
                     /db_xref="UniProtKB/TrEMBL:B4EGJ9"
                     /protein_id="CAR53931.1"
                     /translation="MATSSKRQAIVDTATRLFTQYGYHAVGIDRIIEEAGVAKMTLFR
                     YFSTKNDLISEVLTQRAHSALGSMASAVATRNTPIERLREVFSWHDRWFNARDFGGCM
                     FTSALSEFHAEPGEIIRISTKQKVQLRLFIQNLLRDLVPATSIESTARQVVMLLDGAT
                     LAAVIGDKTNAANEAWQATECLLHAVQAPVAML"
     misc_feature    complement(83421..83561)
                     /locus_tag="BCAM0075"
                     /note="HMMPfam hit to PF00440, Bacterial regulatory
                     proteins, tetR family, score 2.7e-17"
                     /inference="protein motif:HMMPfam:PF00440"
     CDS             complement(84022..84789)
                     /transl_table=11
                     /locus_tag="BCAM0076"
                     /product="TetR family regulatory protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0076"
                     /db_xref="EnsemblGenomes-Tr:CAR53932"
                     /db_xref="GOA:B4EGK0"
                     /db_xref="InterPro:IPR001647"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="UniProtKB/TrEMBL:B4EGK0"
                     /protein_id="CAR53932.1"
                     /translation="MPNTSSRRTRTPSPAVSNGQAPSSPEVREPRGARRKRETRARLL
                     DAAFVLMAQKGMEGVAINEITEAADVGFGSFYNHFESKEAIHAAVLEIVFEEFADTLD
                     RIAGGLTDPAEIISVSLRHTLLRARGEPVWGQFLLREGLSMRALSRGLGPRLLRDIQK
                     GILAGRFSASDPLMSVITVGGAVLTAIAIELRFDADEKPVTDMLNMIGYSQNGFAERA
                     ASSLLQTLGVPRTEAIEIANRPLPPAVTPAPNESQER"
     misc_feature    complement(84523..84663)
                     /locus_tag="BCAM0076"
                     /note="HMMPfam hit to PF00440, Bacterial regulatory
                     proteins, tetR family, score 3.9e-13"
                     /inference="protein motif:HMMPfam:PF00440"
     CDS             84902..86614
                     /transl_table=11
                     /locus_tag="BCAM0077"
                     /product="putative flavoprotein monooxygenase"
                     /note="Similar to Escherichia coli 3- mhpA
                     SWALL:MHPA_ECOLI (SWALL:P77397) (554 aa) fasta scores:
                     E(): 3.7e-45, 32.94% id in 510 aa; homology does not
                     extend to far N and C termini"
                     /db_xref="EnsemblGenomes-Gn:BCAM0077"
                     /db_xref="EnsemblGenomes-Tr:CAR53933"
                     /db_xref="GOA:B4EGK1"
                     /db_xref="InterPro:IPR002938"
                     /db_xref="InterPro:IPR036188"
                     /db_xref="UniProtKB/TrEMBL:B4EGK1"
                     /protein_id="CAR53933.1"
                     /translation="MGDGTVVETKLTCEPGVHEGNDNANCAGGRDLPSEVDVLVVGCG
                     PVGAAIGALLGRDGVRVLVVDRAAEIFMAPRAIALDNDALRILQYVGVNEADLDTVAI
                     PYVRMRSPWFGEFGRINTLGSIDGHPKLVTFYQPDLERCLRARLAAHRTARMALGVTL
                     VSLDEHADHVAATLDSGPGARHVVRARYVVGADGASSIVRQLIGQDFKGKTFAEDWLI
                     VDARNVRRPIDHVEFICDHRRPTPHMTAPGGRERWEFMLHPDETREEMESDERIRELL
                     APWGGIEDMVIERKAVYRFHARTVTTFSKGRVFLAGDAAHITPPFVGQGLVAGLRDAA
                     NLGWKLAWVVKGHATPQILDSYDRERRPHAKAMIGVAKFMGKLVMPRNAGIALFTHGL
                     MRLTRLVPPLRNHFDELGIKPKNAFRSGLFVPGHSSTRLVRGAALPQGWLRRHDGTIR
                     LSDDVFGTGLALIGFGRDPGVELDAGARAALIAAGGVVVQVMHRGQRLHRIEDDGWED
                     LDGTFMPGVVRFGWAAVIRPDKTVLHEGPVADSTRLVLESLQLLGARTALSSLSDHIA
                     QPIS"
     misc_feature    85004..86014
                     /locus_tag="BCAM0077"
                     /note="HMMPfam hit to PF01494, FAD binding domain, score
                     2.3e-59"
                     /inference="protein motif:HMMPfam:PF01494"
     misc_feature    85511..85534
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
                     /inference="protein motif:Prosite:PS00017"
     CDS             86622..87692
                     /transl_table=11
                     /locus_tag="BCAM0078"
                     /product="putative dioxygenase"
                     /note="Similar to Burkholderia cepacia trihydroxytoluene
                     oxygenase dntD SWALL:O87474 (EMBL:AF076848) (315 aa) fasta
                     scores: E(): 5.8e-37, 39.33% id in 300 aa; contains
                     extensions at the N and C termini"
                     /db_xref="EnsemblGenomes-Gn:BCAM0078"
                     /db_xref="EnsemblGenomes-Tr:CAR53934"
                     /db_xref="GOA:B4EGK2"
                     /db_xref="InterPro:IPR004360"
                     /db_xref="InterPro:IPR029068"
                     /db_xref="InterPro:IPR037523"
                     /db_xref="UniProtKB/TrEMBL:B4EGK2"
                     /protein_id="CAR53934.1"
                     /translation="MKLTTAQPARSPQPTTKARALSYLMFERPDLERAERFLNDFGLR
                     TVSRDGEHLFLRGTAATPFCYVVRRAEKNRFVGFGLEVDGIDALRKLAGVPGASDVAP
                     SPWPGGGHRVTLVDPSGFRVDAVAGQARAGALPHRSALPFNSPDSVVRVNDTQRAPLA
                     APEVIRLGHVVLELADFQATCAWYTSHFGFIPSDVQVLPDGSPAVAFLRLDRGATPTD
                     HHTLALAQGFAALYSHSAFELVDADAVGIGQRVLSEKGWTHAWGMGRHILGSQVFDYW
                     QDPWGDKHEHYCDGDMFTADVATGIHEVSREAMSQWGPRMPRSFTKPKITAASIASLI
                     RNLRASPDVTFAKLRTLAKLFA"
     misc_feature    87117..87479
                     /locus_tag="BCAM0078"
                     /note="HMMPfam hit to PF00903, Glyoxalase/Bleomycin
                     resistance protein/Di, score 0.0017"
                     /inference="protein motif:HMMPfam:PF00903"
     CDS             87729..88685
                     /transl_table=11
                     /locus_tag="BCAM0079"
                     /product="putative fumarylacetoacetate hydrolase family
                     protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0079"
                     /db_xref="EnsemblGenomes-Tr:CAR53935"
                     /db_xref="GOA:B4EGK3"
                     /db_xref="InterPro:IPR011234"
                     /db_xref="InterPro:IPR018833"
                     /db_xref="InterPro:IPR036663"
                     /db_xref="UniProtKB/TrEMBL:B4EGK3"
                     /protein_id="CAR53935.1"
                     /translation="MALHVLHYRHQGRAQWGVVRHHRITPIPGDYPTTGEFVRAHRID
                     DLAALDGETIPESDVEWLSPVTRNQRFVCQGANYRQHMIESGMNPDAKSFNMIFTKAT
                     SCIVAADSDVIRPQHVRFLDYEIELGLVLRRDITSRQAITDKNLHEYVAGLVIVNDYS
                     ARDIQIPQMQFYKGKSYRTFGPVGPYLCLLEASDIARLHALTLTLTVNGDVRQSDSTG
                     NLVYGPAETLTELSGVQDLNAGDLLATGTPSGCALSIPSPAKQRIAALLPEQMKWRIF
                     TKVQAARPQYLKAGDLVESRIRSRDGAIDLGVQRNRIVDELA"
     misc_feature    87987..88493
                     /locus_tag="BCAM0079"
                     /note="HMMPfam hit to PF01557, Fumarylacetoacetate (FAA)
                     hydrolase fam, score 6.9e-36"
                     /inference="protein motif:HMMPfam:PF01557"
     CDS             88682..90643
                     /transl_table=11
                     /locus_tag="BCAM0080"
                     /product="putative AMP-binding enzyme"
                     /db_xref="EnsemblGenomes-Gn:BCAM0080"
                     /db_xref="EnsemblGenomes-Tr:CAR53936"
                     /db_xref="GOA:B4EGK4"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="InterPro:IPR025110"
                     /db_xref="InterPro:IPR042099"
                     /db_xref="UniProtKB/TrEMBL:B4EGK4"
                     /protein_id="CAR53936.1"
                     /translation="MNAIATEADVLRIENQGPPADLPASTYEMIGRGAAIDPSAPALS
                     FFLRADDHRKPLRWTYAALLRDITRAANMFSRLGIDRHAVVASVLPNLPETHFVIWGG
                     EAAGIVCAINPLLEGPAIASLLKAANAKVLVTLAPFPGTDIWSKIQPVLSEVPSLQSL
                     VLIDLAERVQGWRRIAARAMQRRECKRLHGRAGVRGAVPRHVAIHDFDSAMSRESGDS
                     LLIPRRFEADDISSYFCTGGTTGLPKIAIRRHGNEVANAWSVGQVVGAGMGPGKTVFC
                     GLPLFHVNAVLATGLVPFSRGAHVVLGTPQGYRGDGVVKRFWEIVEHHRINFFSAVPT
                     LYSALLDVPVDGRNIDSLEYGLCGAAPMPVEVFRTFQDRTGVRILEGYGLTEGACVSS
                     VNPPGGERRLGSIGLRIPGQMMKAVILDDAGRYVRDCVENEVGVLTISGPNVFAGYLQ
                     EDQNKSLWLDLGDGRQWLNTGDLARRDAQGYFWLTGRRKELIIRGGHNIDPATIEEPL
                     HRHPAVQIAAAIGRPDVHAGELPVAYVQLKAGATATETELDTFIRGMIGERAAIPKRI
                     HIVDTMPLTAVGKIFKPELKRWETFDALVSALKDAGVEGARVSMVDDPSRGLTLHVAL
                     SDHAQTAKANTVMGRFPFAFSTSVEPEHH"
     misc_feature    88856..90238
                     /locus_tag="BCAM0080"
                     /note="HMMPfam hit to PF00501, AMP-binding enzyme, score
                     8.4e-79"
                     /inference="protein motif:HMMPfam:PF00501"
     misc_feature    89378..89413
                     /note="PS00455 Putative AMP-binding domain signature."
                     /inference="protein motif:Prosite:PS00455"
     misc_feature    89477..89500
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
                     /inference="protein motif:Prosite:PS00017"
     CDS             90857..91582
                     /transl_table=11
                     /locus_tag="BCAM0081"
                     /product="putative outer membrane protein-OmpW family"
                     /db_xref="EnsemblGenomes-Gn:BCAM0081"
                     /db_xref="EnsemblGenomes-Tr:CAR53937"
                     /db_xref="GOA:B4EGK5"
                     /db_xref="InterPro:IPR005618"
                     /db_xref="InterPro:IPR011250"
                     /db_xref="UniProtKB/TrEMBL:B4EGK5"
                     /protein_id="CAR53937.1"
                     /translation="MKRISAGAVVLVAAISGAHAQSAGQWVVSAGWSHFAPQGAADPL
                     TLNALGQSQVMTGSGGDIASGDTFGLTATYFLTDHIAATTVMGFPPTWHLNGAGTLSG
                     FGELGTARAWSPAIIFNYYFGQPNARFRPYLGAGVTYTWFSNIKLSNPVSTGQIYFSP
                     TVGTALEGPTSVSLSHSFAPVVNGGLTYNIDSHWSINASVAYSWVSTRATLTTRSSVG
                     TVTSTSKFRVNPIVTFLSVGYRF"
     sig_peptide     90857..90916
                     /locus_tag="BCAM0081"
                     /note="Signal peptide predicted for BCAM0081 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.952 between residues 20 and 21"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    90920..91579
                     /locus_tag="BCAM0081"
                     /note="HMMPfam hit to PF03922, OmpW family, score 1.2e-17"
                     /inference="protein motif:HMMPfam:PF03922"
     CDS             complement(91858..92592)
                     /transl_table=11
                     /locus_tag="BCAM0082"
                     /product="putative polysaccharide deacetylase"
                     /db_xref="EnsemblGenomes-Gn:BCAM0082"
                     /db_xref="EnsemblGenomes-Tr:CAR53938"
                     /db_xref="GOA:B4EGK6"
                     /db_xref="InterPro:IPR002509"
                     /db_xref="InterPro:IPR011330"
                     /db_xref="UniProtKB/TrEMBL:B4EGK6"
                     /protein_id="CAR53938.1"
                     /translation="MLARTPRYPILMYHQIRLLPPPTDRLRSLSVAPDAFRRQMTLFR
                     QLGYRGLSVRELQPYLRGERQGKVFGISFDDGFLNVLTHAMPVLDALGFTATCYFVAG
                     RFGGANDWDAGAPTKRSPLMTCEDMLAWRDHGHEIGSHTLDHVALSYVPAPVSDFQLT
                     ESKRQLEMLSGQCVESFCYPYGNLDARVRDQVIAAGYGNATTTRRGCAGAADDPFLLP
                     RIPVAGGVGAARLWFKCWKGRIAGRR"
     misc_feature    complement(91993..92409)
                     /locus_tag="BCAM0082"
                     /note="HMMPfam hit to PF01522, Polysaccharide deacetylase,
                     score 4.6e-26"
                     /inference="protein motif:HMMPfam:PF01522"
     CDS             complement(92616..93182)
                     /transl_table=11
                     /locus_tag="BCAM0083"
                     /product="hypothetical protein"
                     /note="No significant database matches"
                     /db_xref="EnsemblGenomes-Gn:BCAM0083"
                     /db_xref="EnsemblGenomes-Tr:CAR53939"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:B4EGK7"
                     /protein_id="CAR53939.1"
                     /translation="MALNIWKKYWDLRTQECPCDVHFVEWLESVHLKGIRIYHFGTGG
                     HHHVGIECARPHLNNTVFGVTASPKEYKSYVDLVTRQPEVSKTYLAYFGDIYTSHSRL
                     LPTFDVVTLFHLCEFRDEANSRYGAKTDEEVLDLFARHTAPNGHLLFYTGSSAYRKAE
                     PIIARWAANADFVEVGDFKTLRIFRKAA"
     CDS             complement(93173..94327)
                     /transl_table=11
                     /locus_tag="BCAM0084"
                     /product="putative glycosyl transferase"
                     /db_xref="EnsemblGenomes-Gn:BCAM0084"
                     /db_xref="EnsemblGenomes-Tr:CAR53940"
                     /db_xref="GOA:B4EGK8"
                     /db_xref="InterPro:IPR001296"
                     /db_xref="InterPro:IPR028098"
                     /db_xref="UniProtKB/TrEMBL:B4EGK8"
                     /protein_id="CAR53940.1"
                     /translation="MNILYTNFHGDYGGGQDTYVRDLAVAMSRHHRVTVASPEGSRLS
                     RLLKDSPDVAIFDMEFKPRWNRLCREILRLRRRIAAERFDVIHVNGAADHRQVMLALL
                     GCRYRPAIVLTKHNTYRADSLGNVLRARLATDHTIAVSDYVASMLALRSPYGNVTVVK
                     HGVRRPAAERLAGDEIRRRKIALFGASGAEAIVLGSSAGTTPEKGWMDLIAALGRLPE
                     AERERFRVLLIGAEPSGEQREQLARHGMASRTAFTGRLDDVWAPFSIIDVSFVLSYHE
                     SLSYACREAMSLGCPAIVTRVGGLPENVEPGVDGWVVPPREPAAIEAILRAIVQEPGC
                     VRAMGRSARLKGKREFSFDAFVDATLSVYQKSIRHNPYRWVTSLRSTKWH"
     misc_feature    complement(93293..93796)
                     /locus_tag="BCAM0084"
                     /note="HMMPfam hit to PF00534, Glycosyl transferases
                     group, score 5e-18"
                     /inference="protein motif:HMMPfam:PF00534"
     CDS             94684..95280
                     /transl_table=11
                     /locus_tag="BCAM0085"
                     /product="TetR family regulatory protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0085"
                     /db_xref="EnsemblGenomes-Tr:CAR53941"
                     /db_xref="GOA:B4EGK9"
                     /db_xref="InterPro:IPR001647"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR036271"
                     /db_xref="InterPro:IPR039538"
                     /db_xref="UniProtKB/TrEMBL:B4EGK9"
                     /protein_id="CAR53941.1"
                     /translation="MARTRNENLHQQRREQILTAAARVFKAKGFHGARTEDICAAADM
                     SAGAVFRYFADKREMIDAIIAVEVERYTQDFNRILSRDGLLGLAGITADELAGMMAQG
                     DDGLGVDSWLELARDAERRPDIVGLDRKMRADLAALLARGQAEGWVRPSLDPAGATNI
                     VFALFNGLWLDRSLGTSVDMKQTAAALGDFFRTYVLVA"
     misc_feature    94732..94872
                     /locus_tag="BCAM0085"
                     /note="HMMPfam hit to PF00440, Bacterial regulatory
                     proteins, tetR family, score 4.5e-16"
                     /inference="protein motif:HMMPfam:PF00440"
     CDS             95627..96925
                     /transl_table=11
                     /locus_tag="BCAM0086"
                     /product="putative sodium:dicarboxylate symporter family
                     protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0086"
                     /db_xref="EnsemblGenomes-Tr:CAR53942"
                     /db_xref="GOA:B4EGL0"
                     /db_xref="InterPro:IPR001991"
                     /db_xref="InterPro:IPR033380"
                     /db_xref="InterPro:IPR036458"
                     /db_xref="UniProtKB/TrEMBL:B4EGL0"
                     /protein_id="CAR53942.1"
                     /translation="MKKKHNITRYIVVAMILGIAVGYACHSAFPDPKMAKEVAGYVSL
                     LSDVFLRLIKMIIAPLVFATLTVGIAQMGDGSAVGRVGVKAFGWFFIASFTSLLLGLL
                     TATLLQPGSHLSLPLPPSDAALNLKTGAFTLKDFVVHLVPKSIAEAMANNEILQIVVF
                     SIFFGTALSALGDAGKRLTGVIEDLAQVMLKVTGAVMWFAPVAVFAALASTITTEGLG
                     ILLTFAKFMASFYLALALLWAVLTLAGVTFLGKRAFTLIRLIREPFLLSFATASSEAA
                     YPKLLDALDRFGVNRKISSFVLPIGYSFNLDGSMMYCTFAVLFIAQVYGIHLPLGTQI
                     TMLLMLMVTSKGMAGVPRASLVVIAATLNQFNMPEAGLLLIMGVDMFLDMGRSATNAV
                     GNSIAAAVVAKWEGQLDAPRDDDDSDGARVAEVKVRETSA"
     sig_peptide     95627..95707
                     /locus_tag="BCAM0086"
                     /note="Signal peptide predicted for BCAM0086 by SignalP
                     2.0 HMM (Signal peptide probability 0.935) with cleavage
                     site probability 0.688 between residues 27 and 28"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    95645..96838
                     /locus_tag="BCAM0086"
                     /note="HMMPfam hit to PF00375, Sodium:dicarboxylate
                     symporter family, score 4e-110"
                     /inference="protein motif:HMMPfam:PF00375"
     misc_feature    join(95645..95713,95792..95860,95879..95947,96086..96139,
                     96200..96268,96305..96373,96569..96637)
                     /locus_tag="BCAM0086"
                     /note="7 probable transmembrane helices predicted for
                     BCAM0086 by TMHMM2.0 at aa 7-29, 56-78, 85-107, 154-171,
                     192-214, 227-249 and 315-337"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    95669..95701
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     CDS             97379..99313
                     /transl_table=11
                     /locus_tag="BCAM0087"
                     /product="putative lipoprotein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0087"
                     /db_xref="EnsemblGenomes-Tr:CAR53943"
                     /db_xref="InterPro:IPR011042"
                     /db_xref="InterPro:IPR013658"
                     /db_xref="UniProtKB/TrEMBL:B4EGL1"
                     /protein_id="CAR53943.1"
                     /translation="MVARKRIQAALVAAAIAACAPAAHAANTTDWLANTYGTLAAHVG
                     NVARAMWVAPEGVIYTASMWDEDEGGVAIYQNGKSIGSIGAHSEFQGSAITGNATSLF
                     VALQPGKTYGSGAVGRYSRATKVRDRVIQISAATNQPRIDVVTGLATAGSLLYASDFY
                     GNRVRVFTTDGVWQRDIGVSAPGALAVDGAGNVWVAQKSAGSIVGFSPTGALLNTIRM
                     PAGSHPSALHVDAAAGQLLVGDEGPDQNIKRYSISGQPALAGTFGVRGGYLDTTTGIK
                     GQVGPQRFTRIVGIGKDTGGNLYVLNNPWGGSWDLGRNGATDIHAYGSNGNLRWTLQS
                     LNFEGIAAPDPVTDGALFYGGTHIYSGSAGGKFVANTVDPFTYPSDPRINMSDTQRDE
                     HFGLITSVGANRILVAAGQNPPIFYFYHFNAANGYIAIPDGSIPGPAFNTTQRVTGGF
                     SLDSQGGVWAGLDKTGAITHYPLTGFDADGKPSWGPGVTTRIPASIQPLTRIVYLADS
                     DTMVLAQGALGSNDWTSIGTRIEVYHGWRAGNTTKPDPVITLPHSGAKSIDAAGNHLF
                     VGYWFSSSGPLWPNVDAFNLTTGKLDTTLVNTSPATVDTSSAIDAMYSIRAYRRSNGE
                     YVVMKNNVKGNSITVYRWTP"
     sig_peptide     97379..97453
                     /locus_tag="BCAM0087"
                     /note="Signal peptide predicted for BCAM0087 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 1.000 between residues 25 and 26"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    97403..97435
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     misc_feature    97592..97615
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
                     /inference="protein motif:Prosite:PS00017"
     CDS             99606..100424
                     /transl_table=11
                     /locus_tag="BCAM0088"
                     /product="putative peptidyl-prolyl cis-trans isomerase"
                     /db_xref="EnsemblGenomes-Gn:BCAM0088"
                     /db_xref="EnsemblGenomes-Tr:CAR53944"
                     /db_xref="GOA:B4EGL2"
                     /db_xref="InterPro:IPR000297"
                     /db_xref="InterPro:IPR027304"
                     /db_xref="UniProtKB/TrEMBL:B4EGL2"
                     /protein_id="CAR53944.1"
                     /translation="MTPNRLLTIVALAGALSGPVHAQTAATVATVNGTPITQTDVDTL
                     LRASGQPDSPQIRQAIKNQLITRVLVQQAAEKANYADKPEVKAAMQQAKVTAEVQLYL
                     RDHVKPEPVTDEQVKARYDELVAALGKNEFKPRLIVVKDPVAAATVLSELKAGKSFDG
                     LARQYSVAPSRDTGGELPWVSFNTPAVEGRTAGLPLPVAQALEKLSVGAVTKDSIPVD
                     GVRAIVKLDAKRPTQVPGFETAKPTLQQQLQAIAAEKASAQMIGNLLKDAKITQ"
     sig_peptide     99606..99671
                     /locus_tag="BCAM0088"
                     /note="Signal peptide predicted for BCAM0088 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.999 between residues 22 and 23"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    100014..100289
                     /locus_tag="BCAM0088"
                     /note="HMMPfam hit to PF00639, PPIC-type PPIASE domain,
                     score 0.00011"
                     /inference="protein motif:HMMPfam:PF00639"
     CDS             complement(100455..100892)
                     /transl_table=11
                     /locus_tag="BCAM0089"
                     /product="putative acetyltransferase-GNAT family"
                     /db_xref="EnsemblGenomes-Gn:BCAM0089"
                     /db_xref="EnsemblGenomes-Tr:CAR53945"
                     /db_xref="GOA:B4EGL3"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:B4EGL3"
                     /protein_id="CAR53945.1"
                     /translation="MKPAIHLRAASREDLPFLLTLRRLTMTEHLQRVGAPTDDEAHDR
                     RIRANFDDAMIVCEGVDAIGLLKVTRAAGEWHIHQIQILPARQGHGIGEAVLHALLTD
                     AARAHVPVSLSVLHGNPARRLYERLGFRVASDTDTSANMIWHA"
     misc_feature    complement(100503..100733)
                     /locus_tag="BCAM0089"
                     /note="HMMPfam hit to PF00583, Acetyltransferase (GNAT)
                     family, score 1.5e-08"
                     /inference="protein motif:HMMPfam:PF00583"
     CDS             complement(100935..101738)
                     /transl_table=11
                     /locus_tag="BCAM0090"
                     /product="hypothetical protein"
                     /note="no significant database matches"
                     /db_xref="EnsemblGenomes-Gn:BCAM0090"
                     /db_xref="EnsemblGenomes-Tr:CAR53946"
                     /db_xref="UniProtKB/TrEMBL:B4EGL4"
                     /protein_id="CAR53946.1"
                     /translation="MLDASTRALCGAQVRPQVNVRGSFKTGSFGIDFTLATSLLGRMR
                     DMLSGNEGTALANAVTILTALGIAAPKARKGLFAVLKWLRGREITHVRMQDRTAVLDV
                     DGDTLEIDLPVLTLLRDVRVRQATAQVLAPLAREGIEIFAVGTDTEVYEMVARNEMAW
                     FHAPEPTDALLLDEHRKMAFSIVSLAFKDDNKWRLRDGTATIHATITDAGFLSRVNNS
                     QISFSKGDLLLCNVRVQQWQTSDGAKTEYEVTDVLEHRPAGLQIPLPGL"
     CDS             102192..103484
                     /transl_table=11
                     /locus_tag="BCAM0091"
                     /product="putative membrane protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0091"
                     /db_xref="EnsemblGenomes-Tr:CAR53947"
                     /db_xref="GOA:B4EGL5"
                     /db_xref="InterPro:IPR007895"
                     /db_xref="InterPro:IPR013655"
                     /db_xref="InterPro:IPR035965"
                     /db_xref="UniProtKB/TrEMBL:B4EGL5"
                     /protein_id="CAR53947.1"
                     /translation="MDTKRSRPGLVAALLWAALYLATGYISHEFNGPVRLTGYIWLPA
                     GVTVGAFMLRPMRDWLTLAGAFLVGQLALTAIEHGSLVNAVLFTVDEVGAAALAVWLV
                     QRVRFSLEGLYFLRSVILAGMIAGVVGAIGGAAWYTTLKGAPFFDVWSVWAASDFVGV
                     LLVTPVLASWSRFRAHRSGDHERFDLVLGIVAFVLLAAVALVIFDGDTSRKFGTGAGF
                     ALTYVPLFLTVAVTLLLGGRAGSSSVLVLALIVIEQTAQGDGPFASLHAHYGSALLEA
                     QLYLAVASLLVLTVSTLKTTRERVHEHAAVLQNNMELALASAGQIAYVLDPESGRIEW
                     SGDVERVFGVGVDAAQIATVPLVLERVQPGDRDALRDYWNAEIAGEDRASLSLRIVLR
                     DGGTRTITDHGAPLLDSNVDVTVVAGVWQLERVWPADE"
     sig_peptide     102192..102257
                     /locus_tag="BCAM0091"
                     /note="Signal peptide predicted for BCAM0091 by SignalP
                     2.0 HMM (Signal peptide probability 0.853) with cleavage
                     site probability 0.522 between residues 22 and 23"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    join(102216..102269,102297..102353,102366..102419,
                     102429..102497,102531..102599,102642..102710,
                     102747..102803,102831..102899)
                     /locus_tag="BCAM0091"
                     /note="8 probable transmembrane helices predicted for
                     BCAM0091 by TMHMM2.0 at aa 9-26, 36-54, 59-76, 80-102,
                     114-136, 151-173, 186-204 and 214-236"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    102225..103085
                     /locus_tag="BCAM0091"
                     /note="HMMPfam hit to PF05231, MASE1, score 2.6e-41"
                     /inference="protein motif:HMMPfam:PF05231"
     misc_feature    103182..103466
                     /locus_tag="BCAM0091"
                     /note="HMMPfam hit to PF08447, PAS fold, score 0.0013"
                     /inference="protein motif:HMMPfam:PF08447"
     CDS             103498..104313
                     /transl_table=11
                     /locus_tag="BCAM0092"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0092"
                     /db_xref="EnsemblGenomes-Tr:CAR53948"
                     /db_xref="GOA:B4EGL6"
                     /db_xref="InterPro:IPR012354"
                     /db_xref="InterPro:IPR022742"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:B4EGL6"
                     /protein_id="CAR53948.1"
                     /translation="MTGRTGVLLIHGLGGTQYDLGSLHKAMRRAGGDTHMITLPGHGT
                     RPEDLVGVRAEAWLDAVTEQYRALAREYDTLHVAGMCMGALVALLLCHRVQHARGRLA
                     LLATPMFIDGWSTPWYRSLRHVLYRVPGVAERMRVEEGDPFGIKNATIRAIVKKKFER
                     QDSFHYAWVPLACVRQVDRMRDWALDAAAGTPCPTLVLHAREDELTSLRSADFLLENM
                     PDACGIVLENSYHMICADNDRDDVARHVLEFFGFDPVHAVSPAMARRMGRLEP"
     CDS             complement(104321..105343)
                     /transl_table=11
                     /locus_tag="BCAM0093"
                     /product="MerR family regulatory protein"
                     /note="Poor database matches to the full length CDS.
                     N-terminal region is similar to Rhizobium meliloti heavy
                     metal dependent transcription regulator 2 HmrR2
                     SWALL:HMR2_RHIME (SWALL:P58379) (147 aa) fasta scores:
                     E(): 0.033, 31.34% id in 134 aa"
                     /db_xref="EnsemblGenomes-Gn:BCAM0093"
                     /db_xref="EnsemblGenomes-Tr:CAR53949"
                     /db_xref="GOA:B4EGL7"
                     /db_xref="InterPro:IPR000551"
                     /db_xref="InterPro:IPR009061"
                     /db_xref="UniProtKB/TrEMBL:B4EGL7"
                     /protein_id="CAR53949.1"
                     /translation="MGTATPGLNASAAAARLGVSIKALRLYERHGLVTPARTPAGYRT
                     YGPDDLARAADIAALRKLGLTLAQVASVLDGDARGLDAALAAHEAALDHGIHDFVSKL
                     DRVRAMRAGLARGRMPADGELTRLLDPGSAGVAFSLPWPWGGEWFECRDIRPLNYIIG
                     SLGSGKTRLALRLAEALPGAVFVGLDRLDDDCAAASDALRADPELKSRVDRTSALLVG
                     TGATPSAALTALLVSLEAERPRVRIVDLIEQGLDRATQLALIAHLRDSAAAGVRPLFL
                     LTRSTAILDLAAVGPDETILLCPANHSPPARVAPYPGAPGYEAVATCLAAPEVRERIA
                     RRPMTA"
     misc_feature    complement(104843..104866)
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
                     /inference="protein motif:Prosite:PS00017"
     misc_feature    complement(105209..105319)
                     /locus_tag="BCAM0093"
                     /note="HMMPfam hit to PF00376, MerR family regulatory
                     protein, score 3.9e-09"
                     /inference="protein motif:HMMPfam:PF00376"
     misc_feature    complement(105245..105313)
                     /note="PS00552 Bacterial regulatory proteins, merR family
                     signature."
                     /inference="protein motif:Prosite:PS00552"
     misc_feature    complement(105257..105322)
                     /note="Predicted helix-turn-helix motif with score
                     1159.000, SD 3.13 at aa 8-29, sequence
                     LNASAAAARLGVSIKALRLYER"
                     /inference="protein motif:helixturnhelix:EMBOSS"
     CDS             complement(105426..106892)
                     /transl_table=11
                     /gene="xylB"
                     /locus_tag="BCAM0094"
                     /product="xylulose kinase"
                     /EC_number="2.7.1.17"
                     /db_xref="EnsemblGenomes-Gn:BCAM0094"
                     /db_xref="EnsemblGenomes-Tr:CAR53950"
                     /db_xref="GOA:B4EGL8"
                     /db_xref="InterPro:IPR000577"
                     /db_xref="InterPro:IPR006000"
                     /db_xref="InterPro:IPR018483"
                     /db_xref="InterPro:IPR018484"
                     /db_xref="InterPro:IPR018485"
                     /db_xref="UniProtKB/TrEMBL:B4EGL8"
                     /protein_id="CAR53950.1"
                     /translation="MTYLGIDLGTSEVKVLLTDSRSVPLATGSAALSISRPHPHWSEQ
                     SPQAWWHAMLDAIASVRAAHPAGFAALRGIALSGQMHGATLIDRADQVLRPAILWNDT
                     RAGTECVELEALVPESRAITGNMAMPGFTAPKLLWLAKYEPAVFRAVHKVLLPKDYLI
                     WRLSGEFVSDMSDAAGTLWLDCARRDWSDRMLAATELSRAQMPRLVEGNAPAAQLRDA
                     LRREWGIDGPVTIAGGAGDNAASAIGMGVTGAGSGFLSLGTSGVLFAGNDRFAPNPDA
                     AVHAFCHCVEGRWHQMSVILSAAASLDWLARAHGTTAGALAARAERADPARAPLFLPY
                     LGGERTPHNDAHARGVFFGLSNEHDADDLAYAVMEGVAFAMADGYDALRAAGTTLDAV
                     SFIGGGSKSAFWARLCANATGLAMQRHADGAVGAALGAARLARLAATNDTLEEVCVAP
                     PVTETVAPDAASVDLLAGRLARYRRLYRALRDEFAAAD"
     misc_feature    complement(105492..106154)
                     /gene="xylB"
                     /locus_tag="BCAM0094"
                     /note="HMMPfam hit to PF02782, FGGY family of carbohydrate
                     kinases, C-termi, score 4.3e-45"
                     /inference="protein motif:HMMPfam:PF02782"
     misc_feature    complement(105786..105848)
                     /note="PS00445 FGGY family of carbohydrate kinases
                     signature 2."
                     /inference="protein motif:Prosite:PS00445"
     misc_feature    complement(106161..106889)
                     /gene="xylB"
                     /locus_tag="BCAM0094"
                     /note="HMMPfam hit to PF00370, FGGY family of carbohydrate
                     kinases, N-termi, score 6.1e-87"
                     /inference="protein motif:HMMPfam:PF00370"
     CDS             complement(106889..107824)
                     /transl_table=11
                     /locus_tag="BCAM0095"
                     /product="AraC family regulatory protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0095"
                     /db_xref="EnsemblGenomes-Tr:CAR53951"
                     /db_xref="GOA:B4EGL9"
                     /db_xref="InterPro:IPR003313"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR018060"
                     /db_xref="InterPro:IPR018062"
                     /db_xref="UniProtKB/TrEMBL:B4EGL9"
                     /protein_id="CAR53951.1"
                     /translation="MNPDLEIVPTHRDESFRAWVHDYPHSVAKWHFHPEYEIHLIQAS
                     HGKVFVGDHIGDFGPGNLIVTGPNLPHNWVSELADGERVPSRDVVLQFSRDAIEKMVG
                     AFSELQPVIDLIDDAARGVQFPDRVGIEVAPLMLELANAHGCRRVEILMSLFDRLSSC
                     RERRVLAGPGYRSDAQHYMSSTINQVLSYLQQNLPGMLREADVAAFAGMSVSTFTRFF
                     RRHTGSSFVRYLNRLRINEACELLMFSDLTVTDICYRVGFNNLSNFNRQFLAMKQVPP
                     SKFRALHRLNEPHGRDDAPPPRRAPPRAPDRTLHT"
     misc_feature    complement(106982..107116)
                     /locus_tag="BCAM0095"
                     /note="HMMPfam hit to PF00165, Bacterial regulatory
                     helix-turn-helix protei, score 0.0001"
                     /inference="protein motif:HMMPfam:PF00165"
     misc_feature    complement(106997..107125)
                     /note="PS00041 Bacterial regulatory proteins, araC family
                     signature."
                     /inference="protein motif:Prosite:PS00041"
     misc_feature    complement(107132..107272)
                     /locus_tag="BCAM0095"
                     /note="HMMPfam hit to PF00165, Bacterial regulatory
                     helix-turn-helix protei, score 2.4e-05"
                     /inference="protein motif:HMMPfam:PF00165"
     misc_feature    complement(107168..107233)
                     /note="Predicted helix-turn-helix motif with score
                     1306.000, SD 3.64 at aa 198-219, sequence
                     LREADVAAFAGMSVSTFTRFFR"
                     /inference="protein motif:helixturnhelix:EMBOSS"
     CDS             complement(107854..109047)
                     /transl_table=11
                     /locus_tag="BCAM0096"
                     /product="ABC transporter ATP-binding protein"
                     /note="Similar to Escherichia coli sn-glycerol-3-phosphate
                     transport ATP-binding protein UgpC ugpC SWALL:UGPC_ECOLI
                     (SWALL:P10907) (356 aa) fasta scores: E(): 1.8e-56, 48.35%
                     id in 364 aa; contains 30 amino acid C terminal extension"
                     /db_xref="EnsemblGenomes-Gn:BCAM0096"
                     /db_xref="EnsemblGenomes-Tr:CAR53952"
                     /db_xref="GOA:B4EGM0"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR008995"
                     /db_xref="InterPro:IPR013611"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B4EGM0"
                     /protein_id="CAR53952.1"
                     /translation="MAQITCKALSKHYDGGPAVLHPLDLEIADGEFIVLLGPSGCGKS
                     TMLRMIAGLEAITGGELVIGDAVVNDLPSRERNVAMVFQNYALYPHMTVYDNIAFGLR
                     RLKVPADEIDRRVRDVARILSLDALLDRRPRAMSGGQQQRAAIARAMIKTPAVFLFDE
                     PLSNLDAKLRTQLRGDIKRLHRQLKTTTLYVTHDQLEAMTLADRVVLMRGGHIEQIGT
                     PAELYGQPHTVFAAGFVGTPAMNFADGTIARVGTNVLLDCNGARWPLASSRFARLQDG
                     QQVKAAIRPNHLQLVAEGDPTPGTLTLTGTVELVELLGAEALVTLDWRGQPCAALVPA
                     PMAPAPGAVVAFRFDEEALHLFDAGTERNVTLPDANPIAHAAPPAAATRTTPPAATGW
                     SMSRS"
     misc_feature    complement(107980..108207)
                     /locus_tag="BCAM0096"
                     /note="HMMPfam hit to PF08402, TOBE domain, score 1.1e-14"
                     /inference="protein motif:HMMPfam:PF08402"
     misc_feature    complement(107983..108159)
                     /locus_tag="BCAM0096"
                     /note="HMMPfam hit to PF03459, TOBE domain, score 1.9e-05"
                     /inference="protein motif:HMMPfam:PF03459"
     misc_feature    complement(108415..108960)
                     /locus_tag="BCAM0096"
                     /note="HMMPfam hit to PF00005, ABC transporter, score
                     6.6e-59"
                     /inference="protein motif:HMMPfam:PF00005"
     misc_feature    complement(108601..108645)
                     /note="PS00211 ABC transporters family signature."
                     /inference="protein motif:Prosite:PS00211"
     misc_feature    complement(108916..108939)
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
                     /inference="protein motif:Prosite:PS00017"
     CDS             complement(109051..110085)
                     /transl_table=11
                     /locus_tag="BCAM0097"
                     /product="D-xylulose reductase"
                     /EC_number="1.1.1.9"
                     /db_xref="EnsemblGenomes-Gn:BCAM0097"
                     /db_xref="EnsemblGenomes-Tr:CAR53953"
                     /db_xref="GOA:B4EGM1"
                     /db_xref="InterPro:IPR002328"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR020843"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="UniProtKB/TrEMBL:B4EGM1"
                     /protein_id="CAR53953.1"
                     /translation="MKALVLERTRELALRDIDLPQAVGPVDVRIKVHTVGVCGSDVHY
                     YVHGGIGPFRVDAPMVLGHEASGTVVETGAGVTHLRVGDRVCMEPGVPRLDSPATLRG
                     LYNLDPDVRFWATPPIHGCLTPFVVHPAAFTYRLPDNVSFAEGAIVEPLSIGLQAAKK
                     AAMKPGDLAVVIGAGTIGAMTALAALAGGAARVILADVVPDKLALFAGNPAVTTVDVR
                     TRPLADAVAEASGGWGADVVFEASGSANAYAGLVDLMCPGGCAVLIGMPVAPVPLDVV
                     ALQAKEGRIESVFRYANIFPRALALIASGAIDVKPFISRTFPFSEGVRAFEEAASGHP
                     RDVKIQIEMD"
     misc_feature    complement(109174..109593)
                     /locus_tag="BCAM0097"
                     /note="HMMPfam hit to PF00107, Zinc-binding dehydrogenase,
                     score 8.9e-24"
                     /inference="protein motif:HMMPfam:PF00107"
     misc_feature    complement(109516..109584)
                     /locus_tag="BCAM0097"
                     /note="1 probable transmembrane helix predicted for
                     BCAM0097 by TMHMM2.0 at aa 168-190"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    complement(109678..110013)
                     /locus_tag="BCAM0097"
                     /note="HMMPfam hit to PF08240, Alcohol dehydrogenase
                     GroES-like domain, score 1.6e-34"
                     /inference="protein motif:HMMPfam:PF08240"
     misc_feature    complement(109858..109902)
                     /note="PS00059 Zinc-containing alcohol dehydrogenases
                     signature."
                     /inference="protein motif:Prosite:PS00059"
     CDS             complement(110096..110911)
                     /transl_table=11
                     /locus_tag="BCAM0098"
                     /product="putative ABC transporter system permease"
                     /db_xref="EnsemblGenomes-Gn:BCAM0098"
                     /db_xref="EnsemblGenomes-Tr:CAR53954"
                     /db_xref="GOA:B4EGM2"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="InterPro:IPR035906"
                     /db_xref="UniProtKB/TrEMBL:B4EGM2"
                     /protein_id="CAR53954.1"
                     /translation="MARRGPAAVSTVAIAGAILLVAAFPLFWAVLNSLKHLLDIVTPT
                     PRFFFTPTLANYEQVLSSPEVLIGLGNSIAIVGAAVLIGAVLGVPAAYAIARYPVRGK
                     RDIQFFLLSLRFLPPVAVALPLIAIWVDLGLYDTKLSMIVTYLLVTLSTITWLSIPVF
                     RRLPREIEEAAALDGYGPYAVFWHIALPVCASTLLGGIVFSFVLVWNELMIALALTSS
                     RSATLPVVASAFTSLGQEVPWGVINASTVLLALPPLVFVGMLSRLLNSMVKGK"
     misc_feature    complement(110102..110719)
                     /locus_tag="BCAM0098"
                     /note="HMMPfam hit to PF00528, Binding-protein-dependent
                     transport syst, score 3.7e-06"
                     /inference="protein motif:HMMPfam:PF00528"
     misc_feature    complement(join(110129..110197,110303..110371,
                     110429..110497,110525..110593,110627..110695,
                     110825..110893))
                     /locus_tag="BCAM0098"
                     /note="6 probable transmembrane helices predicted for
                     BCAM0098 by TMHMM2.0 at aa 7-29, 73-95, 107-129, 139-161,
                     181-203 and 239-261"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    complement(110348..110434)
                     /note="PS00402 Binding-protein-dependent transport systems
                     inner membrane comp. sign."
                     /inference="protein motif:Prosite:PS00402"
     sig_peptide     complement(110825..110911)
                     /locus_tag="BCAM0098"
                     /note="Signal peptide predicted for BCAM0098 by SignalP
                     2.0 HMM (Signal peptide probability 0.969) with cleavage
                     site probability 0.514 between residues 29 and 30"
                     /inference="protein motif:SignalP:2.0"
     CDS             complement(110911..111870)
                     /transl_table=11
                     /locus_tag="BCAM0099"
                     /product="putative ABC transporter system permease"
                     /note="Similar to Rhizobium loti sugar ABC transporter,
                     permease protein SWALL:Q98D12 (EMBL:BA000012) (290 aa)
                     fasta scores: E(): 6.6e-68, 63.38% id in 284 aa; contains
                     27 amino acid N terminal extension"
                     /db_xref="EnsemblGenomes-Gn:BCAM0099"
                     /db_xref="EnsemblGenomes-Tr:CAR53955"
                     /db_xref="GOA:B4EGM3"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="InterPro:IPR035906"
                     /db_xref="UniProtKB/TrEMBL:B4EGM3"
                     /protein_id="CAR53955.1"
                     /translation="MALANDGTGGRTLGVRPAPSATSARRGRARRDRTSLPWVFLAPT
                     LALLAVLSLVPTIAAINLALRNRVLRYPDSEYVGLRNFVRLASDRRFLNAIEVSVLWE
                     VVTVAGAVLVGIALAVFLFERVHGRWRRFASLVLIMPVLLPRVSAAFIWKFMYAPLTG
                     ILSWLLGTLGVEHTAFLADPHLALYAVALVDVWQWGLFFAVVILKLLETLPPEPLEAA
                     RLDYATTWQVHAYIALPMLKAPLVSLVFIKMVESLRSFDLIYVMTKGGPGIATETLDL
                     YAYQQGIGLAGKVSYASGMAVLMMVATTLVFTLIWKRVNKWDD"
     misc_feature    complement(110914..111600)
                     /locus_tag="BCAM0099"
                     /note="HMMPfam hit to PF00528, Binding-protein-dependent
                     transport syst, score 0.00053"
                     /inference="protein motif:HMMPfam:PF00528"
     misc_feature    complement(join(110938..111006,111130..111198,
                     111259..111327,111370..111438,111508..111576,
                     111691..111759))
                     /locus_tag="BCAM0099"
                     /note="6 probable transmembrane helices predicted for
                     BCAM0099 by TMHMM2.0 at aa 38-60, 99-121, 145-167,
                     182-204, 225-247 and 289-311"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    complement(110956..111000)
                     /note="PS00211 ABC transporters family signature."
                     /inference="protein motif:Prosite:PS00211"
     CDS             complement(111854..113119)
                     /transl_table=11
                     /locus_tag="BCAM0100"
                     /product="putative periplasmic solute-binding protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0100"
                     /db_xref="EnsemblGenomes-Tr:CAR53956"
                     /db_xref="InterPro:IPR006059"
                     /db_xref="UniProtKB/TrEMBL:B4EGM4"
                     /protein_id="CAR53956.1"
                     /translation="MRIVAAGLLLGACLPGVAAAQTCKVPTLRVLAQKSLGLSVMEKS
                     LADYEKKNGTKVEISYFGENDRRAKSRLDASTGAGSYQIYYVDEANVAEFASANWIVP
                     LLKYYPKDYDYDDFLPGRRAVASYNGVAYFAPLIGGGDFLFYRRDLLDAAHIPVPKTL
                     DQLVAAIRKLNAPPKLYGWVARGQRGSGMNVWRWSPFMLGMGGAWTDKGGQPAFNSPA
                     AVKATQLYSDLFKYAPPGSATYDWSNALEAFRSGKVAFMIESTPFADWMEDASKSSVA
                     GKVGYTRPPAPLPSAAYGHGFAISAVGAKDDCTRMAAGRFIAWATSKDQEQARLRNGV
                     FSDYNRSSTIASPYFKQHVAPQIQAGLNDTNPVTQVTIWRTPQWPDIGDNLGIALEQV
                     FTGTQTDIRGTLDDADQYAKDALEHGARK"
     misc_feature    complement(112139..113119)
                     /locus_tag="BCAM0100"
                     /note="HMMPfam hit to PF01547, Bacterial extracellular
                     solute-binding prot, score 7.4e-25"
                     /inference="protein motif:HMMPfam:PF01547"
     sig_peptide     complement(113060..113119)
                     /locus_tag="BCAM0100"
                     /note="Signal peptide predicted for BCAM0100 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.765 between residues 20 and 21"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    complement(113081..113113)
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     CDS             complement(113331..114290)
                     /transl_table=11
                     /locus_tag="BCAM0101"
                     /product="putative amidohydrolase"
                     /db_xref="EnsemblGenomes-Gn:BCAM0101"
                     /db_xref="EnsemblGenomes-Tr:CAR53957"
                     /db_xref="GOA:B4EGM5"
                     /db_xref="InterPro:IPR006680"
                     /db_xref="InterPro:IPR032466"
                     /db_xref="UniProtKB/TrEMBL:B4EGM5"
                     /protein_id="CAR53957.1"
                     /translation="MRDEAPPDGMPDALVDAHHHLWRLDAGAHYPWLQAHYDPARFMF
                     GDYAALCRNFDVDDFRRAAQCAPLVASVHVEAERARDEALAETRWLHEVAAAHALPSA
                     IVAWVDLLAGDADERLAEQAAWPHVRGVRFKPRTAAAPDASIDEPGALRDPRWPAALE
                     RLAAHGLSWDLRVPFWHLGDAAAMLVDAPDVDVVLEHAGLPWDRSEAGLARWRGGMAA
                     LAALPRVTVKISELGLRDAAWNDADNARIIRDTIAIFGWRRCLFASNFPVAGLRVSYP
                     ALLRTFAGAIAHLDGPARRAIWHDNALRVYRIALDAPHRPARG"
     misc_feature    complement(113367..114248)
                     /locus_tag="BCAM0101"
                     /note="HMMPfam hit to PF04909, Amidohydrolase, score
                     1.4e-33"
                     /inference="protein motif:HMMPfam:PF04909"
     CDS             complement(114292..115239)
                     /transl_table=11
                     /locus_tag="BCAM0102"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0102"
                     /db_xref="EnsemblGenomes-Tr:CAR53958"
                     /db_xref="InterPro:IPR011048"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="UniProtKB/TrEMBL:B4EGM6"
                     /protein_id="CAR53958.1"
                     /translation="MNDILLLVQKCAHTFSFYDLDTKAPLKHIVLPNFPHEFTVDVND
                     RYAYVGIFGIETAWSRGHEGDHRIAEIDLVERTHTRMLDLWPYYRPHGMASDRDGRLY
                     AMSEAHDMLLVFDEPTRQPVPNMAVPSGGVKTHLVTLTRDASRAYGVHLLSNTVTQFH
                     PRDATVAPRAVMPGPRPEGNALSNDERTLFVANRGDDTLVEIDTETMTCGRRVKTRSD
                     PNRIYRTSATGGRDLLLLTNSGERSISVFDARQLEEIERIALPANPTALSFHPSRRVA
                     YVSFQDDHVRELDLDAWRFVGALATLREPDASYVLAGAR"
     CDS             complement(115280..116572)
                     /transl_table=11
                     /locus_tag="BCAM0103"
                     /product="Major Facilitator Superfamily protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0103"
                     /db_xref="EnsemblGenomes-Tr:CAR53959"
                     /db_xref="GOA:B4EGM7"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="UniProtKB/TrEMBL:B4EGM7"
                     /protein_id="CAR53959.1"
                     /translation="MNLLNPATPAYDAGEAIPRRRWLRVIPPLLLACIISYMDRVNIA
                     FAMPGGMNADLGMDATMAGLAGGIFFFGYLFLQIPGGRRAALGSGKAFIAWSLVSWAV
                     LSVLTGLVTHTWQLLALRFLLGVAEGGMLPVVLTMVSHWFPDRERGRANAMVILFVPL
                     AGMITAPLSGFILAAYDWHHLFFCAGALSLLCLVVWMLFADDGPETARWVSPREKAYI
                     LDALRDEQERKRAAGTPAATSFGALLRHPTIWLLIAINFCYQAGIYGYTMWLPTLLKN
                     LTHSGMGRVGLLAMVPYVAMVIGMLVTSYWSDRTGKRRLFVLLPLVGFAACLALSVLT
                     HASMAVSFAFLIGCGFFLQAAAGVFWAIPPKLCSVEAAGSARGLINALGNLGGFCGPY
                     AVGVLTQHVSAAAGVYSLAATLAVAGLLALTLPKRCEG"
     misc_feature    complement(115286..116479)
                     /locus_tag="BCAM0103"
                     /note="HMMPfam hit to PF00083, Sugar (and other)
                     transporter, score 0.00019"
                     /inference="protein motif:HMMPfam:PF00083"
     misc_feature    complement(join(115301..115369,115382..115450,
                     115487..115555,115565..115633,115652..115720,
                     115763..115831,115973..116041,116051..116119,
                     116156..116224,116234..116302,116339..116398,
                     116441..116509))
                     /locus_tag="BCAM0103"
                     /note="12 probable transmembrane helices predicted for
                     BCAM0103 by TMHMM2.0 at aa 22-44, 59-78, 91-113, 117-139,
                     152-174, 178-200, 248-270, 285-307, 314-336, 340-362,
                     375-397 and 402-424"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    complement(115376..116488)
                     /locus_tag="BCAM0103"
                     /note="HMMPfam hit to PF07690, Major Facilitator
                     Superfamily, score 7.8e-67"
                     /inference="protein motif:HMMPfam:PF07690"
     misc_feature    complement(115529..115561)
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     misc_feature    complement(115592..115624)
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     CDS             complement(116670..117587)
                     /transl_table=11
                     /locus_tag="BCAM0104"
                     /product="putative dihydrodipicolinate synthase"
                     /db_xref="EnsemblGenomes-Gn:BCAM0104"
                     /db_xref="EnsemblGenomes-Tr:CAR53960"
                     /db_xref="GOA:B4EGM8"
                     /db_xref="InterPro:IPR002220"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:B4EGM8"
                     /protein_id="CAR53960.1"
                     /translation="MNARYQGVFPVVPTIFDAHGALDLDGQRRCVDFMIDAGSHGLCI
                     HANYSEQFALGDDERDLITRTTLEHVAGRVPVIVTTSHFSARICAQRNREAQALGAAM
                     VMVMPPYHGATFRVPEAQVRAYFRDVADGLDIPLMIQDAPASGVALSASLLATLAREI
                     DAVSYFKIETAGAASKLRELIALGGDAIEGPWDGEEGITLLADLDAGATGAMTGGGYP
                     DGIRRVTDAYFAGRRDDAYDAYARWLPLINYENRQSGFLTAKALMKEGGVIACDRPRS
                     PWPELPPQVRAGLLDTARRLDPLVLRWGR"
     misc_feature    complement(116697..117578)
                     /locus_tag="BCAM0104"
                     /note="HMMPfam hit to PF00701, Dihydrodipicolinate
                     synthetase family, score 3.3e-10"
                     /inference="protein motif:HMMPfam:PF00701"
     CDS             complement(117596..118768)
                     /transl_table=11
                     /locus_tag="BCAM0105"
                     /product="putative mandelate racemase/muconate lactonizing
                     enzyme"
                     /db_xref="EnsemblGenomes-Gn:BCAM0105"
                     /db_xref="EnsemblGenomes-Tr:CAR53961"
                     /db_xref="GOA:B4EGM9"
                     /db_xref="InterPro:IPR013341"
                     /db_xref="InterPro:IPR013342"
                     /db_xref="InterPro:IPR029017"
                     /db_xref="InterPro:IPR029065"
                     /db_xref="InterPro:IPR034619"
                     /db_xref="InterPro:IPR036849"
                     /db_xref="UniProtKB/TrEMBL:B4EGM9"
                     /protein_id="CAR53961.1"
                     /translation="MKIRSVRARVFQWKGKTVPPQGNFCSNAMDLLYAPQETMSTFRF
                     HAWTVVEVGTDDGIVGLGNVALAPQVAKAIIDQYLAPLVIGQDPWDYEYLNQRMYRAT
                     HAWGRKGIGMAAISAVDIAIWDILGKSVGKPVFKLLGGRTKEKIPCYYSKLYRTDLKA
                     MQEEAQQYLKEGFRAFKMRFGYGPAHGQQGVVENLKSVAAIREVIGYDNDLMLECYMG
                     WTLEYAKRILPKLEKYQPRWLEEPVIADDLDGYAELNRLTRIPISGGEHEFSLYGFKQ
                     LLDRKAVSVVQYDTNRVGGITMAHKINALCEAYSVPVIPHAGQMHNYHLTMSTLASPM
                     SEYFPMFDVEVGNELFYYIFDGEPVAENGFLQLRDDVPGLGLTLKTEFLDQFDIVE"
     misc_feature    complement(117608..118345)
                     /locus_tag="BCAM0105"
                     /note="HMMPfam hit to PF01188, Mandelate racemase /
                     muconate lactonizing en, score 1.4e-09"
                     /inference="protein motif:HMMPfam:PF01188"
     misc_feature    complement(118352..118660)
                     /locus_tag="BCAM0105"
                     /note="HMMPfam hit to PF02746, Mandelate racemase /
                     muconate lactonizing en, score 2.9e-21"
                     /inference="protein motif:HMMPfam:PF02746"
     CDS             complement(118818..119873)
                     /transl_table=11
                     /locus_tag="BCAM0106"
                     /product="4-hydroxythreonine-4-phosphate dehydrogenase"
                     /db_xref="EnsemblGenomes-Gn:BCAM0106"
                     /db_xref="EnsemblGenomes-Tr:CAR53962"
                     /db_xref="GOA:B4EGN0"
                     /db_xref="InterPro:IPR005255"
                     /db_xref="UniProtKB/TrEMBL:B4EGN0"
                     /protein_id="CAR53962.1"
                     /translation="MHTPSTAATQPVVALTLGDPAGIGAELIAKLLARPDATARANLV
                     LIGDRWLWEAGQRVAGVTIDVEPVASLAAVRGRPSTARAAFVAVDTIGAAQVTVGQAD
                     AAGGRSTLAVLDQCLDAALAGDIDAICFAPLNKYAMKLGGLRHDDELHHFAEALGVTG
                     YFCEFNTLGELWTARISSHIPLKDAAGCLSIERIEQASELIYRSLLANGVAAPKVAIA
                     AFNPHGGDGGSCGREEVDIIEPAVRRLQARDWPTDTPFHGPFPADTIFLKAQAGDYQA
                     IVTMYHDQGQIAIKLLGFSRGVTVQGGLPVPITTPAHGTAYDIAGRGTADVGATWQAL
                     QIACRMGAARRTAAVSA"
     misc_feature    complement(118860..119783)
                     /locus_tag="BCAM0106"
                     /note="HMMPfam hit to PF04166, Pyridoxal phosphate
                     biosynthetic protein Pdx, score 2e-96"
                     /inference="protein motif:HMMPfam:PF04166"
     CDS             119989..120936
                     /transl_table=11
                     /locus_tag="BCAM0107"
                     /product="LysR family regulatory protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0107"
                     /db_xref="EnsemblGenomes-Tr:CAR53963"
                     /db_xref="GOA:B4EGN1"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="InterPro:IPR036390"
                     /db_xref="UniProtKB/TrEMBL:B4EGN1"
                     /protein_id="CAR53963.1"
                     /translation="MGSIDRRDSTPQLLNRLRMRQIALLLAVDECSTLRAAAEQMGLT
                     QPAATKMLAELESALGQRLFDRIGRGLVLNPAGERVLGYFRGIRGSMEALNRELGELQ
                     LGSAGRLAIGSIMAASPGRLTEALVQLKARYPLLAIDIAVDTSDRLMPQLREGVLEVV
                     IGRHVGTDCDFRVVDDEALAIIAGRDHPLAGAGPVEFDALLDYAWIVQPTGSPAREVV
                     EREFRSRHQPMPRGLVETGSILTTMNLVDRSSMLGVIPLTVAQRNAAHGLVAIIDYTL
                     EQKLPSYGSLVRRDRPLSIPAQQFLALFHRDGAGDDGDA"
     misc_feature    120043..120222
                     /locus_tag="BCAM0107"
                     /note="HMMPfam hit to PF00126, Bacterial regulatory
                     helix-turn-helix, score 2.3e-20"
                     /inference="protein motif:HMMPfam:PF00126"
     misc_feature    120082..120147
                     /note="Predicted helix-turn-helix motif with score
                     1421.000, SD 4.03 at aa 32-53, sequence
                     STLRAAAEQMGLTQPAATKMLA"
                     /inference="protein motif:helixturnhelix:EMBOSS"
     misc_feature    120085..120177
                     /note="PS00044 Bacterial regulatory proteins, lysR family
                     signature."
                     /inference="protein motif:Prosite:PS00044"
     misc_feature    120292..120915
                     /locus_tag="BCAM0107"
                     /note="HMMPfam hit to PF03466, LysR substrate binding
                     domain, score 1.2e-27"
                     /inference="protein motif:HMMPfam:PF03466"
     CDS             complement(121180..122451)
                     /transl_table=11
                     /locus_tag="BCAM0108"
                     /product="Major Facilitator Superfamily protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0108"
                     /db_xref="EnsemblGenomes-Tr:CAR53964"
                     /db_xref="GOA:B4EGN2"
                     /db_xref="InterPro:IPR000849"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="UniProtKB/TrEMBL:B4EGN2"
                     /protein_id="CAR53964.1"
                     /translation="MPNDHRQRRHTLWLLCALSFILYVDRVNLATAAGAIKAELGLSN
                     TELGVAFSAFAYSYAICQIGGGWIADRFGARITLIGCGLIWVVSTFTTGLVHSLTLLF
                     AARLLLGIGEGATLPAQARAITHWFPRERRGVVQGFTHSFSRLGNAVTPPIVAALMTW
                     LSWRAAFFVIGAVTLVWLAWWIVGFREHPAGDDDGRPRAARPVAPSGPTPWGPLFRRM
                     APTIFVYFCYGWTAWLFFTWLPTFFLNGQGLNLKSTALFASGVFFAGVVGDTLGGWLC
                     DRIYRKTGNLALSRQSVIVTSFVGALACLLPLAFVHSTAGVALCLSGSFLCLELTIGP
                     IWAVPSDIAPSHAGIASGMMNAGSAISGILSPILFGYLVDRTGSWTVPFIGSVAMLLI
                     GIVAALRIRPDRALSESMPALADAPAAPSAH"
     misc_feature    complement(121210..122418)
                     /locus_tag="BCAM0108"
                     /note="HMMPfam hit to PF00083, Sugar (and other)
                     transporter, score 0.00026"
                     /inference="protein motif:HMMPfam:PF00083"
     misc_feature    complement(join(121252..121320,121333..121401,
                     121438..121506,121519..121587,121624..121692,
                     121720..121788,121897..121965,122158..122226,
                     122245..122313,122350..122418))
                     /locus_tag="BCAM0108"
                     /note="10 probable transmembrane helices predicted for
                     BCAM0108 by TMHMM2.0 at aa 12-34, 47-69, 76-98, 163-185,
                     222-244, 254-276, 289-311, 316-338, 351-373 and 378-400"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    complement(121330..122409)
                     /locus_tag="BCAM0108"
                     /note="HMMPfam hit to PF07690, Major Facilitator
                     Superfamily, score 1.1e-59"
                     /inference="protein motif:HMMPfam:PF07690"
     misc_feature    complement(121540..121572)
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     misc_feature    complement(122152..122184)
                     /note="PS00626 Regulator of chromosome condensation (RCC1)
                     signature 2."
                     /inference="protein motif:Prosite:PS00626"
     sig_peptide     complement(122356..122451)
                     /locus_tag="BCAM0108"
                     /note="Signal peptide predicted for BCAM0108 by SignalP
                     2.0 HMM (Signal peptide probability 0.714) with cleavage
                     site probability 0.567 between residues 32 and 33"
                     /inference="protein motif:SignalP:2.0"
     CDS             122633..123319
                     /transl_table=11
                     /locus_tag="BCAM0109"
                     /product="putative membrane protein"
                     /note="No significant database matches"
                     /db_xref="EnsemblGenomes-Gn:BCAM0109"
                     /db_xref="EnsemblGenomes-Tr:CAR53965"
                     /db_xref="GOA:B4EGN3"
                     /db_xref="UniProtKB/TrEMBL:B4EGN3"
                     /protein_id="CAR53965.1"
                     /translation="MTDDDELSLRPESRFWQLAPVRWWIRGHGRDGYSFGLLLCPLAI
                     VFVLEFVCVMAGALYTSIAVSAVATLFLGIAGFHGARREWLMTAAPARALVKARMKKA
                     AERLASLGVGATVLAIFVAATSLSLVMSGRPVLDSVSKDAVSIFIALVFLPVYVSGAV
                     RKLAIARIEELEALRHATVGTQLKFDRAGAVRAVVVQGAAGTGTVSVMEYTVLGFSPP
                     LDQVGREPRA"
     misc_feature    join(122726..122794,122804..122872,122948..123016,
                     123059..123127)
                     /locus_tag="BCAM0109"
                     /note="4 probable transmembrane helices predicted for
                     BCAM0109 by TMHMM2.0 at aa 32-54, 58-80, 106-128 and
                     143-165"
                     /inference="protein motif:TMHMM:2.0"
     CDS             complement(123339..124424)
                     /transl_table=11
                     /locus_tag="BCAM0110"
                     /product="two-component regulatory system, sensor kinase
                     protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0110"
                     /db_xref="EnsemblGenomes-Tr:CAR53966"
                     /db_xref="GOA:B4EGN4"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR036097"
                     /db_xref="InterPro:IPR036890"
                     /db_xref="UniProtKB/TrEMBL:B4EGN4"
                     /protein_id="CAR53966.1"
                     /translation="MRLDGLSRQIALTMGAIAFGITVLIVVTAYVFYYLLYQYSPEYF
                     KPQSWVPSGPEWVWIISTTLVGLLIAVVVAVNLSRRILVPLNSVTDSIRRVARGDLGA
                     RAVAGDRSLKEAALLADNFNALASELQRVTDEQTFWNAAIAHELRTPVTVLRGRLQGL
                     AEGVFTPSDALYRSLLAQVEGLTRLIEDLRVVSLADSGHLSIEIRDTDLAAEVRAVVD
                     AFAHALQAAGQHPEFDLDPRRMRCDPVRLRQALLALLENARRHAVPGAIRIQTRIENG
                     MCRLRVEDDGPGIPAEFAPHVFQAFRRVDETQPGGTGLGLAVVAAIAHAHRGEALCVP
                     TGAGGTRFEVRWPDDLTPAPDSERFPA"
     misc_feature    complement(123378..123701)
                     /locus_tag="BCAM0110"
                     /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
                     gyrase B-, and HSP90, score 3e-34"
                     /inference="protein motif:HMMPfam:PF02518"
     misc_feature    complement(123831..124025)
                     /locus_tag="BCAM0110"
                     /note="HMMPfam hit to PF00512, His Kinase A
                     (phosphoacceptor) domain, score 5e-11"
                     /inference="protein motif:HMMPfam:PF00512"
     misc_feature    complement(124035..124250)
                     /locus_tag="BCAM0110"
                     /note="HMMPfam hit to PF00672, HAMP domain, score 2.2e-09"
                     /inference="protein motif:HMMPfam:PF00672"
     misc_feature    complement(join(124191..124259,124323..124391))
                     /locus_tag="BCAM0110"
                     /note="2 probable transmembrane helices predicted for
                     BCAM0110 by TMHMM2.0 at aa 12-34 and 56-78"
                     /inference="protein motif:TMHMM:2.0"
     CDS             complement(124421..125158)
                     /transl_table=11
                     /locus_tag="BCAM0111"
                     /product="two-component regulatory system, response
                     regulator protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0111"
                     /db_xref="EnsemblGenomes-Tr:CAR53967"
                     /db_xref="GOA:B4EGN5"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR001867"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="InterPro:IPR016032"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="InterPro:IPR039420"
                     /db_xref="UniProtKB/TrEMBL:B4EGN5"
                     /protein_id="CAR53967.1"
                     /translation="MPEFPSSPGAGQGAQALVLIAEDEPEIAEILIAYFARNGLRTVH
                     AADGRRALELHLSLKPDLVLLDVQMPHVDGWKVLAEIRHRGDTPVIMLTALDQDIDKL
                     TGLRIGADDYVVKPFNPAEVVARAQAVLRRSMAGARQEEQRVLRAAPFEIDLEHHEAT
                     VEVDGVRHTLVLTLTEFKLLAQLARAPRRVFSRAELMATCLPEGDALERTVDSHVSKL
                     RKKLDDLGVAGVPASVRGVGYKLWSGE"
     misc_feature    complement(124436..124660)
                     /locus_tag="BCAM0111"
                     /note="HMMPfam hit to PF00486, Transcriptional regulatory
                     protein, C te, score 1.2e-14"
                     /inference="protein motif:HMMPfam:PF00486"
     misc_feature    complement(124778..125113)
                     /locus_tag="BCAM0111"
                     /note="HMMPfam hit to PF00072, Response regulator receiver
                     domain, score 7.5e-36"
                     /inference="protein motif:HMMPfam:PF00072"
     CDS             125740..127071
                     /transl_table=11
                     /locus_tag="BCAM0112"
                     /product="amine oxidase"
                     /note="Similar to the N-terminal region of Bos taurus
                     amine oxidase [flavin-containing] A MAOA SWALL:AOFA_BOVIN
                     (SWALL:P21398) (527 aa) fasta scores: E(): 1.4e-26, 31.33%
                     id in 466 aa"
                     /db_xref="EnsemblGenomes-Gn:BCAM0112"
                     /db_xref="EnsemblGenomes-Tr:CAR53968"
                     /db_xref="GOA:B4EGN6"
                     /db_xref="InterPro:IPR002937"
                     /db_xref="InterPro:IPR036188"
                     /db_xref="UniProtKB/TrEMBL:B4EGN6"
                     /protein_id="CAR53968.1"
                     /translation="MLDVAIVGAGLAGLTAARDLRYAGCESFVVLEARDRVGGRTLNY
                     DVGGGYVTEVGGQWIGPGQTAVADLARELEVGTFPSYYTGKTVILGGDGRAEIDLEGT
                     FGTDEAVAAKLSRLSRDVPCGAPWTSPKARELDRLSVGDWLATQGIKAEDRMGWNASI
                     SLSGGVAPAKMGLLHFLSMINSADCDYAQLDSIKHSAQETRFVGGSQLLSIRMAQQLG
                     DKVRLSSPVRRIVGWDRDIVTLQTDRGTVRAKKVVMALHPALCHQVRFDPPLPDKRVA
                     LQRAWPAHSPARKTAMVYRRPFWRDKGLNGHIFQTDGPVFWAYDNSPPGGEIGVINAF
                     VRNALMPSDPQAAKQMHMDLYAQAWGDEARAPVSYHDRDWGLADPWTLTCVSAIPPGF
                     WSAHGEALRAPCGNLIWSGTETANIWAGYMDGAVRAGHQSALQALNALRHA"
     misc_feature    125746..126867
                     /locus_tag="BCAM0112"
                     /note="HMMPfam hit to PF01266, FAD dependent
                     oxidoreductase, score 0.00058"
                     /inference="protein motif:HMMPfam:PF01266"
     misc_feature    125770..127050
                     /locus_tag="BCAM0112"
                     /note="HMMPfam hit to PF01593, Flavin containing amine
                     oxidoreductase, score 1.7e-42"
                     /inference="protein motif:HMMPfam:PF01593"
     CDS             127064..127741
                     /transl_table=11
                     /locus_tag="BCAM0113"
                     /product="putative cytochrome c precursor"
                     /note="C-terminal region is similar to Chromatium vinosum
                     cytochrome subunit of sulfide dehydrogenase precursor FccA
                     SWALL:CYSD_CHRVI (SWALL:Q06529) (199 aa) fasta scores:
                     E(): 7.1e-06, 26.4% id in 178 aa"
                     /db_xref="EnsemblGenomes-Gn:BCAM0113"
                     /db_xref="EnsemblGenomes-Tr:CAR53969"
                     /db_xref="GOA:B4EGN7"
                     /db_xref="InterPro:IPR009056"
                     /db_xref="InterPro:IPR024167"
                     /db_xref="InterPro:IPR036909"
                     /db_xref="UniProtKB/TrEMBL:B4EGN7"
                     /protein_id="CAR53969.1"
                     /translation="MLRITKMKKRVLLLTAAVATGALLALYGPTLLGFHRLQRHIDTA
                     AQADDADGGPWPRVTDVCMGCHGVKGTSLSQAYPSLAGQPAQYVAAQLRAFAGGQRAN
                     PTMGPLAMTMSEAEITRLAGYYAKQAPLDNRYFKPDARLRTKGEQWVTGGACAACHGA
                     RLTGQARFPRLAGQGYDYLLAQLDAFATGSRREATGTMQRVAQAMSADDRAAVATYLA
                     SLSPATQ"
     sig_peptide     127064..127138
                     /locus_tag="BCAM0113"
                     /note="Signal peptide predicted for BCAM0113 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.860 between residues 25 and 26"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    127097..127165
                     /locus_tag="BCAM0113"
                     /note="1 probable transmembrane helix predicted for
                     BCAM0113 by TMHMM2.0 at aa 12-34"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    127211..127447
                     /locus_tag="BCAM0113"
                     /note="HMMPfam hit to PF00034, Cytochrome c, score 0.022"
                     /inference="protein motif:HMMPfam:PF00034"
     misc_feature    127247..127264
                     /note="PS00190 Cytochrome c family heme-binding site
                     signature."
                     /inference="protein motif:Prosite:PS00190"
     misc_feature    127487..127726
                     /locus_tag="BCAM0113"
                     /note="HMMPfam hit to PF00034, Cytochrome c, score 0.017"
                     /inference="protein motif:HMMPfam:PF00034"
     misc_feature    127523..127540
                     /note="PS00190 Cytochrome c family heme-binding site
                     signature."
                     /inference="protein motif:Prosite:PS00190"
     CDS             127777..128451
                     /transl_table=11
                     /locus_tag="BCAM0114"
                     /product="putative membrane protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0114"
                     /db_xref="EnsemblGenomes-Tr:CAR53970"
                     /db_xref="GOA:B4EGN8"
                     /db_xref="UniProtKB/TrEMBL:B4EGN8"
                     /protein_id="CAR53970.1"
                     /translation="MDHRSLVLCLSSATLAATTGVYGFKFVRKRNFLLGFEWWIVTIS
                     ASNAVIFFATESPVSYFISHFLDAFSRGFGMPVIAVAGLMAVTHGYRPSIRQDVTLFV
                     LATLGTIALVAGVLQHALPYFYVAMWTLMSIYLAGFAWRLARAGHALHALTTTLALVA
                     SQAIACIYDFYRIPGEDTNVVFNFYVLALLTWSYLTVALYYAYGALEREKGRSRTGAG
                     VLSYPK"
     sig_peptide     127777..127824
                     /locus_tag="BCAM0114"
                     /note="Signal peptide predicted for BCAM0114 by SignalP
                     2.0 HMM (Signal peptide probability 0.997) with cleavage
                     site probability 0.917 between residues 16 and 17"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    join(127789..127848,127867..127935,127978..128046,
                     128065..128124,128134..128202,128221..128289,
                     128317..128385)
                     /locus_tag="BCAM0114"
                     /note="7 probable transmembrane helices predicted for
                     BCAM0114 by TMHMM2.0 at aa 5-24, 31-53, 68-90, 97-116,
                     120-142, 149-171 and 181-203"
                     /inference="protein motif:TMHMM:2.0"
     CDS             128525..129127
                     /transl_table=11
                     /locus_tag="BCAM0115"
                     /product="TetR family regulatory protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0115"
                     /db_xref="EnsemblGenomes-Tr:CAR53971"
                     /db_xref="GOA:B4EGN9"
                     /db_xref="InterPro:IPR001647"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR036271"
                     /db_xref="UniProtKB/TrEMBL:B4EGN9"
                     /protein_id="CAR53971.1"
                     /translation="MDPVRLTRAERRDATRERLLGAARAILAEKGYAAASVEDIAAAA
                     GHTRGAFYSNFGGKADVLFELLRRDRDEAAAALRRIVGSPDPADDAQRAMLAYWRRGA
                     TQRAVHLMWLDAQLQAARDPRFRARFGALLRDRQALAAACIDAYAARAGVSLPLPTRV
                     LALGLTALCDGMQSHGAVDALADAVLVGFITHTVFDHLRR"
     misc_feature    128579..128719
                     /locus_tag="BCAM0115"
                     /note="HMMPfam hit to PF00440, Bacterial regulatory
                     proteins, tetR family, score 6.3e-14"
                     /inference="protein motif:HMMPfam:PF00440"
     CDS             129372..130205
                     /transl_table=11
                     /locus_tag="BCAM0116"
                     /product="putative phytanoyl-CoA dioxygenase protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0116"
                     /db_xref="EnsemblGenomes-Tr:CAR53972"
                     /db_xref="GOA:B4EGP0"
                     /db_xref="InterPro:IPR008775"
                     /db_xref="UniProtKB/TrEMBL:B4EGP0"
                     /protein_id="CAR53972.1"
                     /translation="MDAMKRKAFFEDGAVLVEGVLDDEQLAQCRAVYDWGMENPGPMA
                     TTLLDGTEYKSHNDNANPYAKERLDALVGTLPFGPLFADLWGSKHVWYFAEELFMKAG
                     GKSARSPWHQDTSYLPWQGMHFGNAWISFEHVPKRNALEIVRGSHHGVRHDGTTFQNA
                     EDPTDPLHGGDVWPRLPDIEAERRVAPDAYDILSWETKPGDVLLLHPGVLHGGGAVDA
                     DFPDRHTLVLRFFGDDAVFSPLPDESRSGFTPAGVLFVEELAALKAGDPFRAPCFRQL
                     V"
     misc_feature    129390..130046
                     /locus_tag="BCAM0116"
                     /note="HMMPfam hit to PF05721, Phytanoyl-CoA dioxygenase
                     (PhyH), score 4.6e-06"
                     /inference="protein motif:HMMPfam:PF05721"
     CDS             130222..130635
                     /transl_table=11
                     /locus_tag="BCAM0117"
                     /product="putative endoribonuclease"
                     /db_xref="EnsemblGenomes-Gn:BCAM0117"
                     /db_xref="EnsemblGenomes-Tr:CAR53973"
                     /db_xref="InterPro:IPR006175"
                     /db_xref="InterPro:IPR035959"
                     /db_xref="InterPro:IPR038743"
                     /db_xref="UniProtKB/TrEMBL:B4EGP1"
                     /protein_id="CAR53973.1"
                     /translation="MTATPKRQSIVPAAFQPWYDAYHFSPATRVGDTIWVSGQVGLDA
                     QMQPADGVQAQARIAFECLKAILQEAGASLADVVELTTFHTDLQRETEAFAAVKDVYF
                     PNRYPSWTAVGVTQLALPGLCVEIRAVAVAGSGKG"
     misc_feature    130222..130617
                     /locus_tag="BCAM0117"
                     /note="HMMPfam hit to PF01042, Endoribonuclease L-PSP,
                     score 4.2e-31"
                     /inference="protein motif:HMMPfam:PF01042"
     CDS             130845..132209
                     /transl_table=11
                     /locus_tag="BCAM0118"
                     /product="putative lipoprotein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0118"
                     /db_xref="EnsemblGenomes-Tr:CAR53974"
                     /db_xref="InterPro:IPR010752"
                     /db_xref="UniProtKB/TrEMBL:B4EGP2"
                     /protein_id="CAR53974.1"
                     /translation="MNKHRFWTTSAIAAAACVAIGTAVAADDLTPAGADRSASKDGAV
                     PAYAGKQSPDAGWEWGKVRGDFWKHRNEKPLYSIDAANVDKYADKLSPGQVALIKQKK
                     GYRMDVYPSHRECQLPDAAEQNSKANLTAAKLGPAGDTLASAVLPGVPFPQPKNGVEA
                     MLNYEMRYRGEGVDWAQMVTTVSPRPGSSEWIDAIGPQTLYFPSAKLGKFSPQDVDQL
                     SAAVYFQMNSPAALAGQAFVQRQYFDKASETYYYFPGQRRVRRMPAYTHDAPLIGFEN
                     QYLIDEGNMINGSLDRFNWKLVGKKEMIVPYNAFGMYRFKSKLHDVATPDGVAAANRR
                     YETHRVWVVEAALKPSARHVASKKVFYLDEDSWLALVGEDYDAQGKLWKVRESYPIPV
                     WELGGTCDNEPLAQYDMNNGRYVLDATSIGQGKDVRWLGQADDPRFKQDFYTAESLRS
                     VSER"
     sig_peptide     130845..130919
                     /locus_tag="BCAM0118"
                     /note="Signal peptide predicted for BCAM0118 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.751 between residues 25 and 26"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    130851..132206
                     /locus_tag="BCAM0118"
                     /note="HMMPfam hit to PF07044, Protein of unknown function
                     (DUF1329), score 2.9e-114"
                     /inference="protein motif:HMMPfam:PF07044"
     misc_feature    130863..130922
                     /locus_tag="BCAM0118"
                     /note="1 probable transmembrane helix predicted for
                     BCAM0118 by TMHMM2.0 at aa 7-26"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    130863..130895
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     CDS             132288..134132
                     /transl_table=11
                     /locus_tag="BCAM0119"
                     /product="putative exported protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0119"
                     /db_xref="EnsemblGenomes-Tr:CAR53975"
                     /db_xref="InterPro:IPR010727"
                     /db_xref="UniProtKB/TrEMBL:B4EGP3"
                     /protein_id="CAR53975.1"
                     /translation="MESAGLFRNTTILVAMASAATSSAYAYDFTVGGGAVQGSWVTNL
                     TAGAGIRTKNPSCSLTGDPNAFGCGAGANTNQWGYADNGDLNYRKGQPFSTYVSATSE
                     LLLKMPSEGLKFMVRGTGMYDFMAKNTNRTPLSSTAAAQVVYNAQLLDLWAQKDFTLG
                     GRNAHVRLGNQVINWGESMFAQSGINATNSIDTQKLLIPGSQLKQALLPAPMVSLAAD
                     LSHGFSTEAYYQFQWNGNRYPPVGSYWSVTNGFGRGAEPFTINTNNLNVTGPSAGTIA
                     NAIGGSGAAGNQDTLNAIRNGLVNGAYAGPPFNDIGLPSTTTLPAKYRPQFGVKFNYS
                     PRAFDANFAFYYLNYTDKSPVLASLANGTEQWSYLGRRQLFGVSANFGVGPWAIGTEL
                     SYRPRDAVALSSCYGAGGPLDLNTNGVAGIDCQQWVDKKKFQYDINGLLALTRSEYPF
                     LKLLGADSAALTWELTWIYYPGLKSSGVTRTIDGQTVTQVPQTGYLPWLNNGSAAGYP
                     IGMAQGTSSSVGATIDFNWTYDGSLIPGWQVTPGVTFSTGLYGYTPTFTANYVQGAKS
                     LNVYVLFNQNPPNWQAGINFTSFWGGHNTVGQPYADRNFVGLFVTRNF"
     sig_peptide     132288..132365
                     /locus_tag="BCAM0119"
                     /note="Signal peptide predicted for BCAM0119 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.999 between residues 26 and 27"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    132315..134129
                     /locus_tag="BCAM0119"
                     /note="HMMPfam hit to PF06980, Protein of unknown function
                     (DUF1302), score 5e-79"
                     /inference="protein motif:HMMPfam:PF06980"
     CDS             134201..136561
                     /transl_table=11
                     /locus_tag="BCAM0120"
                     /product="putative membrane protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0120"
                     /db_xref="EnsemblGenomes-Tr:CAR53976"
                     /db_xref="GOA:B4EGP4"
                     /db_xref="InterPro:IPR000731"
                     /db_xref="InterPro:IPR004869"
                     /db_xref="UniProtKB/TrEMBL:B4EGP4"
                     /protein_id="CAR53976.1"
                     /translation="MLNRLVSRLEGLFFGHRAIVLAAIALFTVAMAVFAVQLRMDAGF
                     EKQMPIGHEYIRTFQQYRNDLLGANRITVVVRAKHGSIWSKQGLTRLYDVTQAVTYLP
                     NVDRIGVRSLWTPNAFVNEVTDEGFRAEPIIPGTVTPDQLTPERVQSIRRATTLGGYV
                     GTLVSHGEDSAMITAELNERDSAGKVLDYVAFNHLLEEKIRKPFEDAGYEIQIIGFAK
                     QIGDIADGATAVLGFCAVALLLTTLAVYWYCHSVRFTVLLVACSLTSLVWQFGTLKLL
                     GFGLDPLAVLVPFLVFAIGVSHGVQQVNFIVREIAHGQSSFDAARHSFSGLLIPGVLA
                     LITAFVSFITLLLIPIPMVRELAITASLGVAYKIVTNLILLPVAASCFNFTKTYADNS
                     LKRAQQRAKPLRVLARVAQPKYAGVTVALTVAIFALAAWQSRDRVIGTLQPGAPELRT
                     DARFNRDATSIAGNYDMGLDWLTVAIESTGKACDNPAVGLYEDDFSAAMKTEPGVVSV
                     QSYSAMLRAYNQGYNEDFPKMNVVPIAAENYSAVSVDVSRVKGFMSRDCGMTAVHLFL
                     TDHKATTINRILDDVKQYRASHPFPGITVRLAAGNAGVLAATNDEVEKSELPMMLYVY
                     AAILVLVFLAYRDWRAMLACCVPLSVATFIGYWFMKELQIGLTVATLPVMVLAVGIGV
                     DYAFYIYNRLQVHLAGGQDIVKAVQHAMLEVGVATIFTAITLAIGVATWSFSALKFQA
                     DMGKLLAFMFIVNLVMAMTALPALASLLERGFPRRKPARAPGLFSH"
     sig_peptide     134201..134305
                     /locus_tag="BCAM0120"
                     /note="Signal peptide predicted for BCAM0120 by SignalP
                     2.0 HMM (Signal peptide probability 0.997) with cleavage
                     site probability 0.950 between residues 35 and 36"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    join(134237..134305,134879..134947,134960..135019,
                     135047..135115,135176..135244,135287..135355,
                     135440..135493,136052..136105,136124..136177,
                     136205..136264,136325..136393,136436..136504)
                     /locus_tag="BCAM0120"
                     /note="12 probable transmembrane helices predicted for
                     BCAM0120 by TMHMM2.0 at aa 13-35, 227-249, 254-273,
                     283-305, 326-348, 363-385, 414-431, 618-635, 642-659,
                     669-688, 709-731 and 746-768"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    135311..135343
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     CDS             136593..136877
                     /transl_table=11
                     /locus_tag="BCAM0121"
                     /product="putative lipoprotein"
                     /note="No significant database matches"
                     /db_xref="EnsemblGenomes-Gn:BCAM0121"
                     /db_xref="EnsemblGenomes-Tr:CAR53977"
                     /db_xref="UniProtKB/TrEMBL:B4EGP5"
                     /protein_id="CAR53977.1"
                     /translation="MVKTFAVCGALCLVAAAFARFHETVAQQPAPAHAFATDVKRVSV
                     RHTTGGEPAAAPSPNDTDAGRRTAAAQVADKPPAIVLGVAHAGWSVLFSH"
     sig_peptide     136593..136694
                     /locus_tag="BCAM0121"
                     /note="Signal peptide predicted for BCAM0121 by SignalP
                     2.0 HMM (Signal peptide probability 0.998) with cleavage
                     site probability 0.464 between residues 34 and 35"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    136626..136649
                     /note="PS00306 Caseins alpha/beta signature."
                     /inference="protein motif:Prosite:PS00306"
     CDS             136908..137876
                     /transl_table=11
                     /locus_tag="BCAM0122"
                     /product="BNR/Asp-box repeat protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0122"
                     /db_xref="EnsemblGenomes-Tr:CAR53978"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR028203"
                     /db_xref="UniProtKB/TrEMBL:B4EGP6"
                     /protein_id="CAR53978.1"
                     /translation="MIKTLVACTALCAAAATFAQPQDGTVAAWAAQPAHAWAAPAHRM
                     LMDAARAGTRIVAVGEHGIVLLSDDDGKTWRQARRVPVAATLSAVSFADAKHGWAVGQ
                     WGAILATDDGGDTWVTQRLDTSVDQPLFSVLFTSARDGMAVGLWSLMLQTHDGGRTWA
                     RTTLPKPPGGGKADRNLYHVFADAAQALYIVSEQGMVLKSADGGANWTYLPTGGKGTL
                     WSGVAMPDGRIVVGGLLGSLFESRDGGATWTALHTGTRSSITDLVASGGGLTGVGLDG
                     LVLTQRVAGGPFDVVQRADRATLSAALIDARGKPVLFSQDGVLAAP"
     sig_peptide     136908..136964
                     /locus_tag="BCAM0122"
                     /note="Signal peptide predicted for BCAM0122 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.905 between residues 19 and 20"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    137100..137135
                     /locus_tag="BCAM0122"
                     /note="HMMPfam hit to PF02012, BNR/Asp-box repeat, score
                     0.51"
                     /inference="protein motif:HMMPfam:PF02012"
     misc_feature    137226..137261
                     /locus_tag="BCAM0122"
                     /note="HMMPfam hit to PF02012, BNR/Asp-box repeat, score
                     7.7"
                     /inference="protein motif:HMMPfam:PF02012"
     misc_feature    137355..137390
                     /locus_tag="BCAM0122"
                     /note="HMMPfam hit to PF02012, BNR/Asp-box repeat, score
                     13"
                     /inference="protein motif:HMMPfam:PF02012"
     misc_feature    137499..137534
                     /locus_tag="BCAM0122"
                     /note="HMMPfam hit to PF02012, BNR/Asp-box repeat, score
                     2.8"
                     /inference="protein motif:HMMPfam:PF02012"
     misc_feature    137622..137657
                     /locus_tag="BCAM0122"
                     /note="HMMPfam hit to PF02012, BNR/Asp-box repeat, score
                     0.12"
                     /inference="protein motif:HMMPfam:PF02012"
     CDS             137944..139398
                     /transl_table=11
                     /locus_tag="BCAM0123"
                     /product="putative amine oxidase"
                     /note="C-terminus is similar to the N-terminal region of
                     Homo sapiens amine oxidase [flavin-containing] B MAOB
                     SWALL:AOFB_HUMAN (SWALL:P27338) (519 aa) fasta scores:
                     E(): 4.1e-32, 33.54% id in 462 aa"
                     /db_xref="EnsemblGenomes-Gn:BCAM0123"
                     /db_xref="EnsemblGenomes-Tr:CAR53979"
                     /db_xref="GOA:B4EH23"
                     /db_xref="InterPro:IPR001613"
                     /db_xref="InterPro:IPR002937"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="InterPro:IPR036188"
                     /db_xref="UniProtKB/TrEMBL:B4EH23"
                     /protein_id="CAR53979.1"
                     /translation="MQARRRILRAAAAGAASLATGEVSFAEGAASASADRGVFDVVII
                     GAGLAGLTAARDLKRAGCESFVVVEARDRVGGRTYNHDLGNGVVSEAGGQWIGPGQTA
                     IADLARELGVDTFPTYYAGKTVVLAGDARVAQDFHGGSGGDDAIGAKLGALARGVPSR
                     EPWTAQHAAELDKLTYGDWLLKQGVTYEDGYFLGLAAKLSLGGAPAQLGLLHYLSVIN
                     SADCDYAKLESTKGGAQETRFVGGSQVLSLRMASELGAKVQLSCPVRKISGWDRDVVD
                     VQTDRGVLRARRVIVALNPALCQQIVFDPPLPDGRAQLQRNWPANAPMRKTVHVYDRP
                     FWRDDGYNGQIFEVGGPVFMAYDNSPPDGSIGVLAAFVAPGALPAEPKAAERTLSAIF
                     ARALGDKALHPTQFHDYDWGRVDPWTLQCIHPLPPGFWTKWGRFLRPEAGRLIWSGTE
                     TADLWPGAMDGAVRSGHRAALQALGKLAGRGGEA"
     sig_peptide     137944..138021
                     /locus_tag="BCAM0123"
                     /note="Signal peptide predicted for BCAM0123 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.444 between residues 26 and 27"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    138061..139140
                     /locus_tag="BCAM0123"
                     /note="HMMPfam hit to PF01266, FAD dependent
                     oxidoreductase, score 2.7e-06"
                     /inference="protein motif:HMMPfam:PF01266"
     misc_feature    138085..139365
                     /locus_tag="BCAM0123"
                     /note="HMMPfam hit to PF01593, Flavin containing amine
                     oxidoreductase, score 1.3e-46"
                     /inference="protein motif:HMMPfam:PF01593"
     CDS             139399..140070
                     /transl_table=11
                     /locus_tag="BCAM0124"
                     /product="putative cytochrome c precursor"
                     /db_xref="EnsemblGenomes-Gn:BCAM0124"
                     /db_xref="EnsemblGenomes-Tr:CAR53980"
                     /db_xref="GOA:B4EH24"
                     /db_xref="InterPro:IPR009056"
                     /db_xref="InterPro:IPR024167"
                     /db_xref="InterPro:IPR036909"
                     /db_xref="UniProtKB/TrEMBL:B4EH24"
                     /protein_id="CAR53980.1"
                     /translation="MKRTWMIGAALVIAGVAAAGTLYGPDLVDGMRYQKAMTAIGEGD
                     RANGGAWPQPQETCFFCHGVHGQSQNAWYPSLSGQPATYLAAQLRAFATNQRRNAYMG
                     PLSRELDDAKIAALATYFARQAPARNEAVPADAALDKRGMALVEARSCRACHGAALTG
                     KDPAPRLAGQGQLYLEAQLAAFRSGERHDPTGAMNALAATLSGDDTRAVAHYLAGLSP
                     DGAAK"
     sig_peptide     139399..139455
                     /locus_tag="BCAM0124"
                     /note="Signal peptide predicted for BCAM0124 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.877 between residues 19 and 20"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    139411..139479
                     /locus_tag="BCAM0124"
                     /note="1 probable transmembrane helix predicted for
                     BCAM0124 by TMHMM2.0 at aa 5-27"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    139846..139863
                     /note="PS00190 Cytochrome c family heme-binding site
                     signature."
                     /inference="protein motif:Prosite:PS00190"
     CDS             140244..141374
                     /transl_table=11
                     /locus_tag="BCAM0125"
                     /product="saccharopine dehydrogenase family protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0125"
                     /db_xref="EnsemblGenomes-Tr:CAR53981"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="UniProtKB/TrEMBL:B4EH25"
                     /protein_id="CAR53981.1"
                     /translation="MAKHPVVVYGASGYTGMLIMDWLIDQNIPFTAVARNAARAKEMM
                     AQRVVRLESAQYEIIEAEHDVDALVKAFRGAKVVCNTVGPFSSFGLVGVEAALKAGCH
                     HLDTTGEQSYIRAVRDEFGEQYRQAGLLASSSNAYMYTFAEIAAELALETPGIDALET
                     ATLTRGPRGAAGVSIGSTATIFDGARHESCYLWEKALVPHAADASFTVATPELMQPVF
                     CLPWGGTSLPVYFEHDARVRSCISCVGFYDNNVMKLVHQFGQKWEAEYKHLPREQQDE
                     VLKQVVASTTPTMPPRERTTIQRSVDVAIGRGQLAAVRATVHGVTPYISTGAIHAAGV
                     LKLLDGETARTGFASGSKAFGHRYLLGFLEQRGLARATVTQL"
     misc_feature    140259..141356
                     /locus_tag="BCAM0125"
                     /note="HMMPfam hit to PF03435, Saccharopine dehydrogenase,
                     score 4.9e-07"
                     /inference="protein motif:HMMPfam:PF03435"
     misc_feature    141213..141245
                     /note="PS00626 Regulator of chromosome condensation (RCC1)
                     signature 2."
                     /inference="protein motif:Prosite:PS00626"
     CDS             141417..142970
                     /transl_table=11
                     /locus_tag="BCAM0126"
                     /product="putative AMP-binding enzyme"
                     /db_xref="EnsemblGenomes-Gn:BCAM0126"
                     /db_xref="EnsemblGenomes-Tr:CAR53982"
                     /db_xref="GOA:B4EH26"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="InterPro:IPR025110"
                     /db_xref="InterPro:IPR042099"
                     /db_xref="UniProtKB/TrEMBL:B4EH26"
                     /protein_id="CAR53982.1"
                     /translation="MAIIDFYDRGWRLNPDGIAYIQGDRNYTFQEIGELSCRIANGLL
                     AAGFAKEAKAAVWADNDVIGWSCALGMWRAGLAYIPVNGRNAVAENQYVLDAFDCEVL
                     FFHHAFAAAIDALRPSLPKVRLWVCLDADLPWAPSLASWSEHQPATPPVVDYAMDDVV
                     ALSATGGTTGAPKGVMNTHRSLQTYFAQFMIAMTYDDARPVNLAAAPMTHTAGMMSLP
                     CTARGGTVVVLPKPDPALLLGAIVKHRVTEFFLPPTVIYRLLDIPGIEQVDFSSLRYF
                     LYGAAPMSVEKLKRAIDVFGPVMTGGYGQTEAPASISYLTPAEHFVDGQLASDARLAS
                     VGRPNPLVRVEIVGERGELLKQGETGEICVRGDLVMKGYYRAPDKTAETIVDGWLHTG
                     DIGHLDRDGYLHITDRKKDMIISGGFNVYPSEIEQVIWAHPAVQDCAVIGVPDDKWGE
                     AVKAVVELNAGQQVSAEELVALCKEKLGSVKAPKSVDFVAALPRSTAGKVLKKDLRER
                     YWQGQQRRI"
     misc_feature    141498..142736
                     /locus_tag="BCAM0126"
                     /note="HMMPfam hit to PF00501, AMP-binding enzyme, score
                     1.2e-111"
                     /inference="protein motif:HMMPfam:PF00501"
     misc_feature    141900..141935
                     /note="PS00455 Putative AMP-binding domain signature."
                     /inference="protein motif:Prosite:PS00455"
     CDS             142996..144237
                     /transl_table=11
                     /locus_tag="BCAM0127"
                     /product="putative thiolase"
                     /note="Similar to the N-terminal region of Rattus
                     norvegicus nonspecific lipid-transfer protein,
                     mitochondrial precursor SCP2 SWALL:NLTP_RAT (SWALL:P11915)
                     (547 aa) fasta scores: E(): 4.8e-30, 36.54% id in 405 aa"
                     /db_xref="EnsemblGenomes-Gn:BCAM0127"
                     /db_xref="EnsemblGenomes-Tr:CAR53983"
                     /db_xref="GOA:B4EH27"
                     /db_xref="InterPro:IPR002155"
                     /db_xref="InterPro:IPR016039"
                     /db_xref="InterPro:IPR020616"
                     /db_xref="InterPro:IPR020617"
                     /db_xref="UniProtKB/TrEMBL:B4EH27"
                     /protein_id="CAR53983.1"
                     /translation="MSNIYIAGIAMTVFGRHLDRSLDDLAREALQRALRDAGCHADAI
                     RAAFYAGITNGALQGQLSIPGQVVFSKIGLEGIPVFNVENACASGSTAVHLAVRQLQS
                     GACDVALALGAEKMNVADKAKSFALFDAGWDVSRVDENFAMLARLGEGIEPPPGSESD
                     RPYSRFMKIYAALCRHHMHTYGTTQRQIAAVSAKNHGHSVHNPYSQFRQPFTIDEVLA
                     AAPITYPITLPMCAPLSDGAAAAILCTEEGLERIGADRGRCIRIAASVIRSFTRRRID
                     EPHKHIGRLAALQAYEQAGVGPEDMDVAEVHDASAMGEIIQAENLGFVPLGEGGPAAE
                     RGEFTLGGRIPINTSGGLESKGHPLGATGIGQLYELVTQLRGEAGARQVDGARHAIQE
                     NGGGLQGVEEAALAIHILSRD"
     misc_feature    142996..143736
                     /locus_tag="BCAM0127"
                     /note="HMMPfam hit to PF00108, Thiolase, N-terminal
                     domain, score 1e-06"
                     /inference="protein motif:HMMPfam:PF00108"
     CDS             144345..145733
                     /transl_table=11
                     /locus_tag="BCAM0128"
                     /product="putative FAD dependent oxidoreductase"
                     /db_xref="EnsemblGenomes-Gn:BCAM0128"
                     /db_xref="EnsemblGenomes-Tr:CAR53984"
                     /db_xref="GOA:B4EH28"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="InterPro:IPR036188"
                     /db_xref="UniProtKB/TrEMBL:B4EH28"
                     /protein_id="CAR53984.1"
                     /translation="MQAAGADALGPLARWGEEIRADAALRKYRPVGGWVEPPERAQPE
                     LEGDVQADAIVVGAGFAGLSTALELAARGASVVVLEREFAGFGASGRNAGYLAGGQGL
                     EYELFLKRVGHEQARRIVGFYDEGVAYVERKLAEYAIDCDYRASGIIRAGVHPSQEKR
                     LRESMATGIELGSPAQFLDGAAMRERGIPPAFLFGAYVPGGGTLDPGKYVTGLRRAAL
                     AAGVKLYENTALLDFDAGETVRVRTARGSASAPVLVLATNAYTPQLGLLGDKVMPLRV
                     SALETEPLSGAQLAALGWPNREGIVTSHLTMESHRLTARNTLLLTTKRLHYVYGSQTP
                     NVPDGDTYRALLKTLRARFPQLGDVPVRACWSGYISFAGDALPVVGAAGAHANVFYAA
                     GCSGHGVGTQSLIGRVLAERIHDGRSPVLDALTHKTPSMPPEPLRWCAMTAMLGVANL
                     LDERVNRRVRPM"
     misc_feature    144498..145580
                     /locus_tag="BCAM0128"
                     /note="HMMPfam hit to PF01266, FAD dependent
                     oxidoreductase, score 1.5e-85"
                     /inference="protein motif:HMMPfam:PF01266"
     CDS             145907..146578
                     /transl_table=11
                     /locus_tag="BCAM0129"
                     /product="TetR family regulatory protein"
                     /note="Poor database matches"
                     /db_xref="EnsemblGenomes-Gn:BCAM0129"
                     /db_xref="EnsemblGenomes-Tr:CAR53985"
                     /db_xref="GOA:B4EH29"
                     /db_xref="InterPro:IPR001647"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR036271"
                     /db_xref="InterPro:IPR039538"
                     /db_xref="UniProtKB/TrEMBL:B4EH29"
                     /protein_id="CAR53985.1"
                     /translation="MSNEQRSPRKRRTSTAAAAAGNTDGLRAQGLRTRNTIIRVARKL
                     LLEGGPLEFSQRAVAAAAGISVSNLQYYFPTRIAVLRAVIEPVIEAYLDDMKRAISSD
                     ASPRDVFEEIIVRSIADAKDAKYNALFRHFLSFAATDAECLKLCEEWYSALTRDLAQL
                     VRAVTPTFSAADSRHAATMLIALADGLAMQYGTIGRHTQALDAYFAATSRAIAYGTLT
                     VPAGK"
     misc_feature    146015..146155
                     /locus_tag="BCAM0129"
                     /note="HMMPfam hit to PF00440, Bacterial regulatory
                     proteins, tetR family, score 1.2e-08"
                     /inference="protein motif:HMMPfam:PF00440"
     misc_feature    146063..146128
                     /note="Predicted helix-turn-helix motif with score
                     1673.000, SD 4.89 at aa 53-74, sequence
                     FSQRAVAAAAGISVSNLQYYFP"
                     /inference="protein motif:helixturnhelix:EMBOSS"
     CDS             146750..148039
                     /transl_table=11
                     /locus_tag="BCAM0130"
                     /product="putative acyl-CoA dehydrogenase"
                     /db_xref="EnsemblGenomes-Gn:BCAM0130"
                     /db_xref="EnsemblGenomes-Tr:CAR53986"
                     /db_xref="GOA:B4EH30"
                     /db_xref="InterPro:IPR009075"
                     /db_xref="InterPro:IPR009100"
                     /db_xref="InterPro:IPR036250"
                     /db_xref="InterPro:IPR037069"
                     /db_xref="UniProtKB/TrEMBL:B4EH30"
                     /protein_id="CAR53986.1"
                     /translation="MIRLNKSAALPVVGMTGFETPLSEEESAIQHTVHRFARDVLRPI
                     GRELDRMTAEDVIAPGSPYWAAIVESAKLGLDPQLIAQFPPETAVRIESLIGEELGWG
                     DSGLAVSIGAATMPLMMAHTVGNAELIEMCAGKVGCWMNTQPDRGSDAAILYRQELAG
                     NGRQPVGNVTAKVGADEIVINGQSSAWISNGSVAQVALAYMAADYGDGFYGEGERSAF
                     TNGIAMILPLDLPGVSRGKPLDKIGQRSLPQGEIYFDNVKVPKRFAVALKDDYLGNLA
                     STWSYAGTHMCQVFVGAARAAFELALAYCHERKQGGALLMDHQMTHLRIGEMLRRLEM
                     ARAIARRSLAFSRMSPQSHPYATAQAKVSVTEEAMKITHEAFQLFGGNGTTREFPIEK
                     LFRDVRSALIEDGENYVLASRLGVLAGRLYENGWTRE"
     misc_feature    147554..147994
                     /locus_tag="BCAM0130"
                     /note="HMMPfam hit to PF00441, Acyl-CoA dehydrogenase,
                     C-terminal doma, score 3e-20"
                     /inference="protein motif:HMMPfam:PF00441"
     misc_feature    147599..147961
                     /locus_tag="BCAM0130"
                     /note="HMMPfam hit to PF08028, Acyl-CoA dehydrogenase,
                     C-terminal doma, score 6.5e-09"
                     /inference="protein motif:HMMPfam:PF08028"
     CDS             complement(148102..148983)
                     /transl_table=11
                     /gene="hchA"
                     /locus_tag="BCAM0131"
                     /product="chaperone protein HchA"
                     /db_xref="EnsemblGenomes-Gn:BCAM0131"
                     /db_xref="EnsemblGenomes-Tr:CAR53987"
                     /db_xref="GOA:B4EH31"
                     /db_xref="InterPro:IPR017283"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:B4EH31"
                     /protein_id="CAR53987.1"
                     /translation="MTSDTTQVDRTPAPDPAENNAYFPSPYSLSQYTSSKTDFDGADY
                     PNPYTGGKWKVLMIATDERYILMTNGKMFSTGNHPVEMLLPMHHMDKAGFEIDIATLS
                     GNPAKLELWAMPQDDEAVQSTYRKYLPKLKTPLKLSDVLDRHSGADSPYIAVFIPGGH
                     GVLAGIPHSKDVKRTLRWALDHDRHIITLCHGPACLLSAAVDEDPQDYPFKDYEICVF
                     PDALDTGPNLDIGYMPGPLPWLVAQSLEKLGARVLNKDMTGRCHQDRKLITGDSPLAS
                     NGVGKLAAAALLKEVGH"
     misc_feature    complement(148237..148614)
                     /gene="hchA"
                     /locus_tag="BCAM0131"
                     /note="HMMPfam hit to PF01965, DJ-1/PfpI family, score
                     0.0028"
                     /inference="protein motif:HMMPfam:PF01965"
     CDS             149338..151005
                     /transl_table=11
                     /locus_tag="BCAM0132"
                     /product="putative AMP-binding enzyme"
                     /db_xref="EnsemblGenomes-Gn:BCAM0132"
                     /db_xref="EnsemblGenomes-Tr:CAR53988"
                     /db_xref="GOA:B4EH32"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR025110"
                     /db_xref="InterPro:IPR042099"
                     /db_xref="UniProtKB/TrEMBL:B4EH32"
                     /protein_id="CAR53988.1"
                     /translation="MNSSYPYPQDEPASSAHAYPLLIKQLLHAPLATRPEQEIVYGDR
                     VRHDYWTFRHRIGQLASGLASIGVGAGDVVAVLDWDSHRYLECYHAIPMMGAVLMTAN
                     VRLSPDQLLYTLNHSGARIVLVHRDFLPLLAGMRDRLDTVRHVVLIADGDEAVLPDGF
                     TDEYEALVAAGSPDFAFPDFDEQTRATTFYTTGTTGLPKAVAFTHRQLVLHTLAGMAA
                     LSSARDRGRVHRDDVYMPITPMFHVHAWGMPYIATALGLKQVYPGRYSPDGLVALIAR
                     EAVTFSHCVPTLLAMILDSPASAAVDLSAWKVIVGGSPLSDGLARAALARGIEVYTGY
                     GMSETCPLMTIAQIDPPRAAGGASADDDIARRTKAGLPLPLVDLRIVDAQFRDVPHDG
                     RSAGEVVVRMPWATQGYLGDAPASAALWAGGYLHTNDIGVIDPDGRLQITDRIKDVIK
                     TGGEWVSSLELESILSRHPAVRESAVIGVKNARWGERPLALVVLTDEQAGRVEPEELK
                     AHVKQVADRGLISRYAVPERLLIVDAIEKTSVGKINKRALRERYQPD"
     misc_feature    149479..150765
                     /locus_tag="BCAM0132"
                     /note="HMMPfam hit to PF00501, AMP-binding enzyme, score
                     3.9e-86"
                     /inference="protein motif:HMMPfam:PF00501"
     CDS             151296..154061
                     /transl_table=11
                     /locus_tag="BCAM0133"
                     /product="LuxR superfamily regulatory protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0133"
                     /db_xref="EnsemblGenomes-Tr:CAR53989"
                     /db_xref="GOA:B4EH33"
                     /db_xref="InterPro:IPR000792"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR016032"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="InterPro:IPR041617"
                     /db_xref="UniProtKB/TrEMBL:B4EH33"
                     /protein_id="CAR53989.1"
                     /translation="MAPMDSRQPARPPDPDAIEVLVRTKLAPASARGIVARIARLGRL
                     RRGLDRRLTLVCAPAGYGKTTLLAEWRHALVASDVKVAWVSLDQDDDNASIFASYVVA
                     AIVDATGGVGARAQQLLRDRALIPLKTVFDELLNELDSAGVDLFLMLDDFDRLASPVI
                     HDAMFDLLRYAPSNLHVVLACRSVPALPLSYFESRDELVRVDEHDLRFDDTETRAFFE
                     RVAGKPLNADNVARLRAATEGWVSGLQLAALALHDDSDAARVAEQVSHARAGIAAYLN
                     DNVMTQVPDAIRHFLLHTAVLDRMTPALCDALTGRDDALDCLEWLNAHNLFIRSIDGD
                     RRRYRYHALFLQYLREELALREPGAVATLHRRASAWYAAERQWPDAVRHALAAGDFDA
                     AAGWVEACAMKLIASSDVRTVLDWVSRLPAQALAGRLRLRIAHTWALALSMQMVEARR
                     ALEALEADIATGRLDTDAVTATELLAVRSLIAGLSDHSIESLQLGERVLAAAPPAGSW
                     VEQIGQTTLIFGLGYAGRLGDVRDLGARAEHAASGHEPLYANVYRQNMSGLAEFVAGR
                     LHDASKTFETALHAAERSAGRLSAATALSAGYLSAIYYEWNDWAKVRDAQADRFDIAM
                     QACSLGPLLRFMQTAALLQFQSGNDARAHDMLDEADRVACSRQWLRLRVACMATGIRL
                     HLAAGKPTQAHRVGRALASLVSPVPPDEASSHVETWQMAQSAQARLLLADARASEAAQ
                     RMATVHAVLAARGFDWFAAQAAVLLAIALDQAGDESAALAALARALEYGQGNGLVRTF
                     VDEGAAAERLLARVHRRADRFPAVGAWYLRDLARAFDGQRQSNATPATRQGGPGNLSA
                     REVEILDYVARGLSNKEIARALRVAPETIKWHLKNVFEKLNVTSRIQAVRSGLALDPS
                     RVRRDDE"
     misc_feature    151464..151487
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
                     /inference="protein motif:Prosite:PS00017"
     misc_feature    151806..151838
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     misc_feature    153846..154019
                     /locus_tag="BCAM0133"
                     /note="HMMPfam hit to PF00196, Bacterial regulatory
                     proteins, luxR family, score 6.8e-20"
                     /inference="protein motif:HMMPfam:PF00196"
     misc_feature    153897..153980
                     /note="PS00622 Bacterial regulatory proteins, luxR family
                     signature."
                     /inference="protein motif:Prosite:PS00622"
     misc_feature    153900..153965
                     /note="Predicted helix-turn-helix motif with score
                     1736.000, SD 5.10 at aa 869-890, sequence
                     LSNKEIARALRVAPETIKWHLK"
                     /inference="protein motif:helixturnhelix:EMBOSS"
     CDS             complement(154087..154959)
                     /transl_table=11
                     /locus_tag="BCAM0134"
                     /product="LysR family regulatory protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0134"
                     /db_xref="EnsemblGenomes-Tr:CAR53990"
                     /db_xref="GOA:B4EH34"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="InterPro:IPR036390"
                     /db_xref="UniProtKB/TrEMBL:B4EH34"
                     /protein_id="CAR53990.1"
                     /translation="MNWDDARVFLAIHRERTLRRAAQTLGVDQATVGRRLATLEHMLG
                     ATLFLRSSKGYLPTPVGELALRAAEAMEQHAHELVRLTHGVDRRLAGEVKITTTDALA
                     IEFVMPSIARLHAKHPDVSVALNTSTHILNLAKREADIAIRTVRPENPDLVARRLACW
                     DMGLFASPDYLRRHGEPERGRAFAGHDLVVYQPYIDASRKPTLAGEPIDGGRIVTRTN
                     SNLMMRAALRAGLGVGEIPVHMGERDGLTRIWPDRMRQSPYEVWLVTHRDLRHTARIR
                     AAIDEIVAAFAAHR"
     misc_feature    complement(154099..154704)
                     /locus_tag="BCAM0134"
                     /note="HMMPfam hit to PF03466, LysR substrate binding
                     domain, score 2.4e-38"
                     /inference="protein motif:HMMPfam:PF03466"
     misc_feature    complement(154774..154953)
                     /locus_tag="BCAM0134"
                     /note="HMMPfam hit to PF00126, Bacterial regulatory
                     helix-turn-helix, score 1.2e-18"
                     /inference="protein motif:HMMPfam:PF00126"
     misc_feature    complement(154849..154914)
                     /note="Predicted helix-turn-helix motif with score
                     1474.000, SD 4.21 at aa 16-37, sequence
                     RTLRRAAQTLGVDQATVGRRLA"
                     /inference="protein motif:helixturnhelix:EMBOSS"
     CDS             155154..156191
                     /transl_table=11
                     /locus_tag="BCAM0135"
                     /product="putative quinone oxidoreductase"
                     /db_xref="EnsemblGenomes-Gn:BCAM0135"
                     /db_xref="EnsemblGenomes-Tr:CAR53991"
                     /db_xref="GOA:B4EH35"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR014189"
                     /db_xref="InterPro:IPR020843"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="UniProtKB/TrEMBL:B4EH35"
                     /protein_id="CAR53991.1"
                     /translation="MTAIEIVRPGGPDVLVPATRAVPVPGPDDVLIRIHAAGVNGPDV
                     FQRKGLYDPPPGASDIPGLEIAGEVVAVGRDVTRFAVGDRVCALIPGGGYAEYAVANE
                     SNTLAIPDGLGMAEAAALPETFMTVWLNLFQRGRLSPGESVLIHGGASGIGTTATMLA
                     KAFGASTIITTVGSEAQRDASMRLGADLAIDYRSEDFVEAVARFTGGKGVDVIVDIIA
                     GDYVARNFAAAAMNGRIVQIGVINGPAKELDLFPMLTKRLTHIGSTLRSRTYAEKAQI
                     IRELEEAVWPLIRQGTVKPRVYRLFDLRDARAAHELMDSGRHIGKIVLATRAAEGLLR
                     AAVDANAKHST"
     misc_feature    155232..155477
                     /locus_tag="BCAM0135"
                     /note="HMMPfam hit to PF08240, Alcohol dehydrogenase
                     GroES-like domain, score 1.2e-23"
                     /inference="protein motif:HMMPfam:PF08240"
     misc_feature    155568..155999
                     /locus_tag="BCAM0135"
                     /note="HMMPfam hit to PF00107, Zinc-binding dehydrogenase,
                     score 2e-39"
                     /inference="protein motif:HMMPfam:PF00107"
     CDS             156329..157312
                     /transl_table=11
                     /locus_tag="BCAM0136"
                     /product="LysR family regulatory protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0136"
                     /db_xref="EnsemblGenomes-Tr:CAR53992"
                     /db_xref="GOA:B4EH36"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="InterPro:IPR036390"
                     /db_xref="UniProtKB/TrEMBL:B4EH36"
                     /protein_id="CAR53992.1"
                     /translation="MDMLENMRTFVRVVQAGSFSAVAKQTDVATAQVSRAVASLEAYA
                     QIRLLNRTTRKIALTDSGRRYFERLQSILGDVDQANAEARNALVRPYGRLRVHTMPGL
                     GQSHVTASAVAYRARFPDVAIEMTYSQRMPNLVEEGYDVSVVTAASLPDSACIAHSCG
                     TSFSVLVASPAYLARHGAPAVPADLARHTCLRLDTPAEANGEWLLHGAGGQAVSHAVA
                     AAPFHANAPEAMSIALRAGLGIGSLAIYSAIDDLRSGRLVRVLPDYRLTMLDVYAMYA
                     SRRFLDAKVRTFVDHLRATLSPALKADARALDALAAPHGRDHARALSGVTA"
     misc_feature    156338..156517
                     /locus_tag="BCAM0136"
                     /note="HMMPfam hit to PF00126, Bacterial regulatory
                     helix-turn-helix, score 4.3e-14"
                     /inference="protein motif:HMMPfam:PF00126"
     misc_feature    156377..156442
                     /note="Predicted helix-turn-helix motif with score
                     1361.000, SD 3.82 at aa 17-38, sequence
                     GSFSAVAKQTDVATAQVSRAVA"
                     /inference="protein motif:helixturnhelix:EMBOSS"
     misc_feature    156587..157219
                     /locus_tag="BCAM0136"
                     /note="HMMPfam hit to PF03466, LysR substrate binding
                     domain, score 1e-33"
                     /inference="protein motif:HMMPfam:PF03466"
     CDS             157361..157738
                     /transl_table=11
                     /locus_tag="BCAM0137"
                     /product="putative phospholipid-binding exported protein"
                     /note="Similar to the N-terminal region Escherichia coli,
                     and Escherichia coli O6 osmotically inducible protein Y
                     precursor osmY SWALL:OSMY_ECOLI (SWALL:P27291) (201 aa)
                     fasta scores: E(): 0.71, 28.57% id in 119 aa, and to the
                     full length Xanthomonas campestris hypothetical protein
                     XCC3437 SWALL:Q8P5A4 (EMBL:AE012463) (120 aa) fasta
                     scores: E(): 5.5, 30.68% id in 88 aa"
                     /db_xref="EnsemblGenomes-Gn:BCAM0137"
                     /db_xref="EnsemblGenomes-Tr:CAR53993"
                     /db_xref="InterPro:IPR007055"
                     /db_xref="UniProtKB/TrEMBL:B4EH37"
                     /protein_id="CAR53993.1"
                     /translation="MKSRFAIVVAGFVALSPLAAHAQSAPSAAPAEQAASATASPRAA
                     KKAERAADRAFAKKVRRAIVRAPGVGNAQVTVFAKAKTGDVTLAGQIADESQDRAAVD
                     AARQVPGVTSVKSKLQLRLEGGQ"
     sig_peptide     157361..157426
                     /locus_tag="BCAM0137"
                     /note="Signal peptide predicted for BCAM0137 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.994 between residues 22 and 23"
                     /inference="protein motif:SignalP:2.0"
     CDS             158225..158899
                     /transl_table=11
                     /locus_tag="BCAM0138"
                     /product="phosphoglycerate mutase family protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0138"
                     /db_xref="EnsemblGenomes-Tr:CAR53994"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:B4EH38"
                     /protein_id="CAR53994.1"
                     /translation="MAELFLVRHGQASFGTDDYDRLSAAGDQQGVWLGEYFARQGLTF
                     DRVICGTMNRHAQTVAAILRGMDREGVAVDRHPGLNEYDFHGLFAAAASDYPEIARLA
                     AGSMKEHFRALRQVLQLWTEDKLGDAAPETWAHFQQRVADARAAIRHGGGQRVLAVSS
                     GGPIAVTVQQVLAAPPSSAIALNLQIRNSSLSQFFFNAEAFHLASFNGIPHLEDPERH
                     ALRTYG"
     misc_feature    158231..158725
                     /locus_tag="BCAM0138"
                     /note="HMMPfam hit to PF00300, Phosphoglycerate mutase
                     family, score 2.9e-15"
                     /inference="protein motif:HMMPfam:PF00300"
     CDS             158919..159950
                     /transl_table=11
                     /locus_tag="BCAM0139"
                     /product="putative phosphotransferase family protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0139"
                     /db_xref="EnsemblGenomes-Tr:CAR53995"
                     /db_xref="GOA:B4EH39"
                     /db_xref="InterPro:IPR002575"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR041726"
                     /db_xref="UniProtKB/TrEMBL:B4EH39"
                     /protein_id="CAR53995.1"
                     /translation="MTNPSQQLDVARLTRYLETHVPGFEGPVDTEKFAGGQSNPTFLL
                     NAKSGRYVLRRQPPGELLKSAHAVDREFRVLTALSGTAVPVAHPYHLCEDRDVIGSLF
                     YVMSFEDGRIFWDPALPELPKAERATCYDALLQTMAALHDVDVDAVGLADYGRPGNYF
                     ERQIGVWTKQYRAAETGRLDAMETLIDWLPKACPEDTGRPALVHGDFRIDNLMFARDG
                     YRVQAVLDWELSTLGNPLADLAYFCMCLRLPSGGQVRGLAGQDRAALGIPDEAAIVAR
                     YCELRGIAPIRDWHFYLAFSFFRLAAIAQGVKARALQGNASSEQALRVGEMAGRLAEL
                     AVGVIDAHR"
     misc_feature    159003..159740
                     /locus_tag="BCAM0139"
                     /note="HMMPfam hit to PF01636, Phosphotransferase enzyme
                     family, score 1.3e-51"
                     /inference="protein motif:HMMPfam:PF01636"
     misc_feature    159522..159560
                     /note="PS00109 Tyrosine protein kinases specific
                     active-site signature."
                     /inference="protein motif:Prosite:PS00109"
     CDS             159982..160764
                     /transl_table=11
                     /locus_tag="BCAM0140"
                     /product="putative short-chain dehydrogenase"
                     /db_xref="EnsemblGenomes-Gn:BCAM0140"
                     /db_xref="EnsemblGenomes-Tr:CAR53996"
                     /db_xref="GOA:B4EH40"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="UniProtKB/TrEMBL:B4EH40"
                     /protein_id="CAR53996.1"
                     /translation="MEEHSNMATNLFDLTGKIALVTGASRGIGEEIAKLLAEQGAHVI
                     VSSRKIDDCQAVADAIVAAGGRAEALACHVGRLEDIAATFEHIRGKHGRLDILVNNAA
                     ANPYFGHILDTDLAAYEKTVDVNIRGYFFMSVEAGKLMKTHGGGAIVNTASVNALQPG
                     DRQGIYSITKAAVVNMTKAFAKECGPLGIRVNALLPGLTKTKFAGALFADKDIYETWM
                     TKIPLRRHAEPREMAGTVLYLVSDAASYTNGECIVVDGGLTI"
     misc_feature    160030..160536
                     /locus_tag="BCAM0140"
                     /note="HMMPfam hit to PF00106, short chain dehydrogenase,
                     score 3.6e-28"
                     /inference="protein motif:HMMPfam:PF00106"
     misc_feature    160438..160524
                     /note="PS00061 Short-chain dehydrogenases/reductases
                     family signature."
                     /inference="protein motif:Prosite:PS00061"
     CDS             160772..161530
                     /transl_table=11
                     /locus_tag="BCAM0141"
                     /product="putative short-chain dehydrogenase"
                     /db_xref="EnsemblGenomes-Gn:BCAM0141"
                     /db_xref="EnsemblGenomes-Tr:CAR53997"
                     /db_xref="GOA:B4EH41"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="UniProtKB/TrEMBL:B4EH41"
                     /protein_id="CAR53997.1"
                     /translation="MKLDSYAGQAVMITGAASGFGALLARELAAMGARLALGDLNGDA
                     LERVAAPLRAGGADVLAQRCDVRIETDVASLVQEAVARFGRLDVGINNAGIAPPMKAL
                     IDTDEADLDLSFAVNAKGVFFGMKHQIRQMLVQREGVILNVASMAGLGGAPKLAAYAA
                     SKHAVVGLTKTAALEYARHGIRVNAVCPFYSATPMVTDSEIGERQEFLAQGSPMKRLG
                     RPDEIVATMLTLCAKENTYLTGQAVAVDGGVSAF"
     misc_feature    160796..161302
                     /locus_tag="BCAM0141"
                     /note="HMMPfam hit to PF00106, short chain dehydrogenase,
                     score 1.9e-26"
                     /inference="protein motif:HMMPfam:PF00106"
     misc_feature    161204..161290
                     /note="PS00061 Short-chain dehydrogenases/reductases
                     family signature."
                     /inference="protein motif:Prosite:PS00061"
     CDS             161570..162814
                     /transl_table=11
                     /locus_tag="BCAM0142"
                     /product="putative acyl-CoA dehydrogenase family protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0142"
                     /db_xref="EnsemblGenomes-Tr:CAR53998"
                     /db_xref="GOA:B4EH42"
                     /db_xref="InterPro:IPR006091"
                     /db_xref="InterPro:IPR009075"
                     /db_xref="InterPro:IPR009100"
                     /db_xref="InterPro:IPR013786"
                     /db_xref="InterPro:IPR036250"
                     /db_xref="InterPro:IPR037069"
                     /db_xref="UniProtKB/TrEMBL:B4EH42"
                     /protein_id="CAR53998.1"
                     /translation="MDFGYTPKVEALRERVSAFMDAHIVPRIRQWNDEVHAGQYPVSF
                     MEELKERAKAEGLWNLFLPHLKDDEPGMGLTNLEYAPLAEIMGRVSWASEVFNCNAPD
                     TGNMELLHMFATPEQREQWLLPLLRGEIRSAFAMTEPDVASSDATNITTRIERIGDEY
                     VINGRKWFITNAAHPNCKIFIVMGKTDPDAESHQQQSMILVPRDTPGVTVVRNITVVN
                     HHAPEGHCEITFDNVRVPARNLLGEEGSGFALAQARLGPGRIHHCMRSIGAAELALEL
                     MVDRAQSRVAFGKPLNRHGTVGEWIARSRIEIDQARLLVLKAAWMIDKVGAKAARKEI
                     SMIKALVPTVYTDVCDRAMQVFGAAGLSPDTPLADLWTWGRALRFADGPDEVHLQAIA
                     RMEIKDGEPGATAPYLTPPPRD"
     misc_feature    161966..162130
                     /locus_tag="BCAM0142"
                     /note="HMMPfam hit to PF02770, Acyl-CoA dehydrogenase,
                     middle domain, score 3.1e-23"
                     /inference="protein motif:HMMPfam:PF02770"
     misc_feature    162302..162757
                     /locus_tag="BCAM0142"
                     /note="HMMPfam hit to PF00441, Acyl-CoA dehydrogenase,
                     C-terminal doma, score 1.2e-43"
                     /inference="protein motif:HMMPfam:PF00441"
     misc_feature    162347..162715
                     /locus_tag="BCAM0142"
                     /note="HMMPfam hit to PF08028, Acyl-CoA dehydrogenase,
                     C-terminal doma, score 9.2e-07"
                     /inference="protein motif:HMMPfam:PF08028"
     CDS             162891..163796
                     /transl_table=11
                     /locus_tag="BCAM0143"
                     /product="LysR family regulatory protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0143"
                     /db_xref="EnsemblGenomes-Tr:CAR53999"
                     /db_xref="GOA:B4EH43"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="InterPro:IPR036390"
                     /db_xref="InterPro:IPR037402"
                     /db_xref="UniProtKB/TrEMBL:B4EH43"
                     /protein_id="CAR53999.1"
                     /translation="MRLSKIDLNLFVVFEAIYNKRNLTRAAEVLNLTQPAVSNALARL
                     RKTLNDPLFVSTPAGMMPTPMAENIVGRVREALQLLDSSAHEGDVFDPASSERVFRLS
                     MSDLTEALLLPALGELLQTHAPGMHVRSYTMDRREVATALANGSVDIAIDAPLIGDPH
                     LHQALLVQDRYACMIRDDHPFNGDTLTMDDYLSMGHIHVSSRRKGSGHVDAELTRLGL
                     RRNIQMRVQHYMVAPLIAMRSDLALTAPLRLLQRYPARILELPFEMPGLDYFCYWHRS
                     ADQDQGSQWLREQLMTLMGGIGEVR"
     misc_feature    162912..163091
                     /locus_tag="BCAM0143"
                     /note="HMMPfam hit to PF00126, Bacterial regulatory
                     helix-turn-helix, score 2.1e-19"
                     /inference="protein motif:HMMPfam:PF00126"
     misc_feature    162951..163016
                     /note="Predicted helix-turn-helix motif with score
                     1798.000, SD 5.31 at aa 21-42, sequence
                     RNLTRAAEVLNLTQPAVSNALA"
                     /inference="protein motif:helixturnhelix:EMBOSS"
     misc_feature    162954..163046
                     /note="PS00044 Bacterial regulatory proteins, lysR family
                     signature."
                     /inference="protein motif:Prosite:PS00044"
     misc_feature    163164..163775
                     /locus_tag="BCAM0143"
                     /note="HMMPfam hit to PF03466, LysR substrate binding
                     domain, score 1.9e-18"
                     /inference="protein motif:HMMPfam:PF03466"
     CDS             complement(163813..164940)
                     /transl_table=11
                     /locus_tag="BCAM0144"
                     /product="DnaJ domain protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0144"
                     /db_xref="EnsemblGenomes-Tr:CAR54000"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR036869"
                     /db_xref="UniProtKB/TrEMBL:B4EH44"
                     /protein_id="CAR54000.1"
                     /translation="MTARRGAAVAIAPGHETASLSKAQQTFNTLVKQIETRRERLGAW
                     EAVMPAFQKKFVDALLPLEQEATALRIRLIHLLDDAFLQKGLSKAEQRTLSDLIVDMA
                     RDLLDVSDDATLKIIYDRHAGPAHTGHAAGAPEPAKPGREQEPEPQPPEDLDTLSPDE
                     LAARMQAELDAQFERDMAAHAAREAQRAKRKKAPKQSAAQARIEAEQAESSKSIREIY
                     RKLASALHPDREPDPQEQQRKTVLMQRVNRAYEKGNLLQLLELQLEIEQIDRRAIDGL
                     GEARLTRYNGILEEQLRELDQEIVHVEHDFRRTYGIAPSTKVAPDTVLRMLARDIAGM
                     QRSNQDLTVTLREFEDPDQVRNWLKDMKRRPASSRFDDESY"
     misc_feature    complement(164155..164313)
                     /locus_tag="BCAM0144"
                     /note="HMMPfam hit to PF00226, DnaJ domain, score 0.0049"
                     /inference="protein motif:HMMPfam:PF00226"
     CDS             complement(165048..165374)
                     /transl_table=11
                     /locus_tag="BCAM0145"
                     /product="putative exported protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0145"
                     /db_xref="EnsemblGenomes-Tr:CAR54001"
                     /db_xref="InterPro:IPR025421"
                     /db_xref="UniProtKB/TrEMBL:B4EH45"
                     /protein_id="CAR54001.1"
                     /translation="MKSLIVTIAAVTTTATALLAAPTLSYAQSSSHSTLTRAQVRQEL
                     LDLESVGYNPSIGDGDSYPDDIVAAQERLAAKRLAEHKNAEAGYGPNGAPGSDSGAPA
                     AAAVAH"
     sig_peptide     complement(165294..165374)
                     /locus_tag="BCAM0145"
                     /note="Signal peptide predicted for BCAM0145 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.720 between residues 27 and 28"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    complement(165294..165362)
                     /locus_tag="BCAM0145"
                     /note="1 probable transmembrane helix predicted for
                     BCAM0145 by TMHMM2.0 at aa 5-27"
                     /inference="protein motif:TMHMM:2.0"
     CDS             complement(165890..168274)
                     /transl_table=11
                     /gene="polA"
                     /gene_synonym="dinA"
                     /locus_tag="BCAM0146"
                     /product="DNA polymerase II"
                     /db_xref="EnsemblGenomes-Gn:BCAM0146"
                     /db_xref="EnsemblGenomes-Tr:CAR54002"
                     /db_xref="GOA:B4EH46"
                     /db_xref="InterPro:IPR006133"
                     /db_xref="InterPro:IPR006134"
                     /db_xref="InterPro:IPR006172"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR017964"
                     /db_xref="InterPro:IPR023211"
                     /db_xref="InterPro:IPR036397"
                     /db_xref="InterPro:IPR042087"
                     /db_xref="UniProtKB/TrEMBL:B4EH46"
                     /protein_id="CAR54002.1"
                     /translation="MTAFEQGFILTRHWRDTASGIEIEFWLATGHGPRRVRLRPQEAV
                     AFIPAEQQALAERTLAGERDAELRPLALRDFRQRRVVGLYCKRYRHLSGLQKRLAAAG
                     VDVYEADVQPPDRYAMERFITACVEFRGQPGRDGTLTGGELKPATGYRPALRCVSLDI
                     ETSVHGELYSIALEGCGQRQVYMLGPPNGDERDSTGTLDFNLDYCDSRPAMLARLNDW
                     FDEHDPDAVIGWNLVQFDLRILHAHAEQYGVPLKLGRGGSVLDWRTHGQQPDHFFAGA
                     AGRLILDGIDMLKSATWTFPSFSLEYVSQSLLGEGKSIDNPYQRMDEIQRRFDHDKPA
                     LARYNLKDCELVTRIFDKADLLSFALERASVTGLAADRTGGSVAAFTHLYLPRMHRLG
                     YVAPNLGDVTGQNSPGGFVMDSRPGLYDSVLVFDYKSLYPSIIRTFLIDPVGLIEGLA
                     HPADDTSVPGFLGARFSRTAHCLPDIVRRVWEGRDDAKRQRNAPLSQALKIIMNSFYG
                     VLGSTGCRFFDPRLASSITMRGHEIMHRTRKLIEAQGYEVIYGDTDSTFVWLGRAHDD
                     DEAGAKGRALVEHVNRWWQAHLREQFGLDSALELQYERHYRRFLMPTVRGAEEGSKKR
                     YAGLAATADGGEDLVFKGLETVRTDWTPLAQQFQRELYRRVFRREPYQDFIRDYVRRT
                     LAGEFDDQLVYRKRVRRPLREYERNVPPHVRAARIADEFNHAQGRPLQYQRGGWISYV
                     MTTAGPEPLETMRSPIDYAFYLSRQLQPVADAILPFLRDDFERVISGQGQLFGD"
     misc_feature    complement(165899..167152)
                     /gene="polA"
                     /locus_tag="BCAM0146"
                     /note="HMMPfam hit to PF00136, DNA polymerase family B,
                     score 1.3e-27"
                     /inference="protein motif:HMMPfam:PF00136"
     misc_feature    complement(166601..166627)
                     /note="PS00116 DNA polymerase family B signature."
                     /inference="protein motif:Prosite:PS00116"
     misc_feature    complement(166730..166762)
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     misc_feature    complement(167366..168196)
                     /gene="polA"
                     /locus_tag="BCAM0146"
                     /note="HMMPfam hit to PF03104, DNA polymerase family B,
                     exonuclease do, score 5.9e-16"
                     /inference="protein motif:HMMPfam:PF03104"
     CDS             complement(168376..169134)
                     /transl_table=11
                     /locus_tag="BCAM0147"
                     /product="hypothetical protein"
                     /note="No significant database matches"
                     /db_xref="EnsemblGenomes-Gn:BCAM0147"
                     /db_xref="EnsemblGenomes-Tr:CAR54003"
                     /db_xref="GOA:B4EH47"
                     /db_xref="InterPro:IPR036041"
                     /db_xref="UniProtKB/TrEMBL:B4EH47"
                     /protein_id="CAR54003.1"
                     /translation="MNFILRVGRTWDTQIDAIRDAVTEHTNLIRYDNTYYRICSNAAP
                     PSFTISLLPSTGGTPLVLNMRTRDLYVELIGGHPFENYSHNLDRMPFDAIATSGSDAV
                     RGFSLDSAIRGLLRTPDGDKRMLTPDDRFLAQSLVVFCVAESLRFDKIATELGQYFRS
                     SYDPNHPEITSFLKGATPIRYLQSWLKMAKNWEKTTRDVFDGIPDKMREIVVQPRDRL
                     SPADRQASARVDTTAFGEVTQKIAPGMRVLMRPS"
     misc_feature    complement(168964..168981)
                     /note="PS00343 Gram-positive cocci surface proteins
                     'anchoring' hexapeptide."
                     /inference="protein motif:Prosite:PS00343"
     CDS             169626..172472
                     /transl_table=11
                     /locus_tag="BCAM0148"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0148"
                     /db_xref="EnsemblGenomes-Tr:CAR54004"
                     /db_xref="InterPro:IPR006533"
                     /db_xref="InterPro:IPR017847"
                     /db_xref="InterPro:IPR018769"
                     /db_xref="InterPro:IPR028244"
                     /db_xref="InterPro:IPR037026"
                     /db_xref="UniProtKB/TrEMBL:B4EH48"
                     /protein_id="CAR54004.1"
                     /translation="MDAHSMIGALTGGLIQQERLLKLDTPLGSNVLIPHRVFGQSRIG
                     RDYLFMVDCVSTSNDVQLKALISQPITLWIQQTDKSYLPHHGYIHTARKLGVDGGLAC
                     YQLSFSSWLHFLKFRRDQRHWQDKTVDAIIADVFDAHPQARGMYRFELSQPLPSRSYC
                     RQDETDWNFVHRLLESEGLYGVWRQAQDGKSHTLVMTDRLQTLEPLAPATVEFSRAGV
                     HGEVDALTQWAGTRTLQSVLLSTRTFDYKNPSTPANPKATSVPTMANQGDLPSQAEVY
                     EYTGGYTYPEQERGDHLGKIRMEEWESRAKRYDGVGGVRRIDAGRRFTLTGHPEHDQD
                     AADHREFAVIEVEWIIVNNVPLSGHEANYPHSLYSAVKQADADDPDKLFTVSHDDGST
                     GFYRVAIEAQRTSVPYRSPLEHRKPEAKLESAIVAGPKGQQAYTDSLNRIKVLFIWDR
                     HNEGDERASCWVRVAQSDTGDGYGGVHMPRAGEELLIGHIGNDIDRPIALHRVYNGAA
                     KPRWHSNALLSGYRSQEFSGSGYNQMVMDDSTGQNRVHLYSSSTNAALHLGYLIDQND
                     NARGGYLGKGFDLSSEAYGALRAGRGLFVTTHPVASQPLDASLATRQLNGSANILDGL
                     SQASETSKAESLKDGHDTFKAFADATQHSESGATGGGGVTAGGGTGDASAFKQPVILM
                     AAPAGIGLSTQKSTHVAADQHVNIVSGQSTHVATGKSLVASITEKLSLFVQNAGMKLF
                     AAKGKIEVQTHADNVEVTAQKSLLLASVTEKVQASAQQEILLTSGGAYIRLKGGDIEI
                     HAPGKIDIKGAQHAFSGPARMDVTHPAFKDLPTRRLMLNTMASPSATRVVPVGMPYKL
                     YADGALVKQGVFDKTGQLPIDHQVTTQKYTLEMANGVKHEIPVPGEYRDAENGKLANQ
                     GFQYHEGAPDDGAAPDRATHRQIYNELLSPSSEA"
     misc_feature    170886..171122
                     /locus_tag="BCAM0148"
                     /note="HMMPfam hit to PF04524, Protein of unknown
                     function, DUF586, score 2.7e-27"
                     /inference="protein motif:HMMPfam:PF04524"
     CDS             172476..174527
                     /transl_table=11
                     /locus_tag="BCAM0149"
                     /product="putative phospholipase D protein"
                     /note="Similar to Ralstonia solanacearum probable
                     phospholipase protein rs03737 SWALL:Q8XS51 (EMBL:AL646079)
                     (652 aa) fasta scores: E(): 3.5e-85, 50.36% id in 691 aa.
                     C-terminus is weakly similar to the C-terminal region of
                     Arabidopsis thaliana phospholipase D beta 1 PLDbeta1
                     SWALL:PDB1_ARATH (SWALL:P93733) (967 aa) fasta scores:
                     E(): 0.06, 24.01% id in 483 aa"
                     /db_xref="EnsemblGenomes-Gn:BCAM0149"
                     /db_xref="EnsemblGenomes-Tr:CAR54005"
                     /db_xref="GOA:B4EH49"
                     /db_xref="InterPro:IPR001736"
                     /db_xref="InterPro:IPR015679"
                     /db_xref="InterPro:IPR025202"
                     /db_xref="UniProtKB/TrEMBL:B4EH49"
                     /protein_id="CAR54005.1"
                     /translation="MANINKSITTPIAQNHTSSAMACLPWFVCNSEYSPSAAGFRPLV
                     NGRDAFAAVYKAIADAKHSIDIICWGFQPSMYFLRDGTGKRIGELLEQKGKEGVKVRL
                     LCWRDPFYMAELSENNMPGNDFITPLKRALPKWVYDHVSMLGRDYQTDEERVFDINWY
                     QRANLNNVTNPVSHSVTDRIIEDTVNLPLNVVAALSKPFTSGSNPVLHKIAGFPNIEL
                     ATRGFDLSVRSEIVGRISGYGTMDGWSGGTKATTSAAMGGEPSHHQKMVLVDYDDSDL
                     ATGFVMGHNMLDQYWDTDKHSYQAMAPSKGRNGPYPWQDISSRVTGPILQYLNKNFCE
                     AWDDATGQKLAKSREHLAGIHKIRNDAPDDVSVMAQIVRTQSEKNKREIQVMYLNAVN
                     NATQCIFIQNQYFRWNDLALKIKDVAKAHAKAGRDFGRDGSIYLFVITNSSDDAVGNG
                     TVRTYQMLESLGCGNSMPGVAQLQRSDDYAAQQKDLEAQLAAQQSIQHKFAAQGVDIN
                     AASLQGAMNFYQDNMAKQQELQQALNELKRKKQLNAHIDPDAPPLDIEGLKVQVCTLV
                     APDSPGGNWLPVYVHAKLMTIDDAFMTIGSANVNLRSMNVDSELNICHENSVVTKSLR
                     QRLWSMHAGDKGAQEDFFKSFMAWHDIVEQNKVNKTKNLPPEKSLVKFVRTSAKRTYA
                     D"
     misc_feature    172512..172544
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     misc_feature    172521..172553
                     /note="PS00133 Zinc carboxypeptidases, zinc-binding region
                     2 signature."
                     /inference="protein motif:Prosite:PS00133"
     misc_feature    173247..173345
                     /locus_tag="BCAM0149"
                     /note="HMMPfam hit to PF00614, Phospholipase D Active site
                     motif, score 0.5"
                     /inference="protein motif:HMMPfam:PF00614"
     misc_feature    174201..174284
                     /locus_tag="BCAM0149"
                     /note="HMMPfam hit to PF00614, Phospholipase D Active site
                     motif, score 0.0036"
                     /inference="protein motif:HMMPfam:PF00614"
     CDS             174531..175838
                     /transl_table=11
                     /locus_tag="BCAM0150"
                     /product="putative lipoprotein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0150"
                     /db_xref="EnsemblGenomes-Tr:CAR54006"
                     /db_xref="InterPro:IPR006597"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:B4EH50"
                     /protein_id="CAR54006.1"
                     /translation="MNRHILIVFLSVSLCACTEKESKVSQLPDLSAVRANLEFVCAHE
                     SDHLPSLDPNADILFKYARYLQKNSGPKDYDDILRYYRIAAAYDHYKANTNAQLLISQ
                     GLASSPDAEKESVDLASRLVDKGIPSGYYDIGHYLEGGYGLKKNPEMSLRYFRKAADL
                     GSPEAQYYVADLLAPMDKAPEVAKQMRECATAQGFGKAASALGIDLKTDKHYAEAVKA
                     FQKGVESGDVQSASFLENGFEAPPESDRLYYLALSKDPERTRRYDLIARFLDHNDGRN
                     PKVPDIDKIVPLPPAKLPPWDGTFQWQKEQDAATPPQKPSDEFINEMAKAKHLDPATG
                     LPLPGSADKTSQAEQPENVASRLPLGTVAHTGQTCPEDGVWCAKLGAGQFGDTQRRFL
                     KGDALPSVVVHEPRKLAVLDSMMGTRRHVEQVAWELVAYLDQA"
     sig_peptide     174531..174578
                     /locus_tag="BCAM0150"
                     /note="Signal peptide predicted for BCAM0150 by SignalP
                     2.0 HMM (Signal peptide probability 0.777) with cleavage
                     site probability 0.450 between residues 16 and 17"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    174549..174581
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     misc_feature    174909..175016
                     /locus_tag="BCAM0150"
                     /note="HMMPfam hit to PF08238, Sel1 repeat, score 1.1e-06"
                     /inference="protein motif:HMMPfam:PF08238"
     CDS             175913..176050
                     /pseudo
                     /transl_table=11
                     /locus_tag="BCAM0150A"
                     /product="putative lipoprotein (fragment)"
                     /note="Probable gene remnant. Similar to the N-terminal
                     region of Neisseria meningitidis hypothetical protein
                     NMB1470 SWALL:Q9JYR0 (EMBL:AE002496) (181 aa) fasta
                     scores: E(): 3.7, 46.51% id in 43 aa"
     sig_peptide     175913..175978
                     /locus_tag="BCAM0150A"
                     /note="Signal peptide predicted for BCAM0150A by SignalP
                     2.0 HMM (Signal peptide probability 0.998) with cleavage
                     site probability 0.501 between residues 22 and 23"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    175931..175963
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     CDS             176050..176448
                     /pseudo
                     /transl_table=11
                     /locus_tag="BCAM0151"
                     /product="conserved hypothetical protein (fragment)"
                     /note="Probable gene remnant. Similar to the C-terminal
                     region of Ralstonia solanacearum probable phospholipase
                     protein rs03737 SWALL:Q8XS51 (EMBL:AL646079) (652 aa)
                     fasta scores: E(): 1e-16, 50% id in 120 aa"
                     /db_xref="PSEUDO:CAR54008.1"
     CDS             176452..177762
                     /transl_table=11
                     /locus_tag="BCAM0152"
                     /product="putative lipoprotein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0152"
                     /db_xref="EnsemblGenomes-Tr:CAR54009"
                     /db_xref="InterPro:IPR006597"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:B4EH52"
                     /protein_id="CAR54009.1"
                     /translation="MRKSLVIYTVVLLVCACTNKEDSVDSNLPDMSDVRANLALTCVH
                     ESEHLPPLDPRADQLFQYGRYLQKIDGPKDFDEIVRYYRIAAAYGHYKANTNAQRLIS
                     QGLANSPDGAKETIALAKKLIDDGVPGGYYDIGHYLEAGYGVKQDAEMALRYFRKAAD
                     MGSPEAQTYVAEQLAPHDRAPEIARQMRQCATNQGYGDAANYLGINFKNDSKYSDAVL
                     SFQKGVKAGSAQAALALEEGFNGPEASNRLSYLALAHDPERSRRYRLIGKFLDSNESR
                     NPKVPDLDKIVPLPPAKLPPWDGTFQWQKEQDAATPPQKPSDEFINEMAKAKHLDPAT
                     GLPLPGSADKTSQAEQPENVASRLPLGTVAHTGQTCPEDGVWCAKLGAGQFGDTQRRF
                     LKGDALPSVVVHEPRKLAVLDSMMGTRQHVEQVAWELVAYLDQA"
     sig_peptide     176452..176511
                     /locus_tag="BCAM0152"
                     /note="Signal peptide predicted for BCAM0152 by SignalP
                     2.0 HMM (Signal peptide probability 0.780) with cleavage
                     site probability 0.336 between residues 20 and 21"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    176470..176502
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     misc_feature    176833..176940
                     /locus_tag="BCAM0152"
                     /note="HMMPfam hit to PF08238, Sel1 repeat, score 4.4e-08"
                     /inference="protein motif:HMMPfam:PF08238"
     CDS             complement(178270..179289)
                     /transl_table=11
                     /gene="kdgT"
                     /locus_tag="BCAM0153"
                     /product="2-keto-3-deoxygluconate permease"
                     /db_xref="EnsemblGenomes-Gn:BCAM0153"
                     /db_xref="EnsemblGenomes-Tr:CAR54010"
                     /db_xref="GOA:B4EH53"
                     /db_xref="InterPro:IPR004684"
                     /db_xref="InterPro:IPR018395"
                     /db_xref="UniProtKB/TrEMBL:B4EH53"
                     /protein_id="CAR54010.1"
                     /translation="MKLKQAIDRIPGGLMLVPMLLGACVHTFAPIAGKYFGSFTNGLI
                     AGTVPILAVWFFCMGATINLRATGVVLRKSGTLLATKIVVAWLATLIAAQFIPDDGIR
                     TGLFAGLSLLAITTSMDMTNGGLYAAVMQQYGSKEEAGAFVLMSIESGPLVSMLILGA
                     AGVAVFETRLFVGAVLPFLIGFTLGNLDEDLRELFGRCVHPLIPFFGFALGNGIDLNV
                     IAKSGLPGIALGLAVIVVTGVPLILADKFVGGGNGTAGLAASSTAGAAVANPAIIGEM
                     IPKFKPMVPAATAIVATACLVTAILVPILTAMWAKRAARVSGVPVRAAARVGNGGAIE
                     HEGHV"
     misc_feature    complement(178348..179289)
                     /gene="kdgT"
                     /locus_tag="BCAM0153"
                     /note="HMMPfam hit to PF03812, 2-keto-3-deoxygluconate
                     permease, score 4.4e-198"
                     /inference="protein motif:HMMPfam:PF03812"
     misc_feature    complement(join(178375..178443,178471..178539,
                     178558..178614,178642..178710,178729..178788,
                     178801..178869,178906..178974,179002..179061,
                     179098..179166,179194..179253))
                     /gene="kdgT"
                     /locus_tag="BCAM0153"
                     /note="10 probable transmembrane helices predicted for
                     BCAM0153 by TMHMM2.0 at aa 13-32, 42-64, 77-96, 106-128,
                     141-163, 168-187, 194-216, 226-244, 251-273 and 283-305"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    complement(178405..178437)
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     misc_feature    complement(178756..178803)
                     /note="PS00225 Crystallins beta and gamma 'Greek key'
                     motif signature."
                     /inference="protein motif:Prosite:PS00225"
     misc_feature    complement(179218..179250)
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     CDS             179571..180407
                     /transl_table=11
                     /gene="kduI"
                     /locus_tag="BCAM0154"
                     /product="4-deoxy-L-threo-5-hexosulose-uronate
                     ketol-isomerase"
                     /EC_number="5.3.1.17"
                     /db_xref="EnsemblGenomes-Gn:BCAM0154"
                     /db_xref="EnsemblGenomes-Tr:CAR54011"
                     /db_xref="GOA:B4EH54"
                     /db_xref="InterPro:IPR007045"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR021120"
                     /db_xref="InterPro:IPR027449"
                     /db_xref="UniProtKB/Swiss-Prot:B4EH54"
                     /protein_id="CAR54011.1"
                     /translation="MDVRQGIHSEHAKALDTAGLRRHFLVENVFAPDALSLTYSHIDR
                     IIVGGAWPATRPVEVPASLGAEMGVSHLLARRELGAINIGGPGWVEVDGQRHAVGTEE
                     AIYIGQGGQGVVFGSDDHARPAKFYLNCAPAHTAYPTRTITLAQASPETLGDAATSNR
                     RTIYKFIVPDVLPTCQLSMGMTKLEPGSLWNTMPCHTHERRMEVYFYFNLAADAAVFH
                     LLGEPGETRHVVVHNEQAVISPSWSIHSGVGTQAYTFIWGMAGENQVFKDMDHIAVAD
                     LR"
     misc_feature    179571..180404
                     /gene="kduI"
                     /locus_tag="BCAM0154"
                     /note="HMMPfam hit to PF04962, 5-keto 4-deoxyuronate
                     isomerase, score 7.2e-176"
                     /inference="protein motif:HMMPfam:PF04962"
     CDS             180412..181218
                     /transl_table=11
                     /gene="kduD"
                     /locus_tag="BCAM0155"
                     /product="2-deoxy-D-gluconate 3-dehydrogenase"
                     /EC_number="1.1.1.125"
                     /note="CDS is extending at the N-terminus in comparison to
                     orthologues"
                     /db_xref="EnsemblGenomes-Gn:BCAM0155"
                     /db_xref="EnsemblGenomes-Tr:CAR54012"
                     /db_xref="GOA:B4EH55"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR011286"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="UniProtKB/TrEMBL:B4EH55"
                     /protein_id="CAR54012.1"
                     /translation="MKRETPELPAAGAHAALARLFDLTGKVAIVTGCNTGLGAAMAVA
                     LASAGCDIVGANRSSPDATSARVAAAGRRFVDVRADLSTLEPVERIVEGAVDAFGHVD
                     ILVNNAGMIRRCDALAFTEADWDAVIDVNLKSVFFLSQAVARQMVRQGRGGKIVNVAS
                     MLSFQGGIRVPSYTASKSGVLGLTRLLANEWAARGINVNAIAPGYMETDNTAQLREDS
                     RRSDEILGRIPAGRWGVPDDLAGAAVFLASRASDYVHGHTLAVDGGWLAR"
     misc_feature    180487..180987
                     /gene="kduD"
                     /locus_tag="BCAM0155"
                     /note="HMMPfam hit to PF00106, short chain dehydrogenase,
                     score 7.5e-29"
                     /inference="protein motif:HMMPfam:PF00106"
     misc_feature    180529..180561
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     misc_feature    180889..180975
                     /note="PS00061 Short-chain dehydrogenases/reductases
                     family signature."
                     /inference="protein motif:Prosite:PS00061"
     CDS             181278..182174
                     /transl_table=11
                     /gene="kdgR"
                     /locus_tag="BCAM0156"
                     /product="transcriptional regulator KdgR"
                     /note="Lack of similarity at the N-terminus in comparison
                     to other proteins"
                     /db_xref="EnsemblGenomes-Gn:BCAM0156"
                     /db_xref="EnsemblGenomes-Tr:CAR54013"
                     /db_xref="GOA:B4EH56"
                     /db_xref="InterPro:IPR005471"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR014757"
                     /db_xref="InterPro:IPR029016"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="InterPro:IPR036390"
                     /db_xref="UniProtKB/TrEMBL:B4EH56"
                     /protein_id="CAR54013.1"
                     /translation="MTATPRQRKRDQANQETGGGQPGADLSAAGSVEKPDSVAAVGKV
                     FTILAALGERREIGISELSHQLGMSKTTVHRFLQTLKTLGYVAQEGETDRYRLTIRLF
                     ELGSKALESVDLVREADLEMRRIGQLTREAVHLGAFDEDAIIYIHKIDADYGLRMQSR
                     IGRRNPLYSTAIGKVLLAWMTPGDARAVLAGIEFRKSTAKTLASADAVMSILPHVRQQ
                     GYGEDNEEQEDGLLCLAVPVFDRFGRVIAGLSLSFPTMRCGADTKAHYVALLKEAGQA
                     ISARLGHHPEAVGVEATTIAQD"
     misc_feature    181404..181565
                     /gene="kdgR"
                     /locus_tag="BCAM0156"
                     /note="HMMPfam hit to PF08279, HTH domain, score 0.0022"
                     /inference="protein motif:HMMPfam:PF08279"
     misc_feature    181446..181511
                     /note="Predicted helix-turn-helix motif with score
                     1838.000, SD 5.45 at aa 57-78, sequence
                     IGISELSHQLGMSKTTVHRFLQ"
                     /inference="protein motif:helixturnhelix:EMBOSS"
     misc_feature    181734..182117
                     /gene="kdgR"
                     /locus_tag="BCAM0156"
                     /note="HMMPfam hit to PF01614, Bacterial transcriptional
                     regulator, score 7e-46"
                     /inference="protein motif:HMMPfam:PF01614"
     misc_feature    181932..181997
                     /note="PS01051 Bacterial regulatory proteins, iclR family
                     signature."
                     /inference="protein motif:Prosite:PS01051"
     CDS             182234..182611
                     /transl_table=11
                     /locus_tag="BCAM0157"
                     /product="putative exported protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0157"
                     /db_xref="EnsemblGenomes-Tr:CAR54014"
                     /db_xref="UniProtKB/TrEMBL:B4EH57"
                     /protein_id="CAR54014.1"
                     /translation="MQMKMTMRMGITMLVLGASLAASGAHATRAVDCGQLDAATSGPD
                     DNFRPPASGTVIGTGRAYFYSAPDAQCMTKRTFIVPGDSVTVYKSHGRWYNIMYVNGK
                     TGDDFEGWVEQGRVRLDGRYGAQ"
     sig_peptide     182234..182314
                     /locus_tag="BCAM0157"
                     /note="Signal peptide predicted for BCAM0157 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.942 between residues 27 and 28"
                     /inference="protein motif:SignalP:2.0"
     CDS             complement(182630..184141)
                     /transl_table=11
                     /locus_tag="BCAM0158"
                     /product="putative diguanylate phosphodiesterase"
                     /db_xref="EnsemblGenomes-Gn:BCAM0158"
                     /db_xref="EnsemblGenomes-Tr:CAR54015"
                     /db_xref="GOA:B4EH58"
                     /db_xref="InterPro:IPR001633"
                     /db_xref="InterPro:IPR024744"
                     /db_xref="InterPro:IPR035919"
                     /db_xref="UniProtKB/TrEMBL:B4EH58"
                     /protein_id="CAR54015.1"
                     /translation="MFFAAVIICVLVPAFAIVLADRYARDAVTAHERVVANDIVASVD
                     RILDGVRLRHADELTALVGRPCATVFRTLAEVGTRLRYLRAVALVNDGRVMCSSALGS
                     IDLPLAAYAREPEPGSMIVTLLRQTPFQHGIPVLSAFRATARGAGVLYLIEGDYVADA
                     LNHGTGDGAETATLSIAGSGRLDQHGKFAPETAAGPAGGSTMASQRWPFTVSVIASAR
                     YASQVQRHYRLICATIVLLADSLVMAAYLLAMAPRRLLLKAVRHALRRNEFHVVYQPI
                     VDVQTRRTVGVEALLRWHHPKWGAISPAAFIPQVESSTVLPKVTEFVLRTAVSELTAL
                     TPSAPLRIAVNVAPQDLERGRFVAVVEEAIRALPPGFTLVLEVTERILLEKNARTTEI
                     FQTLRSKGAKFAIDDFGTHHSNLDMLSRFPFDYVKIDRQFISQLDGGSARLIEGIAAV
                     AHHYGLKIIAEGVETEAQHRALHAVGIQYAQGYLYQRPLRAENLKRDFAWAPV"
     misc_feature    complement(182678..183388)
                     /locus_tag="BCAM0158"
                     /note="HMMPfam hit to PF00563, EAL domain, score 2.5e-84"
                     /inference="protein motif:HMMPfam:PF00563"
     misc_feature    complement(join(183389..183457,184082..184132))
                     /locus_tag="BCAM0158"
                     /note="2 probable transmembrane helices predicted for
                     BCAM0158 by TMHMM2.0 at aa 4-20 and 229-251"
                     /inference="protein motif:TMHMM:2.0"
     sig_peptide     complement(184082..184141)
                     /locus_tag="BCAM0158"
                     /note="Signal peptide predicted for BCAM0158 by SignalP
                     2.0 HMM (Signal peptide probability 0.910) with cleavage
                     site probability 0.612 between residues 20 and 21"
                     /inference="protein motif:SignalP:2.0"
     CDS             184660..184956
                     /transl_table=11
                     /locus_tag="BCAM0159"
                     /product="conserved ypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0159"
                     /db_xref="EnsemblGenomes-Tr:CAR54016"
                     /db_xref="UniProtKB/TrEMBL:B4EH59"
                     /protein_id="CAR54016.1"
                     /translation="MEENAGPTVIVTDGAAVADGGSLWIRIAVDGQTRDYSLDRALAS
                     RGTPRYDSIRGTHGVLSNEERRALRVLLERIADPAMWAGIVGTFIEVLKRADGP"
     CDS             complement(184977..185282)
                     /transl_table=11
                     /locus_tag="BCAM0160"
                     /product="putative exported protein"
                     /note="No significant database matches"
                     /db_xref="EnsemblGenomes-Gn:BCAM0160"
                     /db_xref="EnsemblGenomes-Tr:CAR54017"
                     /db_xref="UniProtKB/TrEMBL:B4EH60"
                     /protein_id="CAR54017.1"
                     /translation="MKRVALAAALTLFAAFNAPAIAGASSGAVAPVPAQAHAKNCVPS
                     RDAAPGARSPSGAPPIRVCVGDADTQLNLPWFLTDVLTAVDTHQSPSGLLHKMRNDF"
     sig_peptide     complement(185217..185282)
                     /locus_tag="BCAM0160"
                     /note="Signal peptide predicted for BCAM0160 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.676 between residues 22 and 23"
                     /inference="protein motif:SignalP:2.0"
     CDS             complement(185369..186415)
                     /transl_table=11
                     /locus_tag="BCAM0161"
                     /product="AraC family regulatory protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0161"
                     /db_xref="EnsemblGenomes-Tr:CAR54018"
                     /db_xref="GOA:B4EH61"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR018060"
                     /db_xref="InterPro:IPR020449"
                     /db_xref="InterPro:IPR032687"
                     /db_xref="UniProtKB/TrEMBL:B4EH61"
                     /protein_id="CAR54018.1"
                     /translation="MPAASPLATQRIYYSSTYVRLLFDYLSGQGKDAARVLGEARPPE
                     DDRGLTLYASAHWRRLLERAADALDDPLLGLHVGQRITPAHLGALGYALHACRDAGAA
                     LARWQQYEHLIANVARMEVRVEATSVAIEWHDAPEPLGPLVDEVALTAIVQFARNITG
                     TRTGPDEVGFVHPSPGDEQPYRDYFGCPVRFGQPVNRLAFPLRLLTQPLQRPDDALRQ
                     MMERQASALLAELRQTDDLEQSVREAVARLLTQGEVSIEQIASDLHVSSRTLHRRLAG
                     LGLNFRRLREDTRRRLAIDHLNDPRLTLAEVAWLLGYSEHSAFTRAFRRWTGESPQQW
                     RSRQPARAASVARG"
     misc_feature    complement(185408..185542)
                     /locus_tag="BCAM0161"
                     /note="HMMPfam hit to PF00165, Bacterial regulatory
                     helix-turn-helix protei, score 2.4e-07"
                     /inference="protein motif:HMMPfam:PF00165"
     misc_feature    complement(185591..185656)
                     /note="Predicted helix-turn-helix motif with score
                     1299.000, SD 3.61 at aa 254-275, sequence
                     VSIEQIASDLHVSSRTLHRRLA"
                     /inference="protein motif:helixturnhelix:EMBOSS"
     CDS             186525..187442
                     /transl_table=11
                     /locus_tag="BCAM0162"
                     /product="putative membrane protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0162"
                     /db_xref="EnsemblGenomes-Tr:CAR54019"
                     /db_xref="GOA:B4EH62"
                     /db_xref="InterPro:IPR006694"
                     /db_xref="UniProtKB/TrEMBL:B4EH62"
                     /protein_id="CAR54019.1"
                     /translation="MTWLHAFLGNDVDWKQVLLIGMTPVFLIAFAVEYAVMTRRGRRE
                     PFSWKEIVANLSLGAGYQVAETVTGLLLSGAIFAWVYRHRLFDVPVNGFTIVPIFVVV
                     EFCYYWFHRTSHRVRWFWAAHVPHHSGEVMNFTTAMRQSLLNAFVGVFLFYLPPVWLG
                     IPPAVVLFLLAVDLTYQYFVHTEAIGRLPRWFEYVFDTPSNHRAHHGRNPRYIDRNYG
                     GVLIIFDRMFGTYVEETEPVDYGITQQIRSYNFLVLNVHEFVDMWRDVLAPGPVLQRL
                     KHLWMPPEWERPGHRPIHTWSVERKGGKG"
     misc_feature    join(186567..186635,186696..186764,186792..186851,
                     186948..187007)
                     /locus_tag="BCAM0162"
                     /note="4 probable transmembrane helices predicted for
                     BCAM0162 by TMHMM2.0 at aa 15-37, 58-80, 90-109 and
                     142-161"
                     /inference="protein motif:TMHMM:2.0"
     CDS             complement(187493..187867)
                     /transl_table=11
                     /locus_tag="BCAM0163"
                     /product="putative microcin immunity protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0163"
                     /db_xref="EnsemblGenomes-Tr:CAR54020"
                     /db_xref="GOA:B4EH63"
                     /db_xref="UniProtKB/TrEMBL:B4EH63"
                     /protein_id="CAR54020.1"
                     /translation="MNSIITRSFGGLTRPYYIRNFLFSLIFPTVFIFISSFGKESLPG
                     GLLALVLIFMAVSCLLYPYSRFVYESVVNYIVGRNMFFVNAALMLVVKFMTMFLCWYL
                     AIFIAPLGLAYLFFRHRPTGAN"
     misc_feature    complement(join(187520..187588,187598..187657,
                     187676..187744,187754..187807))
                     /locus_tag="BCAM0163"
                     /note="4 probable transmembrane helices predicted for
                     BCAM0163 by TMHMM2.0 at aa 21-38, 42-64, 71-90 and 94-116"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    complement(187694..187726)
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     sig_peptide     complement(187754..187867)
                     /locus_tag="BCAM0163"
                     /note="Signal peptide predicted for BCAM0163 by SignalP
                     2.0 HMM (Signal peptide probability 0.624) with cleavage
                     site probability 0.359 between residues 38 and 39"
                     /inference="protein motif:SignalP:2.0"
     CDS             complement(188051..189679)
                     /transl_table=11
                     /locus_tag="BCAM0164"
                     /product="putative lipoprotein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0164"
                     /db_xref="EnsemblGenomes-Tr:CAR54021"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:B4EH64"
                     /protein_id="CAR54021.1"
                     /translation="MTRPTRTAAALTIACLLLAACGGDDDPTPPATSVDNNGTAPAPQ
                     PQPQPTPDPAPATYYQTKTPYRPQQDAATYEAPPADYAPVYTELVARHGSRGLSGFKY
                     DGAIYAMLVKAEADGALTALGAQLKADTYAMMKANALLGYGVQGISTPGYGNLTQTGI
                     REHQQLAARLAQRLPALFAAGNRQVVVVNSGQDRAVDSSTYFSAALVAAQPALAPAIT
                     LPAAPAGYPANAPVAQPAGTNRFLLYFHSLKPATDLVTDTSDPYYATYQASQAYQAYA
                     NDATVAAKLKAIKAAPQAADVARTVLTALVSPAFIAKLGTDGYTFANTGTYAFTSTDG
                     KFTNTLKGDGKTKIATAVDAVNVLYNLLQVAPAMTAETGGVTMEKYIGAEQAQYLAYL
                     QDAEDYYQKGPGIQEANPVTYRMAKVLQDDFFGEVDAIARGDLTHAAKLRFTHAEIVI
                     PFASIMNLKNVFVPTPQAQTYTYANNPWRGDQVSPMAANMQWDVYRNGTRLIVKMLYN
                     ERETDFQAACDGAKIAPTSHFYDYAGLKQCYGYQ"
     misc_feature    complement(188156..189418)
                     /locus_tag="BCAM0164"
                     /note="HMMPfam hit to PF00328, Histidine acid phosphatase,
                     score 0.00035"
                     /inference="protein motif:HMMPfam:PF00328"
     sig_peptide     complement(189614..189679)
                     /locus_tag="BCAM0164"
                     /note="Signal peptide predicted for BCAM0164 by SignalP
                     2.0 HMM (Signal peptide probability 0.999) with cleavage
                     site probability 0.499 between residues 22 and 23"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    complement(189617..189649)
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     CDS             complement(189862..190296)
                     /transl_table=11
                     /locus_tag="BCAM0165"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0165"
                     /db_xref="EnsemblGenomes-Tr:CAR54022"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR036412"
                     /db_xref="UniProtKB/TrEMBL:B4EH65"
                     /protein_id="CAR54022.1"
                     /translation="MVIEAIVTRLDAAFAQIEATPDSRESRHQRDAIIQWLDRASEEG
                     YRLGLVTTLPAARLSDMFEGQFGRANLDRFSVVVTDSDQQDSGSNQHPFDVALQALGV
                     PPERAVGIASSEPERREVEHFGLSRCVNITDTVRSIASAGLH"
     CDS             complement(190623..191981)
                     /transl_table=11
                     /gene="ndh"
                     /locus_tag="BCAM0166"
                     /product="NADH dehydrogenase"
                     /EC_number="1.6.99.3"
                     /db_xref="EnsemblGenomes-Gn:BCAM0166"
                     /db_xref="EnsemblGenomes-Tr:CAR54023"
                     /db_xref="GOA:B4EH66"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="InterPro:IPR036188"
                     /db_xref="UniProtKB/TrEMBL:B4EH66"
                     /protein_id="CAR54023.1"
                     /translation="MDNTTPTLATDRAPRVPRIVIVGGGAGGLQLATRLGDTVGRRGQ
                     TDVVLVDRYPTHFWKPLLHEAASGHRDPASHTIEYAAQAKRHGFRFVQGALRRVDRAA
                     RTATIAAVRDADGTEILPQRELDYDDLVLAVGSVTNFFNVPGAERHALPLENLDQAED
                     FRRKFLAACTKANHLAEQQPARRGAPICINVIGAGATGVELAAALRHAIQQLTTYRFK
                     ALVSARDVHIRLIEGGPRILPALDERLSGKMHAQLRALNVDVLTDTRVAEVGADAVTT
                     AAGERLASDITIWAAGVAGPAMLRDIGDIALNRSNQVIVTDTLQTPDDPHVYAFGDCA
                     ACPSTGAGGFLPPRAQVAHQQAVYLVNAFARRVAGKPVAGFTFRDAGTVVSLGHAGAV
                     YQADIGVRSRSLIVDGLAAIGLYKFLYRKHLFSVVGVKRALFQSLSHWLQSRNQPSIK
                     LH"
     misc_feature    complement(190791..191930)
                     /gene="ndh"
                     /locus_tag="BCAM0166"
                     /note="HMMPfam hit to PF01266, FAD dependent
                     oxidoreductase, score 0.0016"
                     /inference="protein motif:HMMPfam:PF01266"
     misc_feature    complement(190968..191930)
                     /gene="ndh"
                     /locus_tag="BCAM0166"
                     /note="HMMPfam hit to PF07992, Pyridine
                     nucleotide-disulphide oxidoreduc, score 1.9e-16"
                     /inference="protein motif:HMMPfam:PF07992"
     misc_feature    complement(191106..191420)
                     /gene="ndh"
                     /locus_tag="BCAM0166"
                     /note="HMMPfam hit to PF00070, Pyridine
                     nucleotide-disulphide oxidoreduc, score 2e-12"
                     /inference="protein motif:HMMPfam:PF00070"
     CDS             192082..193035
                     /transl_table=11
                     /locus_tag="BCAM0167"
                     /product="LysR family regulatory protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0167"
                     /db_xref="EnsemblGenomes-Tr:CAR54024"
                     /db_xref="GOA:B4EH67"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="InterPro:IPR036390"
                     /db_xref="UniProtKB/TrEMBL:B4EH67"
                     /protein_id="CAR54024.1"
                     /translation="MYSLIGKTATFRQLKALDMIARLGSVSRAAEELNLTQPAVSLQV
                     RLLEEAVGAALLQRVGRGVQLTAAGEIVARYAREILHLWSEAGDEVAALTGDLGGTLR
                     IGAITTAEYLIPPLLVKFTATRPHVKTYFKVGNRDDIIRMLATHEIDLAVMGSAPKEL
                     RTHAVEFAKHPMVFVAAPGHPLMQRKRVALKDLESAHLLVRERGAGTRSTVESLFKNA
                     GHRFHVGSELSSNEAIKQMAEAGLGVAFLSLHACALELRTGLLGQLPFPGNPIEREWY
                     VVTLADRRISQVTGLFRDFLIKQGAPVIDGATVASHERRRK"
     misc_feature    192112..192291
                     /locus_tag="BCAM0167"
                     /note="HMMPfam hit to PF00126, Bacterial regulatory
                     helix-turn-helix, score 1e-21"
                     /inference="protein motif:HMMPfam:PF00126"
     misc_feature    192151..192216
                     /note="Predicted helix-turn-helix motif with score
                     1382.000, SD 3.89 at aa 24-45, sequence
                     GSVSRAAEELNLTQPAVSLQVR"
                     /inference="protein motif:helixturnhelix:EMBOSS"
     misc_feature    192154..192246
                     /note="PS00044 Bacterial regulatory proteins, lysR family
                     signature."
                     /inference="protein motif:Prosite:PS00044"
     misc_feature    192361..192984
                     /locus_tag="BCAM0167"
                     /note="HMMPfam hit to PF03466, LysR substrate binding
                     domain, score 9.7e-55"
                     /inference="protein motif:HMMPfam:PF03466"
     CDS             193436..194359
                     /transl_table=11
                     /locus_tag="BCAM0168"
                     /product="AraC family regulatory protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0168"
                     /db_xref="EnsemblGenomes-Tr:CAR54025"
                     /db_xref="GOA:B4EH68"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR018060"
                     /db_xref="UniProtKB/TrEMBL:B4EH68"
                     /protein_id="CAR54025.1"
                     /translation="MSDPILAAPTDNGVPVSLRSSRGLGWHGFGASLLEIRAGTYRIP
                     AAEHHRIGVHIGAPVRADCVCDGERVSRIQAHGDVDVIPAGLPGQWTDSADCRILHIA
                     LSDTFVRRTVEQLELKPSHAQIRRRLQVRDPRLQHIAWAMAAELEAEDASDPLYAESL
                     CTALVARLVDAQPAFRERRRTLAPKAAARVIDYVEANLDRRMTLAELAALVSISVPHF
                     KVLFRETLGMPVHQYVVRRRVERAKALLLEGRLSISQIALEAGFAHQSHMANWMNRVL
                     GATPTEIARSGVRSGLRLAYDGKDGAKPPRR"
     misc_feature    194000..194140
                     /locus_tag="BCAM0168"
                     /note="HMMPfam hit to PF00165, Bacterial regulatory
                     helix-turn-helix protei, score 8.8e-07"
                     /inference="protein motif:HMMPfam:PF00165"
     misc_feature    194039..194104
                     /note="Predicted helix-turn-helix motif with score
                     1440.000, SD 4.09 at aa 202-223, sequence
                     MTLAELAALVSISVPHFKVLFR"
                     /inference="protein motif:helixturnhelix:EMBOSS"
     misc_feature    194156..194290
                     /locus_tag="BCAM0168"
                     /note="HMMPfam hit to PF00165, Bacterial regulatory
                     helix-turn-helix protei, score 1.2e-06"
                     /inference="protein motif:HMMPfam:PF00165"
     CDS             194494..195381
                     /transl_table=11
                     /locus_tag="BCAM0169"
                     /product="NmrA-like family protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0169"
                     /db_xref="EnsemblGenomes-Tr:CAR54026"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="UniProtKB/TrEMBL:B4EH69"
                     /protein_id="CAR54026.1"
                     /translation="MFVIFGASGNVGLSTVTALRNAGHSVRAVLRDARHRERFVQLGC
                     DVAIADLTDANAIAAAIDGARAVQMLCPVPAADPDPAATMTRTIDAATAALAANPPPA
                     LLALSDYGAELEGNTGITRLFHDFEERLKPIPTQLTLLRSAEHLQNWARVLPVALGTG
                     VLPSFHHPVGKVFPTVWAPDVGVVAARLLLDAPEGGSGPRIVSVEGPRRVSVTAIADT
                     LGAAAGRSVVAHELPRDTWNATLLRAGLSERHAQLIVDLYDVHNAGRIDVEAGVSERV
                     YGATTLEEVLAQLVRRHAH"
     misc_feature    194497..195189
                     /locus_tag="BCAM0169"
                     /note="HMMPfam hit to PF05368, NmrA-like family, score
                     0.0016"
                     /inference="protein motif:HMMPfam:PF05368"
     CDS             complement(195407..196609)
                     /transl_table=11
                     /gene="benE"
                     /locus_tag="BCAM0170"
                     /product="benzoate membrane transport protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0170"
                     /db_xref="EnsemblGenomes-Tr:CAR54027"
                     /db_xref="GOA:B4EH70"
                     /db_xref="InterPro:IPR004711"
                     /db_xref="UniProtKB/TrEMBL:B4EH70"
                     /protein_id="CAR54027.1"
                     /translation="MQPNTPPSAIRTLGNDWSVSAITAGFLAVLISYAGPLAIFFQAS
                     QAAHASNEMVTSWVWAISIGAGVSGLFASWKLKVPVVTAWSAPGTALLVGLFPQLTLN
                     QAVGAYITAALIILAIGVSGYFDRLVRHIPRGIACGMMAGILLPFGMHAFSAASAQPA
                     LAFGMIAAYVIFRRLLPRYSIVLVLLTGAALATLLGMTHLGNVSPSLARPVFIAPKWT
                     LGTTLSLALPLVVVSLTGQFLPGMAILRVSGYHTPARPIITATSMMSLVVACFGGITI
                     VVAAITAALCTGKDAHEDPDRRYVAGLANGVIYLIGGLFAGTIVTLFFALPKAFVAIL
                     AGLALIGAISANVHGIFEDENHREASVITFLATASGMTWLGLGSAFWGIVIGSVAYGV
                     LNRVRRPA"
     misc_feature    complement(join(195431..195499,195557..195625,
                     195638..195706,195749..195817,195875..195943,
                     196001..196069,196082..196141,196151..196219,
                     196238..196297,196307..196375,196394..196453,
                     196481..196549))
                     /gene="benE"
                     /locus_tag="BCAM0170"
                     /note="12 probable transmembrane helices predicted for
                     BCAM0170 by TMHMM2.0 at aa 21-43, 53-72, 79-101, 105-124,
                     131-153, 157-176, 181-203, 223-245, 265-287, 302-324,
                     329-351 and 371-393"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    complement(195434..196567)
                     /gene="benE"
                     /locus_tag="BCAM0170"
                     /note="HMMPfam hit to PF03594, Benzoate membrane transport
                     protein, score 1.4e-204"
                     /inference="protein motif:HMMPfam:PF03594"
     misc_feature    complement(195482..196555)
                     /gene="benE"
                     /locus_tag="BCAM0170"
                     /note="HMMPfam hit to PF00860, Permease family, score
                     0.0024"
                     /inference="protein motif:HMMPfam:PF00860"
     misc_feature    complement(195800..195832)
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     sig_peptide     complement(196463..196609)
                     /gene="benE"
                     /locus_tag="BCAM0170"
                     /note="Signal peptide predicted for BCAM0170 by SignalP
                     2.0 HMM (Signal peptide probability 0.894) with cleavage
                     site probability 0.808 between residues 49 and 50"
                     /inference="protein motif:SignalP:2.0"
     CDS             complement(196785..197810)
                     /transl_table=11
                     /locus_tag="BCAM0171"
                     /product="putative desaturase"
                     /db_xref="EnsemblGenomes-Gn:BCAM0171"
                     /db_xref="EnsemblGenomes-Tr:CAR54028"
                     /db_xref="GOA:B4EH71"
                     /db_xref="InterPro:IPR005804"
                     /db_xref="UniProtKB/TrEMBL:B4EH71"
                     /protein_id="CAR54028.1"
                     /translation="MAEYFDVDHARAIAALDARFTARTEWPTWLLVVVIYGGWLAVLL
                     LVRDGHLSLGAATPPLILLGAWHLSLQHELLHGHPTRSAFVNKLLGYPPLTIWYPYTL
                     YRDMHLEHHRDEDLTVPGVDPETNYVTQERWARLPRWRRALTVARKTFLGRIVVGPPL
                     AIAATFRDAFAAFRRGDFRYLPMWATHAACVVALLAWLQWAIGVPWWYYLLAVTWPAL
                     SLAMIRSLYEHRAAPHPKARITINEAGFAMRLLYLNNNYHLVHHDMPKLPWYDLPRAY
                     RMRRAAYAEKCGGFVIRGGYRALLARHAWTPTDPPVHPFDAGTASLSTGSGIKVAVVD
                     RVLQIST"
     misc_feature    complement(196965..197645)
                     /locus_tag="BCAM0171"
                     /note="HMMPfam hit to PF00487, Fatty acid desaturase,
                     score 8.9e-08"
                     /inference="protein motif:HMMPfam:PF00487"
     misc_feature    complement(join(197127..197195,197205..197273,
                     197673..197735))
                     /locus_tag="BCAM0171"
                     /note="3 probable transmembrane helices predicted for
                     BCAM0171 by TMHMM2.0 at aa 26-46, 180-202 and 206-228"
                     /inference="protein motif:TMHMM:2.0"
     CDS             198053..198880
                     /transl_table=11
                     /locus_tag="BCAM0172"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0172"
                     /db_xref="EnsemblGenomes-Tr:CAR54029"
                     /db_xref="UniProtKB/TrEMBL:B4EH72"
                     /protein_id="CAR54029.1"
                     /translation="MNPWIAVLPMYNVTPRHAVLWRALLRDALDAFANAGGPADVALP
                     DAPFDDLQALWRRDDLLLSQTCGYPYRMLGLRDVVRLIATPIFEAEGCDGACYSSVLV
                     VSARVHAGGATTLAACRGLRAAFNGADSHSGMNAFRHAVAPHAHDGRFFGSVTPFGSH
                     LNVLRALASGEADCAAIDCVTFAYVRDALPDLLTDIRIIGTTASAPGLPFVASRAALA
                     DTQVVALQDALDRAVAADAERARVLRLKGFDRLSPADYDTIARFAQAAAAHGYPELA"
     misc_feature    198374..198406
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     CDS             complement(198931..200328)
                     /transl_table=11
                     /gene="dbpA"
                     /locus_tag="BCAM0173"
                     /product="ATP-independent RNA helicase"
                     /db_xref="EnsemblGenomes-Gn:BCAM0173"
                     /db_xref="EnsemblGenomes-Tr:CAR54030"
                     /db_xref="GOA:B4EH73"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR005580"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:B4EH73"
                     /protein_id="CAR54030.1"
                     /translation="MTQPTATPFSALPLTPATLANLAQLGYVDMTPIQAASLPIALAG
                     QDLIAQAKTGSGKTAAFSLALLARLDARRFDVQAMILCPTRELADQVAQEVRRLARAE
                     ENVKVLTLCGGTPMRPQAQSLEHGAHIVVGTPGRIMDHLDRGNLKLDALNTLVLDEAD
                     RMLDMGFFDDIAKVARMCPTTRQTLLFSATYPDGIAKLSQQFLRNPKEIKLAERHDDS
                     KIRQRFYEVTEDERLHAVGQLLNHYRPVSTIAFCNTKQQCRDLLDVLHAQGFHALALH
                     GELDQRERDQVLIQFANRSCSVLVATDVAARGLDIAQLEAVINVDVTPDPEVHVHRIG
                     RTGRADQDGWALSLASMDEMGRVGAIEQAQKREVEWHPLAELKPADDSVLLPPMETLQ
                     ILGGRKDKIRPGDVLGALTGDAGFDGKQIGKINVTEFSTYVAIERGVARDALRKLNAG
                     KIKGKRVKVRLMDEE"
     misc_feature    complement(198940..199197)
                     /gene="dbpA"
                     /locus_tag="BCAM0173"
                     /note="HMMPfam hit to PF03880, DbpA RNA binding domain,
                     score 5.2e-22"
                     /inference="protein motif:HMMPfam:PF03880"
     misc_feature    complement(199309..199539)
                     /gene="dbpA"
                     /locus_tag="BCAM0173"
                     /note="HMMPfam hit to PF00271, Helicase conserved
                     C-terminal domain, score 7.7e-28"
                     /inference="protein motif:HMMPfam:PF00271"
     misc_feature    complement(199735..200238)
                     /gene="dbpA"
                     /locus_tag="BCAM0173"
                     /note="HMMPfam hit to PF00270, DEAD/DEAH box helicase,
                     score 1.6e-68"
                     /inference="protein motif:HMMPfam:PF00270"
     misc_feature    complement(199840..199866)
                     /note="PS00039 DEAD-box subfamily ATP-dependent helicases
                     signature."
                     /inference="protein motif:Prosite:PS00039"
     misc_feature    complement(200155..200178)
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
                     /inference="protein motif:Prosite:PS00017"
     sig_peptide     complement(200269..200328)
                     /gene="dbpA"
                     /locus_tag="BCAM0173"
                     /note="Signal peptide predicted for BCAM0173 by SignalP
                     2.0 HMM (Signal peptide probability 0.874) with cleavage
                     site probability 0.662 between residues 20 and 21"
                     /inference="protein motif:SignalP:2.0"
     CDS             complement(200325..200522)
                     /transl_table=11
                     /locus_tag="BCAM0174"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0174"
                     /db_xref="EnsemblGenomes-Tr:CAR54031"
                     /db_xref="UniProtKB/TrEMBL:B4EH74"
                     /protein_id="CAR54031.1"
                     /translation="MFTCRNQSCGTQWEQSDVVIKDEGQGLLFRCPLCGARNYLERFE
                     DDEGNVVYEQMEGRPYLGDLS"
     CDS             complement(200810..202453)
                     /transl_table=11
                     /gene="mqo"
                     /locus_tag="BCAM0175"
                     /product="malate:quinone oxidoreductase"
                     /EC_number="1.1.99.16"
                     /db_xref="EnsemblGenomes-Gn:BCAM0175"
                     /db_xref="EnsemblGenomes-Tr:CAR54032"
                     /db_xref="GOA:B4EH75"
                     /db_xref="InterPro:IPR006231"
                     /db_xref="InterPro:IPR036188"
                     /db_xref="UniProtKB/TrEMBL:B4EH75"
                     /protein_id="CAR54032.1"
                     /translation="MIKTLRVILSALALCVATSSAHAADTKKVDVLLVGGGIMSSTLG
                     VWLHELQPDWSMTMVERLDGVALESSNGWNNAGTGHSALAELNYTPEKADGKVDISKA
                     IEINESFQISRQFWAWQVKQGVLKNPHSFINSTPHMSFVWGDDNVRFLKKRYEALQAS
                     PLFRGMQYSEDYDQIKQWVPLMMEGRDRNQKVAATWTPIGTDVNFGEITRQFVGYLKT
                     QPNFTLSLSSEVREITRNADGTWHVSWVKLHSDEPPQAVDAKFVFIGAGGGALHLLQA
                     SGIPEAKDYGAFPVGGSFLVTDNPEVVKQHLAKAYGKASVGSPPMSVPHLDTRIIDGK
                     KIILFGPFATFSTKFLKNGSYFDLAKSTNLHNVAPMMRVGVDEFPLVQYLAGQLMLSD
                     DDRFNALKEYFPNAKKEDWRLWQAGQRVQIIKRDPVKGGVLKLGTEIVASQDGSIAGL
                     LGASPGASTAAPIMLNLMKKVFKDKVATPEWQQKIRQIVPSYGTRLNDSPAKVVEEWT
                     YTSDVLQLSPPPKIDLGAPSQATGAAPARPAKASADMAL"
     misc_feature    complement(200906..202381)
                     /gene="mqo"
                     /locus_tag="BCAM0175"
                     /note="HMMPfam hit to PF06039, Malate:quinone
                     oxidoreductase (Mqo), score 0"
                     /inference="protein motif:HMMPfam:PF06039"
     misc_feature    complement(201065..202366)
                     /gene="mqo"
                     /locus_tag="BCAM0175"
                     /note="HMMPfam hit to PF01266, FAD dependent
                     oxidoreductase, score 0.0001"
                     /inference="protein motif:HMMPfam:PF01266"
     sig_peptide     complement(202385..202453)
                     /gene="mqo"
                     /locus_tag="BCAM0175"
                     /note="Signal peptide predicted for BCAM0175 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 1.000 between residues 23 and 24"
                     /inference="protein motif:SignalP:2.0"
     CDS             complement(202997..203302)
                     /transl_table=11
                     /locus_tag="BCAM0175a"
                     /product="putative lipoprotein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0175a"
                     /db_xref="EnsemblGenomes-Tr:CAR54033"
                     /db_xref="UniProtKB/TrEMBL:B4EH76"
                     /protein_id="CAR54033.1"
                     /translation="MKRYSPAASFAAAIACAFALSACATPSSTPANASAPADTAAQAA
                     PPRVGGDRDAHGCIGSAGYAWCERTRQCERPWELAKAQGFANSAQAYEQFCRSGGAK"
     sig_peptide     complement(203204..203302)
                     /locus_tag="BCAM0175a"
                     /note="Signal peptide predicted for BCAM0175a by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.853 between residues 33 and 34"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    complement(203255..203287)
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     CDS             complement(203373..203861)
                     /transl_table=11
                     /locus_tag="BCAM0176"
                     /product="AnsC family regulatory protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0176"
                     /db_xref="EnsemblGenomes-Tr:CAR54034"
                     /db_xref="GOA:B4EH77"
                     /db_xref="InterPro:IPR000485"
                     /db_xref="InterPro:IPR011008"
                     /db_xref="InterPro:IPR019887"
                     /db_xref="InterPro:IPR019888"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="InterPro:IPR036390"
                     /db_xref="UniProtKB/TrEMBL:B4EH77"
                     /protein_id="CAR54034.1"
                     /translation="MSKNRASVELDGVDRAMLRLLQEDGALSNATLGEKLSLSVTPCW
                     RRRKRLEDEHVITGYQANLDRRALGMNVFAFVQVTFNMHSGQDSDHFEDVMRRHDEVT
                     SCHKITGAADYILQVVAADLDAYAEFVERVLRKQAGVSSIQSSLALREVKFSSRVPVP
                     DA"
     misc_feature    complement(203412..203642)
                     /locus_tag="BCAM0176"
                     /note="HMMPfam hit to PF01037, AsnC family, score 1.5e-25"
                     /inference="protein motif:HMMPfam:PF01037"
     CDS             203990..205027
                     /transl_table=11
                     /gene="aphA"
                     /locus_tag="BCAM0177"
                     /product="acetylpolyamine aminohydrolase"
                     /db_xref="EnsemblGenomes-Gn:BCAM0177"
                     /db_xref="EnsemblGenomes-Tr:CAR54035"
                     /db_xref="GOA:B4EH78"
                     /db_xref="InterPro:IPR000286"
                     /db_xref="InterPro:IPR023696"
                     /db_xref="InterPro:IPR023801"
                     /db_xref="InterPro:IPR037138"
                     /db_xref="UniProtKB/TrEMBL:B4EH78"
                     /protein_id="CAR54035.1"
                     /translation="MLTVYSSDHHLHRGVELKDGAITESFEHPLRAETVLAQVRAAGL
                     GDVIAPRAFDRASYAGAHSARYVDFLAGAWDEWTATGRTCQALPLVWPVRAMPAAATP
                     PGFIDGKLGFFAMDAGAPINAGTWDAVSASANSALTGADLLSGGGARAAFALCRPPGH
                     HAGREYMGGYCYLNNAAIAAQHGIARGAARVAVLDVDFHHGNGTQDIFYERSDVLFAS
                     LHGEPSVSYPYFSGYADERGAGVGAGFNLNLPLPKGTRWDTYSAALDHAAAAIAKHAP
                     DLLVVSLGVDTFEHDPISHFKLRSPDYLRIGETLARLNLPTLFVMEGGYMVDEIGINA
                     VNVLLGFEGRA"
     misc_feature    203993..205018
                     /gene="aphA"
                     /locus_tag="BCAM0177"
                     /note="HMMPfam hit to PF00850, Histone deacetylase domain,
                     score 4.1e-60"
                     /inference="protein motif:HMMPfam:PF00850"
     CDS             205096..206238
                     /transl_table=11
                     /locus_tag="BCAM0178"
                     /product="putative periplasmic solute-binding protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0178"
                     /db_xref="EnsemblGenomes-Tr:CAR54036"
                     /db_xref="GOA:B4EH79"
                     /db_xref="InterPro:IPR000709"
                     /db_xref="InterPro:IPR028081"
                     /db_xref="InterPro:IPR028082"
                     /db_xref="UniProtKB/TrEMBL:B4EH79"
                     /protein_id="CAR54036.1"
                     /translation="MNRHHKTVFATAVALTCALPAGAAQADDVVRIGHVAPLTGAIAH
                     LGKDSENGARLAVEEINAKGLVIGGRKVTLQLDAQDDAGDPRTATQVAQRLVDDKVVG
                     VVGHHNSGTSIPASRVYRDGGVVQISQAATNPTYTQQGFKTTYRVVATDAQQGPALAM
                     YAAKNMGIRTVAVVDDSTAYGQGLATEFEKAAKAAGMKVVSRDATNDKAIDFRAILTK
                     IKGASPDAIMYGGMDATGGPLAKQARQLGMRAKILAGDGVCSTDLPKLAGPASDNVVC
                     SEAGIALEKMPGGAAFAKRYEARYHQPMQVYAPFSYDAVYIIVDAMKRANSTDPAKVL
                     AAMPATDYRGVIGETSFTPQGDLKHGAISVFTYKSGRKALLDIVRM"
     sig_peptide     205096..205173
                     /locus_tag="BCAM0178"
                     /note="Signal peptide predicted for BCAM0178 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.919 between residues 26 and 27"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    205237..206205
                     /locus_tag="BCAM0178"
                     /note="HMMPfam hit to PF01094, Receptor family ligand
                     binding region, score 2.5e-57"
                     /inference="protein motif:HMMPfam:PF01094"
     CDS             complement(206272..207141)
                     /transl_table=11
                     /locus_tag="BCAM0179"
                     /product="putative mechanosensitive ion channel protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0179"
                     /db_xref="EnsemblGenomes-Tr:CAR54037"
                     /db_xref="GOA:B4EH80"
                     /db_xref="InterPro:IPR006685"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR011014"
                     /db_xref="InterPro:IPR011066"
                     /db_xref="InterPro:IPR023408"
                     /db_xref="UniProtKB/TrEMBL:B4EH80"
                     /protein_id="CAR54037.1"
                     /translation="MFLDQLHPERWTFLWNALSTLSLKLSAALALLVAGWWLSKRIGN
                     WLNRLLSNKERVDDTLRPILCDVAVWGIRIVAIVGALSQLGIETASIVAVLGAAGLAI
                     GFALQGTMQNIAAGIMLLLLRPFKVGDYIDGGTGVAGTVEEVGLFMTRLTKPDGICEY
                     VPNSALWGSSIRNYTRNPTRRLDLEVEVSVHDDIDRALAALRALAVADPDVLQDPAPD
                     VMVMRFDDSTAVANMRVWTHTDQFWAMRWRLARQVRKTLADADCALPIRTRELHIVHD
                     AARRADEARVRVS"
     misc_feature    complement(206347..206946)
                     /locus_tag="BCAM0179"
                     /note="HMMPfam hit to PF00924, Mechanosensitive ion
                     channel, score 5.4e-56"
                     /inference="protein motif:HMMPfam:PF00924"
     misc_feature    complement(join(206812..206880,206899..206967,
                     207037..207105))
                     /locus_tag="BCAM0179"
                     /note="3 probable transmembrane helices predicted for
                     BCAM0179 by TMHMM2.0 at aa 13-35, 59-81 and 88-110"
                     /inference="protein motif:TMHMM:2.0"
     CDS             207421..208794
                     /transl_table=11
                     /locus_tag="BCAM0180"
                     /product="metallo peptidase, subfamily M23B"
                     /note="subfamily M23B metallo peptidase. Weakly similar to
                     Rhizobium loti MLR3423 protein SWALL:Q98GA2
                     (EMBL:AP003001) (476 aa) fasta scores: E(): 1.3e-18,
                     29.73% id in 454 aa. C-terminus is similar to the
                     C-terminal region of Bordetella parapertussis hypothetical
                     protein SWALL:Q7W3Z7 (EMBL:BX640435) (471 aa) fasta
                     scores: E(): 9.1e-27, 39.39% id in 264 aa"
                     /db_xref="EnsemblGenomes-Gn:BCAM0180"
                     /db_xref="EnsemblGenomes-Tr:CAR54038"
                     /db_xref="InterPro:IPR011055"
                     /db_xref="InterPro:IPR016047"
                     /db_xref="UniProtKB/TrEMBL:B4EH81"
                     /protein_id="CAR54038.1"
                     /translation="MRSDLRFRVAREQGRPASRGVHRFPIGRAFLRGIVAAACVAGAQ
                     GAAAQAFHDAAPAAPATAETIDLGDVPFFNSARTTWGGLRASSAAPLDVAYASHAWNV
                     STGTGRDDPVARFGACVAYRVLCDTARGAVERGYAARFDYGLASALPATGAQPAFAHG
                     PVDLASAEPFTLAQPDRGTRAGAIVGSLHASLARADLPAGVAAQIVRMLAGRVDPKQR
                     GAQGDTFRVAFEPDHDATRPGRVRVTALDVRFRGQQVAAVWFAAQAGSPGAYYDLDGM
                     PLGGARFAMPVAATRISSTFGARVHPVSGARHVHSGVDLAAPAGRAVHASERGVVTFI
                     GTEPRGYGKYVVIRHDGGYASYYAHLSAFEPTLRTGARVMRGQRVGAVGSTGTATGPH
                     LHFEVRRHARLVDPIELVHAAQATKLKGAQRVAFNRVARDARVQLAAATWAQPVAMSA
                     PSAPHAG"
     misc_feature    207862..207879
                     /note="PS00343 Gram-positive cocci surface proteins
                     'anchoring' hexapeptide."
                     /inference="protein motif:Prosite:PS00343"
     misc_feature    208342..208638
                     /locus_tag="BCAM0180"
                     /note="HMMPfam hit to PF01551, Peptidase family M23, score
                     3.4e-41"
                     /inference="protein motif:HMMPfam:PF01551"
     CDS             209163..210236
                     /transl_table=11
                     /locus_tag="BCAM0181"
                     /product="putative catalase"
                     /db_xref="EnsemblGenomes-Gn:BCAM0181"
                     /db_xref="EnsemblGenomes-Tr:CAR54039"
                     /db_xref="GOA:B4EH82"
                     /db_xref="InterPro:IPR011614"
                     /db_xref="InterPro:IPR018028"
                     /db_xref="InterPro:IPR020835"
                     /db_xref="InterPro:IPR024168"
                     /db_xref="UniProtKB/TrEMBL:B4EH82"
                     /protein_id="CAR54039.1"
                     /translation="MSKLDFTSKRTWGALAAIAAVAGVLTSTLAWTAGWIGSRTTSVS
                     LVSETPQPFPAGFRRAHGKGVCFAGTFRPDRAAVPLSTARVFTQADIPVVGRLSIGTG
                     SPYAADSSTTTLSMALLLTTDDKQQWRMAMNNQPYFATHEPEGFLAMQQATAPDPATG
                     QPDPARLSAFLKAYPEAEKFMKWAAQEPAPGSFAGATFYSVNAFYLVGADGHRQPVRW
                     MMRPHDPFMPMSDAQRQKADHDFLFEGVRERLARKPLYWDYVLQLAQPGDPVDDASQP
                     WPADRKQLVAGTLEMMRVVEQAEGACRDINFDPSIVPAGVEVSNDPILNARSGAYAHS
                     FNRREREIGYGKATEAVGKQEVK"
     sig_peptide     209163..209258
                     /locus_tag="BCAM0181"
                     /note="Signal peptide predicted for BCAM0181 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.722 between residues 32 and 33"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    209199..209267
                     /locus_tag="BCAM0181"
                     /note="1 probable transmembrane helix predicted for
                     BCAM0181 by TMHMM2.0 at aa 13-35"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    209211..210233
                     /locus_tag="BCAM0181"
                     /note="HMMPfam hit to PF00199, Catalase, score 2.2e-06"
                     /inference="protein motif:HMMPfam:PF00199"
     misc_feature    210006..210047
                     /note="PS00287 Cysteine proteases inhibitors signature."
                     /inference="protein motif:Prosite:PS00287"
     CDS             210233..210799
                     /transl_table=11
                     /locus_tag="BCAM0182"
                     /product="putative cytochrome b561"
                     /db_xref="EnsemblGenomes-Gn:BCAM0182"
                     /db_xref="EnsemblGenomes-Tr:CAR54040"
                     /db_xref="GOA:B4EH83"
                     /db_xref="InterPro:IPR011577"
                     /db_xref="InterPro:IPR016174"
                     /db_xref="UniProtKB/TrEMBL:B4EH83"
                     /protein_id="CAR54040.1"
                     /translation="MNTRKITSGDAPRHFNALARGLHWLMAAMILAMLFIGAGMMTSL
                     HHRIWLIDLHRPLGIAILVLALLRVANRLRSRPPALPRSLPHWQVLAAKASHWALYAL
                     MLALPLIGWALLSAGGFPIVLFKGVNLPAIVPASPTLFAWLRDAHGLLARLLFVVVLA
                     HLSAALVHAWIYRDGVFSSMARGGRQRG"
     misc_feature    210266..210781
                     /locus_tag="BCAM0182"
                     /note="HMMPfam hit to PF01292, Cytochrome b561 family,
                     score 6e-40"
                     /inference="protein motif:HMMPfam:PF01292"
     misc_feature    join(210293..210361,210374..210442,210521..210589,
                     210680..210748)
                     /locus_tag="BCAM0182"
                     /note="4 probable transmembrane helices predicted for
                     BCAM0182 by TMHMM2.0 at aa 21-43, 48-70, 97-119 and
                     150-172"
                     /inference="protein motif:TMHMM:2.0"
     CDS             211297..214632
                     /transl_table=11
                     /locus_tag="BCAM0183"
                     /product="putative autotransporter protein"
                     /note="Similar to the C-terminal region of Bordetella
                     parapertussis autotransporter SWALL:Q7WC79 (EMBL:BX640424)
                     (1616 aa) fasta scores: E(): 7.3e-42, 33.64% id in 1165
                     aa"
                     /db_xref="EnsemblGenomes-Gn:BCAM0183"
                     /db_xref="EnsemblGenomes-Tr:CAR54041"
                     /db_xref="GOA:B4EH84"
                     /db_xref="InterPro:IPR005546"
                     /db_xref="InterPro:IPR006315"
                     /db_xref="InterPro:IPR011050"
                     /db_xref="InterPro:IPR012332"
                     /db_xref="InterPro:IPR013425"
                     /db_xref="InterPro:IPR036709"
                     /db_xref="UniProtKB/TrEMBL:B4EH84"
                     /protein_id="CAR54041.1"
                     /translation="MKRKARNLGLGGMAILTGAVPVSAYAACSATAPGSGTTVTCTGA
                     NAPSVVATAGSTGVTINLDSTVTGSYVLTSTPTPFSVDASSTITNNGSLSMSGNGTGV
                     ANRGAVLLGVNNGNTLTNAATGVIATSGTYNDGMAANGNNNTLVNNGTITTTGNNSYG
                     MTAAWGQSNPGASGNQIVNTGTVTTSGNNARAASLLGGNGTITNGGTLTSNGRDAPAV
                     YMQGNNDTLVNSGTIQTTGTATSGGSVDAVVSNTLGSSFTATITNQAGGRIISNNGIG
                     VRSTNGATTITNAGLIQGGGGTAIQGGNGNVTLILQTGSQIVGTANGGAGTNTLTLQG
                     TGTASNAFTNFQSLTMAGTDWTWAGTGTFSTALVQSGTLNLTGTLGTTTASVVATVNA
                     GATLQANASNLPLSVTDNGLVRFQQDSAGTYTGTIGGSGAVEKTGAGTLTVAPSSAGG
                     NPYSGGTTITQGTLSVAADNALGASSGSLTFNGGTLQLGSAFDLASSRAVSITSNNGT
                     IDTQGFDSAIAQNVTGAGGLTKLGAGTLTMNGANTYAGGTALNAGTLVVGDAAHASAA
                     LGGGGPVAVAAGATLGGYGSVTGNVTNNGTISVANALASLASGAIGDFRINGNLTNAG
                     RVQLGGSGVGNTLTVAGNYVGQNAMLTLNTTLAGDGAPSDKLVVSGGTASGSSTLKVT
                     NVGGAGAQTTGDGIQVVQAANGATTSAGAFSLSGGTVSAGAYTYFLAKGGESTGTGDN
                     WYLRNTVPPKPQPPVVEPGQPTPPAEPPVIAAEGTPESIVEAVDHAGIGGNPEPIYRP
                     EVPLYAEAPAVARQLGLLQIDTFHDRQGEQGLLAENGSVPASWARVWGGNSNIRQKGD
                     ATPSFDGTVWGMQVGQDLYADTTASGHRNHYGFFLGFSRAVGDVNGFALAQTDLGVGS
                     LQVNAYDLGGYWTHIGPGGWYTDAVLMASALTVRTHSNDNVNGSTNGNALTGSVEAGL
                     PIALGNGLTLEPHAQLVWQWLSLDRFNDGVSSIGWNNGNTFVGRIGARLQYAFDANGV
                     SWKPYLRANVLRSFGADDKTTFGGSTTIGTQVGQTAGQIGAGLVAQLTKRGSVYATVS
                     YLTNFGGEHQRTITGNAGVRWAW"
     sig_peptide     211297..211374
                     /locus_tag="BCAM0183"
                     /note="Signal peptide predicted for BCAM0183 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.718 between residues 26 and 27"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    211315..211383
                     /locus_tag="BCAM0183"
                     /note="1 probable transmembrane helix predicted for
                     BCAM0183 by TMHMM2.0 at aa 7-29"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    212602..212835
                     /locus_tag="BCAM0183"
                     /note="HMMPfam hit to PF05594, no description, score 0.2"
                     /inference="protein motif:HMMPfam:PF05594"
     misc_feature    213148..213531
                     /locus_tag="BCAM0183"
                     /note="HMMPfam hit to PF03212, Pertactin, score 0.0003"
                     /inference="protein motif:HMMPfam:PF03212"
     misc_feature    213796..214581
                     /locus_tag="BCAM0183"
                     /note="HMMPfam hit to PF03797, Autotransporter
                     beta-domain, score 3.4e-34"
                     /inference="protein motif:HMMPfam:PF03797"
     CDS             complement(214786..215520)
                     /transl_table=11
                     /locus_tag="BCAM0184"
                     /product="lectin"
                     /note="No significant database matches to the full length
                     CDS. C-terminus is similar to Chromobacterium violaceum
                     hypothetical protein SWALL:Q7NX84 (EMBL:AE016916) (114 aa)
                     fasta scores: E(): 3.7e-18, 56.14% id in 114 aa, and to
                     the C-terminal region of Photorhabdus luminescens
                     hypothetical protein SWALL:Q937N3 (EMBL:AF346497) (320 aa)
                     fasta scores: E(): 4.5e-08, 33.51% id in 182 aa"
                     /db_xref="EnsemblGenomes-Gn:BCAM0184"
                     /db_xref="EnsemblGenomes-Tr:CAR54042"
                     /db_xref="InterPro:IPR010907"
                     /db_xref="InterPro:IPR036684"
                     /db_xref="UniProtKB/TrEMBL:B4EH85"
                     /protein_id="CAR54042.1"
                     /translation="MSQPFTHDDLYALLQLAGNDATAVQANGDQAVLDRMRQFMTAQL
                     VEKLPQYDVFVDIATIPYSFDVGSWQNKVKTDAAGEVVACTVTWAGAPGVLPGAAAKF
                     GVGAVVNYFSKATPQPVQPAPVPTGGGERDGIFTLPPNIAFGVTALVNSSAPQTIEVF
                     VDDNPKPAATFQGAGTQDANLNTQIVNSGKGKVRVVVTANGKPSKIGSRQVDIFKKTY
                     FGLVGSEDGGDGDYNDGIAILNWPLG"
     misc_feature    complement(214792..215118)
                     /locus_tag="BCAM0184"
                     /note="HMMPfam hit to PF07472, Fucose-binding lectin II
                     (PA-IIL), score 6.8e-41"
                     /inference="protein motif:HMMPfam:PF07472"
     CDS             complement(215683..216501)
                     /transl_table=11
                     /locus_tag="BCAM0185"
                     /product="lectin"
                     /note="N-terminal region is similar to Photorhabdus
                     luminescens hypothetical membrane protein SWALL:Q7MZP1
                     (EMBL:BX571873) (139 aa) fasta scores: E(): 2.3e-18,
                     56.06% id in 132 aa. C-terminal region is similar to
                     Chromobacterium violaceum hypothetical protein
                     SWALL:Q7NX84 (EMBL:AE016916) (114 aa) fasta scores: E():
                     1.4e-15, 51.75% id in 114 aa. Full length CDS is similar
                     to the C-terminal region of Photorhabdus luminescens
                     photopexin B PpxB SWALL:Q7MZN8 (EMBL:BX571873) (340 aa)
                     fasta scores: E(): 2e-06, 28.62% id in 276 aa"
                     /db_xref="EnsemblGenomes-Gn:BCAM0185"
                     /db_xref="EnsemblGenomes-Tr:CAR54043"
                     /db_xref="GOA:B4EH86"
                     /db_xref="InterPro:IPR010907"
                     /db_xref="InterPro:IPR033790"
                     /db_xref="InterPro:IPR036684"
                     /db_xref="PDB:2WQ4"
                     /db_xref="PDB:2XR4"
                     /db_xref="UniProtKB/TrEMBL:B4EH86"
                     /protein_id="CAR54043.1"
                     /translation="MPLLSASIVSAPVVTSETYVDIPGLYLDVAKAGIRDGKLQVILN
                     VPTPYATGNNFPGIYFAIATNQGVVADGCFTYSSKVPESTGRMPFTLVATIDVGSGVT
                     FVKGQWKSVRGSAMHIDSYASLSAIWGTAAPSSQGSGNQGAETGGTGAGNIGGGGERD
                     GTFNLPPHIKFGVTALTHAANDQTIDIYIDDDPKPAATFKGAGAQDQNLGTKVLDSGN
                     GRVRVIVMANGRPSRLGSRQVDIFKKSYFGIIGSEDGADDDYNDGIVFLNWPLG"
     misc_feature    complement(215689..216015)
                     /locus_tag="BCAM0185"
                     /note="HMMPfam hit to PF07472, Fucose-binding lectin II
                     (PA-IIL), score 8.8e-39"
                     /inference="protein motif:HMMPfam:PF07472"
     CDS             complement(216624..217013)
                     /transl_table=11
                     /locus_tag="BCAM0186"
                     /product="lectin"
                     /db_xref="EnsemblGenomes-Gn:BCAM0186"
                     /db_xref="EnsemblGenomes-Tr:CAR54044"
                     /db_xref="GOA:B4EH87"
                     /db_xref="InterPro:IPR010907"
                     /db_xref="InterPro:IPR036684"
                     /db_xref="PDB:2VNV"
                     /db_xref="PDB:2WR9"
                     /db_xref="PDB:2WRA"
                     /db_xref="UniProtKB/TrEMBL:B4EH87"
                     /protein_id="CAR54044.1"
                     /translation="MADSQTSSNRAGEFSIPPNTDFRAIFFANAAEQQHIKLFIGDSQ
                     EPAAYHKLTTRDGPREATLNSGNGKIRFEVSVNGKPSATDARLAPINGKKSDGSPFTV
                     NFGIVVSEDGHDSDYNDGIVVLQWPIG"
     misc_feature    complement(216630..216974)
                     /locus_tag="BCAM0186"
                     /note="HMMPfam hit to PF07472, Fucose-binding lectin II
                     (PA-IIL), score 2.8e-18"
                     /inference="protein motif:HMMPfam:PF07472"
     CDS             217955..219667
                     /transl_table=11
                     /locus_tag="BCAM0187"
                     /product="putative 2-isopropylmalate synthase"
                     /db_xref="EnsemblGenomes-Gn:BCAM0187"
                     /db_xref="EnsemblGenomes-Tr:CAR54045"
                     /db_xref="GOA:B4EHL9"
                     /db_xref="InterPro:IPR000891"
                     /db_xref="InterPro:IPR002034"
                     /db_xref="InterPro:IPR005668"
                     /db_xref="InterPro:IPR013709"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR036230"
                     /db_xref="InterPro:IPR039371"
                     /db_xref="UniProtKB/TrEMBL:B4EHL9"
                     /protein_id="CAR54045.1"
                     /translation="MMLKNPATKYRPFTPVNLPDRTWPSRTITQAPIWMSTDLRDGNQ
                     ALFEPMDATRKMRMFKTLVAIGFKEIEVAFPSASETDFNFVRELIEGGHIPDDVTIEV
                     LTQARDDLIERTFASLRGAKRAIVHLYNATAPEFRKIVFSLDRDGVKQLAVNAARTIK
                     RCADAATDTQFTLQYSPETFTATELDFAKEVCDAVFDVWQPTPERKSIVNLPATVEIG
                     TPNYYADQIEWMHRNLARRDSLILSVHPHNDRGTAVAAAELAVMAGADRIEGCLFGNG
                     ERTGNVDLVTLALNLYTQGVDPGLDFSQINEVARTSEECTQLPVHPRHPYVGDLVFTA
                     FSGSHQDAIKKGFAVQRADTVWEVPYLSIDPNDLGRTYDSIIRVNSQSGKGGIAYLLE
                     QGYGVALPRRMQVDFSAAVQRLTDESGHEVTSAQIWALFQQEYVESDTPLRYVSHELT
                     ERDGRETIVLTADVHGERRVLRGEGNGPLDALMHALHTPLRIQHYEERALSQGADAKA
                     IAIAELAGTGVRGSAFGVGVDANLTTASIRAVISGVNRAYARADEVVQATFFAGQPAV
                     QAVA"
     misc_feature    218069..218119
                     /note="PS00815 Alpha-isopropylmalate and homocitrate
                     synthases signature 1."
                     /inference="protein motif:Prosite:PS00815"
     misc_feature    218072..218908
                     /locus_tag="BCAM0187"
                     /note="HMMPfam hit to PF00682, HMGL-like, score 1e-92"
                     /inference="protein motif:HMMPfam:PF00682"
     misc_feature    218678..218719
                     /note="PS00816 Alpha-isopropylmalate and homocitrate
                     synthases signature 2."
                     /inference="protein motif:Prosite:PS00816"
     misc_feature    219215..219598
                     /locus_tag="BCAM0187"
                     /note="HMMPfam hit to PF08502, LeuA allosteric
                     (dimerisation) domain, score 1.8e-25"
                     /inference="protein motif:HMMPfam:PF08502"
     CDS             complement(219739..220452)
                     /transl_table=11
                     /locus_tag="BCAM0188"
                     /product="N-acylhomoserine lactone dependent regulatory
                     protein"
                     /note="Similar to Ralstonia solanacearum transcriptional
                     activator protein SolR or rsc3287 or rs02516
                     SWALL:SLR1_RALSO (SWALL:P58590) (236 aa) fasta scores:
                     E(): 7.1e-29, 38.79% id in 232 aa, and to Burkholderia
                     stabilis N-acyl homoserine lactone transcriptional
                     regulator cepR SWALL:Q93PF6 (EMBL:AF333005) (239 aa) fasta
                     scores: E(): 6e-26, 38.46% id in 234 aa"
                     /db_xref="EnsemblGenomes-Gn:BCAM0188"
                     /db_xref="EnsemblGenomes-Tr:CAR54046"
                     /db_xref="GOA:B4EHM0"
                     /db_xref="InterPro:IPR000792"
                     /db_xref="InterPro:IPR005143"
                     /db_xref="InterPro:IPR016032"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="InterPro:IPR036693"
                     /db_xref="PDB:5L10"
                     /db_xref="UniProtKB/TrEMBL:B4EHM0"
                     /protein_id="CAR54046.1"
                     /translation="MDLTILHDCFDALQRAPTAEAAFPPIAAAAAALGFRYCVYGLRR
                     TLPLARPDMQIVGNHPREWEHRYVKFGYVTIDPIIKRVASQPRPVVWNAFDEPGDTAF
                     WHDAACFGMRYGWSHGGYDRAGNLGVLTLVRDTTPLDADEISRLRAPCASLSHAAHAY
                     LMPRLADPIAPVGTGLTLREREVLAWTADGKTAYEIGMIFGIAERTVKFHLQNAVVKL
                     DAMNKTHAATKAAMLGLLP"
     misc_feature    complement(219763..219936)
                     /locus_tag="BCAM0188"
                     /note="HMMPfam hit to PF00196, Bacterial regulatory
                     proteins, luxR fami, score 1.7e-16"
                     /inference="protein motif:HMMPfam:PF00196"
     misc_feature    complement(219802..219885)
                     /note="PS00622 Bacterial regulatory proteins, luxR family
                     signature."
                     /inference="protein motif:Prosite:PS00622"
     misc_feature    complement(219817..219882)
                     /note="Predicted helix-turn-helix motif with score
                     1238.000, SD 3.40 at aa 191-212, sequence
                     KTAYEIGMIFGIAERTVKFHLQ"
                     /inference="protein motif:helixturnhelix:EMBOSS"
     misc_feature    complement(219877..219900)
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
                     /inference="protein motif:Prosite:PS00017"
     misc_feature    complement(219964..220401)
                     /locus_tag="BCAM0188"
                     /note="HMMPfam hit to PF03472, Autoinducer binding domain,
                     score 3.5e-27"
                     /inference="protein motif:HMMPfam:PF03472"
     CDS             220649..221464
                     /transl_table=11
                     /locus_tag="BCAM0189"
                     /product="AraC family regulatory protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0189"
                     /db_xref="EnsemblGenomes-Tr:CAR54047"
                     /db_xref="GOA:B4EHM1"
                     /db_xref="InterPro:IPR003313"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR018060"
                     /db_xref="InterPro:IPR018062"
                     /db_xref="InterPro:IPR020449"
                     /db_xref="UniProtKB/TrEMBL:B4EHM1"
                     /protein_id="CAR54047.1"
                     /translation="MTSVQDVPLLARAGARAFAFGGIRAIEPPCASAPARALAHEYAP
                     HAHQAGQLLFTTRGVLVLDVEGQRWITPPLRAIWIPARTVHAMRVADDVQLCSLYLGD
                     ALGARLPATLCAMTVSPLLRELATRVSHPFDCSVDHDPLARLFADELSELAQTPLTLP
                     LPRDRRLLKLCERLQREPHCELPLDTLARDAALSARHLARLFRSETGMSVAAWRQQLR
                     LSMSLALLASGMPVTQAAHQVGYRSPTTYAATFKRAFGVTPSQYLAAAEAAAR"
     misc_feature    220706..221179
                     /locus_tag="BCAM0189"
                     /note="HMMPfam hit to PF02311, AraC-like ligand binding
                     domain, score 3.6e-08"
                     /inference="protein motif:HMMPfam:PF02311"
     misc_feature    221042..221062
                     /note="PS00290 Immunoglobulins and major
                     histocompatibility complex proteins signature."
                     /inference="protein motif:Prosite:PS00290"
     misc_feature    221153..221293
                     /locus_tag="BCAM0189"
                     /note="HMMPfam hit to PF00165, Bacterial regulatory
                     helix-turn-helix pr, score 3.5e-05"
                     /inference="protein motif:HMMPfam:PF00165"
     misc_feature    221294..221425
                     /note="PS00041 Bacterial regulatory proteins, araC family
                     signature."
                     /inference="protein motif:Prosite:PS00041"
     misc_feature    221309..221440
                     /locus_tag="BCAM0189"
                     /note="HMMPfam hit to PF00165, Bacterial regulatory
                     helix-turn-helix pr, score 4.7e-07"
                     /inference="protein motif:HMMPfam:PF00165"
     CDS             complement(221495..222841)
                     /transl_table=11
                     /locus_tag="BCAM0190"
                     /product="putative aminotransferase-class III"
                     /db_xref="EnsemblGenomes-Gn:BCAM0190"
                     /db_xref="EnsemblGenomes-Tr:CAR54048"
                     /db_xref="GOA:B4EHM2"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:B4EHM2"
                     /protein_id="CAR54048.1"
                     /translation="MSYSESRFWHPRQHPLAASRPPVRITRGEGCYLYDDTGRPYLDA
                     VASLFNVYVGHGRREIKEAIIRQLDELEYHPVFAGFSHPRAEELSARLVGMLQPEDMS
                     RVIFGSGGSDAVEAALMIARQYWKVSGQPERTKFIALRQAYHGSHFGGSSVTGNTVYR
                     RNYEPTLAGCFHVETPWIYRNPFTHDPEELGRLCASLVEREILFQGPDTVAAFIAEPV
                     QATGGIIVPPANYWPLVREVCDRHGVLLIADEVVTGFGRTGAAFGSRGWGVAPDIMCL
                     AKGVSSGYLPLGATVVNRRIENAFASNPGGIGTLMHGYTYSGHPIVCAAALANLQIIV
                     DEDLAGNAAREGAYLLERLQPLVDRYPVVGDVRGKGLLVGIDLVKDKVTRESIDPSDG
                     YAAALADAARDAGVLIRSLGNRLAIAPPLVIGREDVDRIVHAIEHAFEAVPRWTAR"
     misc_feature    complement(221705..222772)
                     /locus_tag="BCAM0190"
                     /note="HMMPfam hit to PF00202, Aminotransferase class-III,
                     score 4.2e-125"
                     /inference="protein motif:HMMPfam:PF00202"
     misc_feature    complement(221993..222106)
                     /note="PS00600 Aminotransferases class-III
                     pyridoxal-phosphate attachment site."
                     /inference="protein motif:Prosite:PS00600"
     CDS             complement(222898..224259)
                     /transl_table=11
                     /locus_tag="BCAM0191"
                     /product="putative non-ribosomal peptide synthetase"
                     /db_xref="EnsemblGenomes-Gn:BCAM0191"
                     /db_xref="EnsemblGenomes-Tr:CAR54049"
                     /db_xref="InterPro:IPR001242"
                     /db_xref="InterPro:IPR023213"
                     /db_xref="UniProtKB/TrEMBL:B4EHM3"
                     /protein_id="CAR54049.1"
                     /translation="MTDSTLQLPLSAPQRDFWEAALAYPVPSTHIYAAEYFDIRGALD
                     TGAFEHALRQVIREAQTLHTTRIVLDGDTPVRVLDAALANDWTLEHVDLAGTKDAHAI
                     ALAGMRAHCTGAIDLARGPFFRHTLYRIAPDHYYWYHGYAHILVDGYSGSLIATRAAE
                     LYNAFASGAKAPPARFASLAELQLDEDAYRASEQFAHDRRYWLERFADQPRTVTLAGP
                     ARFPERDDGPDLRETRLATATESARLEAVARDLFTSTMPRLVTALTAAYLYLNTGAHD
                     IVLSVAAMARTSARERRTPAQCANMLPLRLHVEPGHTLDDLCRQANREMTALRQHQRY
                     RMGDLHRELTSLDNGQGVFGPEINIMAFDYDLRFGDCVTTSHNLSVGTTDDLMVNLTD
                     RRNGEPLRFDFDASPQYYSRDALNAHVGQFLTFMRVALDEPFATLGALESRLDFQPAA
                     LAG"
     misc_feature    complement(223333..224250)
                     /locus_tag="BCAM0191"
                     /note="HMMPfam hit to PF00668, Condensation domain, score
                     2.1e-11"
                     /inference="protein motif:HMMPfam:PF00668"
     CDS             224656..225438
                     /transl_table=11
                     /locus_tag="BCAM0192"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0192"
                     /db_xref="EnsemblGenomes-Tr:CAR54050"
                     /db_xref="InterPro:IPR016084"
                     /db_xref="InterPro:IPR024423"
                     /db_xref="UniProtKB/TrEMBL:B4EHM4"
                     /protein_id="CAR54050.1"
                     /translation="MNQLEGLERKIGEQHERLAHHPVFGSIRTIDELRVFMEWHVFAV
                     WDFMSLVKRLQQDLTTVAVPWVAPRNANASRLINEIVLGEESDETPNGHMSHYDLYLH
                     AMRDVGASTSRIEEMVSLVRSGFSVSAALKAVDAPEPVIRFVEATMAACTSGATHQVL
                     GNFFYGRENVIPDMFRTLLDEWKIERSSIPLLVYYLDRHIEVDSGEHGPAARAMIREA
                     ADGDTAKLEEALQAGLDAIDERMRLWDGLLAHLGQTRNVVPA"
     CDS             225435..225824
                     /transl_table=11
                     /locus_tag="BCAM0193"
                     /product="conserved hypothetical protein"
                     /note="homology extends only to N terminus of protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0193"
                     /db_xref="EnsemblGenomes-Tr:CAR54051"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="UniProtKB/TrEMBL:B4EHM5"
                     /protein_id="CAR54051.1"
                     /translation="MNARGLSERIVDFAALEWEHPAAFDDGIDQVVLVDTLDEHAKRG
                     IRTRIVRFDPGAGTRVPFLHDYHEEVHLIDGDQSLVDVATREYRATYREGSYFVRPAG
                     TPHGPFRSDAGCLLLEIHYYGSPEDTR"
     misc_feature    225576..225794
                     /locus_tag="BCAM0193"
                     /note="HMMPfam hit to PF07883, Cupin domain, score
                     0.00016"
                     /inference="protein motif:HMMPfam:PF07883"
     CDS             225821..226747
                     /transl_table=11
                     /locus_tag="BCAM0194"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0194"
                     /db_xref="EnsemblGenomes-Tr:CAR54052"
                     /db_xref="GOA:B4EHM6"
                     /db_xref="InterPro:IPR012348"
                     /db_xref="InterPro:IPR025859"
                     /db_xref="UniProtKB/TrEMBL:B4EHM6"
                     /protein_id="CAR54052.1"
                     /translation="MTTAVTYVSHVDRWEARATVRSRPRRIVEDDELRYYPLERQPLC
                     AHPAIVDAGDAVRDFVLLQSFYKYIQDVIIFETEIVNATALRIARGRFAHPFPFACRQ
                     DAMTVVIDEDYHAYVAMDYLRQVEEATGIAPLPPNSEIELSRAIPRAVERVGAQYRDG
                     MELLCVAISENTVTAEVAAFSRDATLKRSVKGVMADHLADEGRHSAFWINLVKLYWSE
                     IDEPARLALGEGLPCFLREYLSADLQLQFDRRLIDALDLPAAERARIADDMVGAYPIT
                     SQHPMIVNIRQFFRMSGLLDHAPTRAALSDYL"
     CDS             226757..230323
                     /transl_table=11
                     /locus_tag="BCAM0195"
                     /product="putative non-ribosomal peptide synthetase"
                     /note="homology does not extend to N terminus"
                     /db_xref="EnsemblGenomes-Gn:BCAM0195"
                     /db_xref="EnsemblGenomes-Tr:CAR54053"
                     /db_xref="GOA:B4EHM7"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR009081"
                     /db_xref="InterPro:IPR010071"
                     /db_xref="InterPro:IPR010080"
                     /db_xref="InterPro:IPR013120"
                     /db_xref="InterPro:IPR020806"
                     /db_xref="InterPro:IPR025110"
                     /db_xref="InterPro:IPR036291"
                     /db_xref="InterPro:IPR036736"
                     /db_xref="InterPro:IPR042099"
                     /db_xref="UniProtKB/TrEMBL:B4EHM7"
                     /protein_id="CAR54053.1"
                     /translation="MKAIIIAIGGQTRLAARLASELEATGHTVCIADGRDGPLRDAAD
                     ALLLPAPAPEPLRNAAEWSIVCGAPDPAVHCAHARPLHCEIVADAFPPREVRVAWLTD
                     AAPGDTRVLADATLAFGAALNGADLADEIAACAVDLMHEVASGIARELSDPNDAPRAT
                     PPGPADIVLDLERLAGWHASNDTAAEWPCEPSLPELVSRAAAAAPDACALVAADGQLT
                     YRELVTRARQVAARIAARPAAPRVVAVRLDKGVALYPALVGVLGAGATCVPLDPAFPP
                     ERARTILRESGAQALVVDGAVEPALLDGFDLDVIDCGAHEQVDADASPDALSGQWPLE
                     RDADRAARCAVAIYTSGSTGVPKGVMLSHRNIVQFCHWYRAHVSLDASSRVLQFSTVA
                     FDASLLDMFPTWLAGATLVAPSEAQRRELDALAALVADARITHGFLPPALLAALPDCD
                     WPALAHLVTGGDVCDPDTIARWSANRRLHNIYGPTECTVLATTGELRAGDSNRRIGRP
                     IANARCHVLAADGRPALTGEEGELCIAGAGVGLGYLGRPDLSAERFVADPYGTPGATM
                     YRTGDIASWEPDGTLRYVGRRDAQLKIRGFRVEPGEIETAALAAGLYRQCAVVPDERK
                     RIRLFAAKPVDAAATPDALRAVLAATLPDYMVPYDITALDVLPATPNGKIDRAALARL
                     PVSRAGSDTRDAPRGALELRLAAMWATLLELAPDEIGRDASFFELGGHSLLVSRLMLA
                     VKRELGGNAALARFMERPTIAALAALLTDETGERGANVPARVHDDRRLPDDVRLPAGQ
                     SAGDGPGAVLLTGANGFLGSFILSELISRTNQIVYCVVRGDDDASARRRLDEAAFVNG
                     LGHLCGHPRVRVLRGDLGAPRLGLSDAVWQTLAAEVGAIHHNGAHVNHVYDYPYLHAE
                     NVGSTLELLRLCCSGRRKALHFVSTLSAASATGPTGRLIEAAPSEAGPAFVNNGYNLT
                     KWVSEHLVAEAAARGIDTTILRPGNITGHSRTGLCQPGRNRILLLLKGAVQLGCAPLA
                     SEGGLFDLSPVDYLARAIVACTLDGARTERVFHLHNPRPLDWAGYLRALARRGYPLRF
                     EAPEVWRERLLSIDESNALFDVVAFYLDDRQDDIGDMAVIDHARTEATLRRLGVTYPD
                     KDDALLDAHFGYLAECGFMPPPPEPAPRANDARRDAEPEPAW"
     misc_feature    227408..228610
                     /locus_tag="BCAM0195"
                     /note="HMMPfam hit to PF00501, AMP-binding enzyme, score
                     3.9e-133"
                     /inference="protein motif:HMMPfam:PF00501"
     misc_feature    228857..229057
                     /locus_tag="BCAM0195"
                     /note="HMMPfam hit to PF00550, Phosphopantetheine
                     attachment site, score 2.6e-14"
                     /inference="protein motif:HMMPfam:PF00550"
     misc_feature    229175..229975
                     /locus_tag="BCAM0195"
                     /note="HMMPfam hit to PF01370, NAD dependent
                     epimerase/dehydratase fam, score 2e-05"
                     /inference="protein motif:HMMPfam:PF01370"
     misc_feature    229178..230032
                     /locus_tag="BCAM0195"
                     /note="HMMPfam hit to PF01073, 3-beta hydroxysteroid
                     dehydrogenase/iso, score 0.0028"
                     /inference="protein motif:HMMPfam:PF01073"
     CDS             230379..230867
                     /transl_table=11
                     /locus_tag="BCAM0196"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0196"
                     /db_xref="EnsemblGenomes-Tr:CAR54054"
                     /db_xref="InterPro:IPR019587"
                     /db_xref="InterPro:IPR023393"
                     /db_xref="UniProtKB/TrEMBL:B4EHM8"
                     /protein_id="CAR54054.1"
                     /translation="MLQRTATQPRPSTLVYAPQTPILSGSADLDVPARDAWRVVGDFA
                     GFSRFITGLDHTDMIGEGVRSLRIKHFADGNVVVEQLNSHDDEAMVMTWSLIHTSFDI
                     GNLWALMRVEPRGDHACTVTWDIAGEPSHGGAARQPEFDAFVTGFLDMAMTNLRALFK
                     PQ"
     CDS             complement(230896..231864)
                     /transl_table=11
                     /locus_tag="BCAM0197"
                     /product="LysR family regulatory protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0197"
                     /db_xref="EnsemblGenomes-Tr:CAR54055"
                     /db_xref="GOA:B4EHM9"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="InterPro:IPR036390"
                     /db_xref="UniProtKB/TrEMBL:B4EHM9"
                     /protein_id="CAR54055.1"
                     /translation="MQAFVTLADAGTFTETGKRLGITTAHVSRLVASLEHRLGIRLLN
                     RTTRSMCLTEAGERYLARARDITLAVDASEREARDARVHPHGRLRAHCSASIANHFVI
                     PLIGQFQARYPDVSVDLTLAPHLPKLVRDSYDVAVIAMPSLPSSEQVAIDVGRIRSVL
                     CASPAYLDAHGMPDSPGALVHHRCVQLVAPAYHERIWTLWNGAEAQTVDVDPSMTADV
                     AASLAIAVREGAGIGLLPDFVAAADLRSGALVRVLSDYQAEEIGVFLVYASRQHLDAK
                     TRAWVDFMKAALRDAFAQVHDDACASPAGRKSHAPGKAGAWAGAAA"
     misc_feature    complement(230998..231624)
                     /locus_tag="BCAM0197"
                     /note="HMMPfam hit to PF03466, LysR substrate binding
                     domain, score 1.3e-43"
                     /inference="protein motif:HMMPfam:PF03466"
     misc_feature    complement(231694..231864)
                     /locus_tag="BCAM0197"
                     /note="HMMPfam hit to PF00126, Bacterial regulatory
                     helix-turn-helix, score 6.6e-15"
                     /inference="protein motif:HMMPfam:PF00126"
     misc_feature    complement(231769..231834)
                     /note="Predicted helix-turn-helix motif with score
                     1734.000, SD 5.09 at aa 11-32, sequence
                     GTFTETGKRLGITTAHVSRLVA"
                     /inference="protein motif:helixturnhelix:EMBOSS"
     CDS             complement(232000..232773)
                     /transl_table=11
                     /locus_tag="BCAM0198"
                     /product="AraC family regulatory protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0198"
                     /db_xref="EnsemblGenomes-Tr:CAR54056"
                     /db_xref="GOA:B4EHN0"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR013096"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR018060"
                     /db_xref="InterPro:IPR018062"
                     /db_xref="InterPro:IPR020449"
                     /db_xref="UniProtKB/TrEMBL:B4EHN0"
                     /protein_id="CAR54056.1"
                     /translation="MENFFIALERQARDKQIAVVASDSPAGMAYPPHSHRQGQLIHAI
                     SGVMIVHADAGSWVVPTGRAVWVPGGTQHEIRSAGDVQMRTVFVGPEVRPSLPTECRV
                     IEVGTLLRELIVTACDLPADYDLSHRPGRVLALILDEIEIAPSLSLHVPMPRHPALVA
                     LCTRLINDPSSAVTLQAWARDAHMNERTLARAFKRETGMTHGAWCRHARLLLSLPRLA
                     AGTPILELALEHGYDSPSAFAAMFRKALGVAPSEYFRRR"
     misc_feature    complement(232009..232155)
                     /locus_tag="BCAM0198"
                     /note="HMMPfam hit to PF00165, Bacterial regulatory
                     helix-turn-helix pr, score 7e-06"
                     /inference="protein motif:HMMPfam:PF00165"
     misc_feature    complement(232024..232149)
                     /note="PS00041 Bacterial regulatory proteins, araC family
                     signature."
                     /inference="protein motif:Prosite:PS00041"
     misc_feature    complement(232192..232257)
                     /note="Predicted helix-turn-helix motif with score
                     1603.000, SD 4.65 at aa 173-194, sequence
                     VTLQAWARDAHMNERTLARAFK"
                     /inference="protein motif:helixturnhelix:EMBOSS"
     misc_feature    complement(232357..232728)
                     /locus_tag="BCAM0198"
                     /note="HMMPfam hit to PF02311, AraC-like ligand binding
                     domain, score 0.00094"
                     /inference="protein motif:HMMPfam:PF02311"
     misc_feature    complement(232507..232719)
                     /locus_tag="BCAM0198"
                     /note="HMMPfam hit to PF07883, Cupin domain, score
                     1.1e-06"
                     /inference="protein motif:HMMPfam:PF07883"
     CDS             232941..234377
                     /transl_table=11
                     /locus_tag="BCAM0199"
                     /product="outer membrane efflux protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0199"
                     /db_xref="EnsemblGenomes-Tr:CAR54057"
                     /db_xref="GOA:B4EHN1"
                     /db_xref="InterPro:IPR003423"
                     /db_xref="InterPro:IPR010131"
                     /db_xref="UniProtKB/TrEMBL:B4EHN1"
                     /protein_id="CAR54057.1"
                     /translation="MPHVRRATCAAVLLASAALAACSVGEPYRPPVSDATRTGPFDAV
                     ADVPAAAAGEPPQRWWRLYDDPVLDGLVRDALAQNRDLAAAVARVERARAVFDEAGAA
                     RLPDTTAGFGVDYGKHAPDQIVAAAKGTEARTRWGFAPSFSLSWEVDLWGRVRHLVDA
                     ARADADAVQAASDAMRVVVAAETTAAYAQVCAYGERIDVAEQSVGIADRLAALTAKQR
                     AHGLVSDLEVARSRAFADDTRADLPALVGSRRAALYELAALTGRAPGALPDAAAHCRT
                     APVLARPFPVGDGASLLRRRPDLRESERQLAAANARIGVATAELYPSISLGGSVNWLS
                     TGGDPSTLGDKYAIAWGVGPLITWRFPNMAASRARLAQARADDTLARAQFDAQVLRAL
                     KETEQALARYGAAWRRRAALETARAEHARAYHLAELNYEAGALDFLGVLDAQRSLVAV
                     DSALAESTQQVSLDQVAVFKALGGGWQP"
     sig_peptide     232941..233003
                     /locus_tag="BCAM0199"
                     /note="Signal peptide predicted for BCAM0199 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.389 between residues 21 and 22"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    232974..233006
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     misc_feature    233142..233723
                     /locus_tag="BCAM0199"
                     /note="HMMPfam hit to PF02321, Outer membrane efflux
                     protein, score 5.8e-27"
                     /inference="protein motif:HMMPfam:PF02321"
     misc_feature    233793..234359
                     /locus_tag="BCAM0199"
                     /note="HMMPfam hit to PF02321, Outer membrane efflux
                     protein, score 1.7e-29"
                     /inference="protein motif:HMMPfam:PF02321"
     CDS             234437..235561
                     /transl_table=11
                     /locus_tag="BCAM0200"
                     /product="efflux system transport protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0200"
                     /db_xref="EnsemblGenomes-Tr:CAR54058"
                     /db_xref="GOA:B4EHN2"
                     /db_xref="InterPro:IPR032317"
                     /db_xref="InterPro:IPR039562"
                     /db_xref="UniProtKB/TrEMBL:B4EHN2"
                     /protein_id="CAR54058.1"
                     /translation="MSTTAVPEKAKSARFSRRQLIAAGVVLAVIALAVFGWHWWTVGR
                     FIEGTDDAYVRADVVTVSSRVSGYVAQVAVDDNQPVKRGDVLVRLDDRDYRAKVDDAQ
                     AAVAAAEATLQAEQAAASTLDAQIGQQRSQIAQADADAAAARAEAARRDADATRYKQL
                     LAESAASGQRWEQAHADALKARAELARAGAAVRVQTDQQTVLQRRREQSTAAIAQARA
                     RLAAAQAKLALAQLDLDHTVIRATRDGSIGQRAVRAGQYVEVGMPLLAVVPLSDVYVV
                     ANFKETQLGAMHDGQPVEIDVDTYSGHTLHGRVIGLAPGSGAQFALLPPDNATGNFTK
                     IVQRIPVKIRVDAPPAGVVLRPGMSVIARVDTRGTQEAGT"
     sig_peptide     234437..234535
                     /locus_tag="BCAM0200"
                     /note="Signal peptide predicted for BCAM0200 by SignalP
                     2.0 HMM (Signal peptide probability 0.712) with cleavage
                     site probability 0.584 between residues 33 and 34"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    234494..234562
                     /locus_tag="BCAM0200"
                     /note="1 probable transmembrane helix predicted for
                     BCAM0200 by TMHMM2.0 at aa 20-42"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    234605..235522
                     /locus_tag="BCAM0200"
                     /note="HMMPfam hit to PF00529, HlyD family secretion
                     protein, score 1.6e-44"
                     /inference="protein motif:HMMPfam:PF00529"
     misc_feature    234620..234646
                     /note="PS00850 Glycine radical signature."
                     /inference="protein motif:Prosite:PS00850"
     CDS             235558..237141
                     /transl_table=11
                     /locus_tag="BCAM0201"
                     /product="Major Facilitator Superfamily protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0201"
                     /db_xref="EnsemblGenomes-Tr:CAR54059"
                     /db_xref="GOA:B4EHN3"
                     /db_xref="InterPro:IPR001411"
                     /db_xref="InterPro:IPR004638"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="UniProtKB/TrEMBL:B4EHN3"
                     /protein_id="CAR54059.1"
                     /translation="MSTTTAQAAHEDTVSLRAWVAVLGGVFGCFMAGMNVHVTNASLP
                     DIRGSLGASFEEGSWITTAYLVAEIVVIPLTGWLVQVFSARRVLLVGATGFLAFSLAC
                     SVAPSISTMIIARALQGAFGGVLIPLSFQLIVTELPPSKHPLGMALFAIANNVAQAAG
                     PSVGGWLTDMYSWRWIFYLQIPPAIALVAAIGWAIRPVPVQLGMLRRADWFGIATMAV
                     GLSALQIVLEEGGRKDWFASDLIVELSIVAALGLAAFVAIELRRKEPFINLRLLGRYN
                     FGIASLMQFLFGAVVFGVVFLVPNYFAELHGYSARDIGLAMIPYGLVQFAMSFLTPPL
                     MRRTSPRTTIVLGFVLVAAGCLMNIHLDADAASNVIVPSLIVRGVGQSFVVIALAVMA
                     VDGIEKAQLGSASGVFNMVRNVGGAIGIAVMSQIVVERQKLHAMRIGEAVTPFSEAFQ
                     ERMAMLARLLARVHAPRADVLPGGSISGVHELALGLVNQRVMREALLMAYSDTFLIAG
                     IAMIGCTAAAFVLKGKKKA"
     misc_feature    join(235600..235668,235726..235794,235804..235872,
                     235891..235959,235987..236055,236074..236142,
                     236185..236238,236275..236331,236389..236457,
                     236494..236553,236581..236640,236677..236745,
                     236773..236841,237046..237114)
                     /locus_tag="BCAM0201"
                     /note="14 probable transmembrane helices predicted for
                     BCAM0201 by TMHMM2.0 at aa 15-37, 57-79, 83-105, 112-134,
                     144-166, 173-195, 210-227, 240-258, 278-300, 313-332,
                     342-361, 374-396, 406-428 and 497-519"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    235612..235644
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     misc_feature    235630..236841
                     /locus_tag="BCAM0201"
                     /note="HMMPfam hit to PF07690, Major Facilitator
                     Superfamily, score 1.9e-56"
                     /inference="protein motif:HMMPfam:PF07690"
     misc_feature    235831..235863
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     misc_feature    236590..236622
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     misc_feature    237067..237099
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     CDS             237309..238340
                     /transl_table=11
                     /locus_tag="BCAM0202"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0202"
                     /db_xref="EnsemblGenomes-Tr:CAR54060"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:B4EHN4"
                     /protein_id="CAR54060.1"
                     /translation="MPPAFPTVLLPMLRIPTLFVAVVLSFAVLPAAHAADHARWPTAF
                     GGQPRVGVQVKIQSFTPDDARQIRQTGFDFVRFGVWTDRLDRADYRRQIDDAFAAARS
                     ARLPVLLTVRTLTRFRRVDWQREEAQVDRESLAATGARLAGTVTRLAAQYSHALVALE
                     LWNEPDLDRYWPTGDVAHTFPPFAEGLCGGLAARRPDVPVVGFGFARPPLPGSVPDRL
                     LADVYAASPACLDAVSYHAYGMTPMQIRDAARDIRARYGLSALVTEDGAASAGVDGDA
                     RQARRVRTLLDARATLGTPLLSIYEWIDTPKANDAVQRSYGLVRADRSPKLALDAAST
                     SLRATTSKP"
     misc_feature    237777..237806
                     /note="PS00659 Glycosyl hydrolases family 5 signature."
                     /inference="protein motif:Prosite:PS00659"
     CDS             complement(238348..239397)
                     /transl_table=11
                     /locus_tag="BCAM0203"
                     /product="putative membrane protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0203"
                     /db_xref="EnsemblGenomes-Tr:CAR54061"
                     /db_xref="GOA:B4EHN5"
                     /db_xref="UniProtKB/TrEMBL:B4EHN5"
                     /protein_id="CAR54061.1"
                     /translation="MLRKLIASGPLLSRGLRDAIAACLALLYVGVYANARVLLPEFIF
                     RDADKIQTQIGGGSTYDGSSFDAVGKLYQALGGAGTAVFVVALGIATIWIALRATRRL
                     GALVAHLALIAPCLFFNLFVASKDTLVVAMSIAVLAVARVRGPAGAMPIAVMLYLGYA
                     ATIRSYFALIVAIALAAWVWRRVSTLPRLAGALLVVAVLVALPNAAYSLLQQPRDLAV
                     DYLMYASPFGARTSFYNPFPPDSFVHFAGNYSYSFVRLNLPVLFSFDPKGFAMQALVA
                     LFLGAAWRRVPSQRSGERTTGLRRNGELLACLLLGHVAVSMLFEPDLGSYLRHLSSVA
                     PFAVALWAIRTRDPN"
     misc_feature    complement(join(238768..238836,238864..238932,
                     238966..239019,239032..239091,239110..239178,
                     239281..239340))
                     /locus_tag="BCAM0203"
                     /note="6 probable transmembrane helices predicted for
                     BCAM0203 by TMHMM2.0 at aa 5-24, 59-81, 88-107, 112-129,
                     141-163 and 173-195"
                     /inference="protein motif:TMHMM:2.0"
     sig_peptide     complement(239293..239352)
                     /locus_tag="BCAM0203"
                     /note="Signal peptide predicted for BCAM0203 by SignalP
                     2.0 HMM (Signal peptide probability 0.965) with cleavage
                     site probability 0.751 between residues 20 and 21"
                     /inference="protein motif:SignalP:2.0"
     CDS             complement(239387..240682)
                     /transl_table=11
                     /locus_tag="BCAM0204"
                     /product="putative polysaccharide biosynthesis transporter
                     protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0204"
                     /db_xref="EnsemblGenomes-Tr:CAR54062"
                     /db_xref="GOA:B4EHN6"
                     /db_xref="InterPro:IPR002797"
                     /db_xref="UniProtKB/TrEMBL:B4EHN6"
                     /protein_id="CAR54062.1"
                     /translation="MKAASSRLALRVGALGLKFVLTIVVARTLGFDAVAVYGVALAVS
                     VVASKVLGLGFSTEINRRLAGPDPRDAIRTCMRLSVLYAGVYVALCGAAALPVGAFIG
                     LPRAGALADVPLVLVMLVACAEHAALEVNTWLFSLHRVRAASWVLFARTGAWAGVALA
                     ALAARAIVSIDGVFAIWLAGDALVVALGWLLIAGTARRLPAMPALSATRLPLATVWRS
                     GAPFFVALLLLSVLQYLERFVASAMLDAGELGRYVFVWSIANAIQTIASATVAAVAAP
                     RLVRALDCPRRAPQAFRGELAHALRGSVILTGAAALAIVTVHPWLFRLAHEGNDLPST
                     VILAILLLSFVLRAACDVLWAAAVALRAGRVVAGVMAVLTLACVPMTIALVHDQHAIG
                     AAIAHLVASIAVAAWLVWIVSSRAPTARRAIRPGAADAA"
     misc_feature    complement(join(239447..239515,239528..239596,
                     239615..239683,239726..239794,239855..239923,
                     239981..240040,240098..240166,240179..240247,
                     240272..240340,240383..240451,240518..240586,
                     240596..240664))
                     /locus_tag="BCAM0204"
                     /note="12 probable transmembrane helices predicted for
                     BCAM0204 by TMHMM2.0 at aa 7-29, 33-55, 78-100, 115-137,
                     146-168, 173-195, 215-234, 254-276, 297-319, 334-356,
                     363-385 and 390-412"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    complement(239552..239584)
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     misc_feature    complement(240317..240349)
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     CDS             complement(240679..241842)
                     /transl_table=11
                     /locus_tag="BCAM0205"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0205"
                     /db_xref="EnsemblGenomes-Tr:CAR54063"
                     /db_xref="InterPro:IPR007345"
                     /db_xref="UniProtKB/TrEMBL:B4EHN7"
                     /protein_id="CAR54063.1"
                     /translation="MSRPVHVALLHAYSARNSGDGLLVELSVALLRGAFGTDTRVSVV
                     AADPASFPDQPDVRPAPVLAAGGAGRLIGAAMAALPVGANPALADLRGLLKQADLIVG
                     VGGGYLRARNSVEALKLEAGHLVQMRAARAARKPAVYLPQSIGPAAGNTMLAGHLTSL
                     LAGFHTVFVRDDRSMALLAANPNTRRAPDLAVLEFGRRAAGLRKHAHVPPAHPGHIAL
                     VLRRPPAWSAAQCARYHAQTEALVERLGAFCRITFAVQSTGRGNDDAAYYRERGFDDT
                     RTLKDVLAGDTPDAVVSVRLHGALESILHGVPAYHLSYERKGFGAYADLGVGHWVANA
                     ADFDANAVCDTLFAPDALRRFWTQTDTGIARLGRERDRIVAALRAALHHGAAR"
     CDS             complement(241842..243065)
                     /transl_table=11
                     /locus_tag="BCAM0206"
                     /product="glycosyltransferase"
                     /note="Similar to Rhizobium meliloti (Sinorhizobium
                     meliloti) putative glycosyltransferase protein.
                     UniProt:Q92QS8 (414 aa) fasta scores: E()=1.1e-31, 35.092%
                     id in 379 aa; homology does not extend to far N and C
                     termini"
                     /db_xref="EnsemblGenomes-Gn:BCAM0206"
                     /db_xref="EnsemblGenomes-Tr:CAR54064"
                     /db_xref="GOA:B4EHN8"
                     /db_xref="InterPro:IPR028098"
                     /db_xref="UniProtKB/TrEMBL:B4EHN8"
                     /protein_id="CAR54064.1"
                     /translation="MSDIAFAPSLDERASLQPDTNPPAPSATAAPPLRIALVVEAAGG
                     GVAVHLTDLIAGLHARGHAEIHLIAPLGERFDDAMLAGAAAQCTTFHRLPLRRSVGAH
                     DLRGAIALRRLLRRIRPDIVHSHSSKAGALARLCRGPWKQVYTPHAVYTLNPTLSPAK
                     RAFYGGVERVLGNACSDAVIAVSQDEADHLHTLGIARDRIRLVENGVTPPMLLARQAA
                     RIALGLADHPFVVGFVGRFDHQKGVDRLVRIARVLDECFGNRVQVVAIGSGDFDQAAG
                     DEAHDLPANLRIAGRVDSARRYFSAFDLLALPSRYEGFPYVCLEAVAAQVPIVATQVS
                     GATELIAGHRVGLTVSNSDDPAAFASMVGRLVEHPASHRLMREQCARAYPHFSADAMV
                     DRTLAVYRDLLRENA"
     misc_feature    complement(241917..242423)
                     /locus_tag="BCAM0206"
                     /note="HMMPfam hit to PF00534, Glycosyl transferases
                     group, score 1.9e-24"
                     /inference="protein motif:HMMPfam:PF00534"
     CDS             complement(243062..245335)
                     /transl_table=11
                     /locus_tag="BCAM0207"
                     /product="putative tyrosine-protein kinase"
                     /EC_number="2.7.1.112"
                     /db_xref="EnsemblGenomes-Gn:BCAM0207"
                     /db_xref="EnsemblGenomes-Tr:CAR54065"
                     /db_xref="GOA:B4EHN9"
                     /db_xref="InterPro:IPR003856"
                     /db_xref="InterPro:IPR005700"
                     /db_xref="InterPro:IPR005702"
                     /db_xref="InterPro:IPR025669"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR032807"
                     /db_xref="UniProtKB/TrEMBL:B4EHN9"
                     /protein_id="CAR54065.1"
                     /translation="MTSSASPEHEIDLIRVLDVLRQARWTIASITAACVAAGALYAFV
                     APPTYQADLMIQTDDATDAASKNLLGDAASFFNVASPASAEAQILSSRLVVTRAVEDL
                     RAYIVATPARVPVIGAFVARFNDGAVKPGLFGFGGYAWGQERIDVVRFDVPTRAEGDT
                     FQVVRLDNTRYRLTGADMKADAIGTIGRTETFDTRYGPLHIDIIGFDALPGTRFQLVR
                     QSRAETIDTLRTALDVQEKVKQSGVLVASLRGDDPVDISATLNAIANRYIEQNIARRT
                     AEAAQSLAFLNAQLPIVKGQLERAETRYARLRSRTGSVDLEEEGKVVLQQGADLQTRL
                     LELQQKHDELSRRFLPTHPDMAALDAQLATLKRQQGALDARIARLPAQQSEEVRARLD
                     VKVNADLYTALLNNTQQLELVQAGRTASVRVVDAAVAPADPVRPNRPVVIAAAALAGL
                     ALGLIAAFAREFLYGGLTAVDEIERHTSLPVRAVLPAAARQRKLMRAVERHDAGLHVL
                     AYDDPYEPAIEGLRSLQTALHFALADRAHPLVLVTGPAPGTGKSFVSVNLAAVHAASG
                     RRVLLIDGDLRKGYLHQYFGLERGAGFAALLAGHAHADNAIRRNVAPNLDFLPTGELP
                     SAPTALLQQAGLGALLASLRARYDLVIVDSAPLLAATDSTWLGAHADATLLVARAGST
                     RAGELVEAAKRLPQRPDAQPGVVLNGLDPRTGASAFGSKYGGYRYEAYRYTCNTRRCT
                     HLARLRAALQRLLRRSA"
     misc_feature    complement(243548..243571)
                     /note="PS00030 Eukaryotic putative RNA-binding region
                     RNP-1 signature."
                     /inference="protein motif:Prosite:PS00030"
     misc_feature    complement(join(243959..244018,245201..245269))
                     /locus_tag="BCAM0207"
                     /note="2 probable transmembrane helices predicted for
                     BCAM0207 by TMHMM2.0 at aa 23-45 and 440-459"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    complement(244538..245311)
                     /locus_tag="BCAM0207"
                     /note="HMMPfam hit to PF02706, Chain length determinant
                     protein, score 9.8e-38"
                     /inference="protein motif:HMMPfam:PF02706"
     CDS             complement(245332..245838)
                     /transl_table=11
                     /locus_tag="BCAM0208"
                     /product="putative protein-tyrosine-phosphatase (low
                     molecular weight)"
                     /EC_number="3.1.3.48"
                     /db_xref="EnsemblGenomes-Gn:BCAM0208"
                     /db_xref="EnsemblGenomes-Tr:CAR54066"
                     /db_xref="GOA:B4EHP0"
                     /db_xref="InterPro:IPR017867"
                     /db_xref="InterPro:IPR023485"
                     /db_xref="InterPro:IPR036196"
                     /db_xref="UniProtKB/TrEMBL:B4EHP0"
                     /protein_id="CAR54066.1"
                     /translation="MPTPPPFLLAVCEGNVCRSPLAAALLAAKLPHARTGSAGLAPPN
                     GRPADPLARDMAAARGLNLDAHAARPVTAALCAQADLIFVMDGGQRRALEARHPFLRG
                     RVFRLGEYARIADGAPLGLDIPDPYRGTRDDFVRCAALIDLAVGSWLPRLAARWPHIT
                     ASFSGFQS"
     misc_feature    complement(245386..245823)
                     /locus_tag="BCAM0208"
                     /note="HMMPfam hit to PF01451, Low molecular weight
                     phosphotyrosine protein, score 5.2e-32"
                     /inference="protein motif:HMMPfam:PF01451"
     CDS             complement(245838..246986)
                     /transl_table=11
                     /locus_tag="BCAM0209"
                     /product="putative capsular polysaccharide transport
                     protein"
                     /note="Similar to Ralstonia solanacearum (Pseudomonas
                     solanacearum) EPS I polysaccharide export outer membrane
                     protein EpsA precursor UniProt:EPA2_RALSO (377 aa) fasta
                     scores: E()=4.9e-43, 43.490% id in 361 aa; homology does
                     not extend to N terminus"
                     /db_xref="EnsemblGenomes-Gn:BCAM0209"
                     /db_xref="EnsemblGenomes-Tr:CAR54067"
                     /db_xref="GOA:B4EHP1"
                     /db_xref="InterPro:IPR003715"
                     /db_xref="InterPro:IPR019554"
                     /db_xref="UniProtKB/TrEMBL:B4EHP1"
                     /protein_id="CAR54067.1"
                     /translation="MNTSYLGWLADTPDDGAPAPASADSRAAEARAAAASTMAGTPVR
                     AQSTGVDSAATPPIVDIEPSLIARQRAARDAAAASFDTPAASRAPSAYRIGPGDVLQI
                     TVWDHPELAAAQGGAQQTPPRTADPVAGFVVDDLGNLTFPYAGALKVAGLTAAEAQAR
                     LKQALGKIYRDPQVTLRVASFRSQQVYVDGEVHTPGALPVNDVPMTLADAIARAGGFT
                     PGADQSDVTIVRDGTPVRIDLARLIERHRDPSRIVLRSGDLLRVGARDSNGVYVMGEV
                     NRPTLALPKRDGRLTLSDALLQAGSINSNTADAAQMFVIRGAQGRTPTVFHLDARSPV
                     AMVLANQFELEPKDIVYVDGNGLVRISRVLSLLLPSVNTGVAAGIATK"
     misc_feature    complement(246333..246746)
                     /locus_tag="BCAM0209"
                     /note="HMMPfam hit to PF02563, Polysaccharide
                     biosynthesis/export protei, score 1.7e-39"
                     /inference="protein motif:HMMPfam:PF02563"
     CDS             complement(247226..248617)
                     /transl_table=11
                     /locus_tag="BCAM0210"
                     /product="putative transferase"
                     /note="Similar to Escherichia coli WcaJ putative colanic
                     biosynthesis UDP-glucose lipid carrier transferase
                     UniProt:WCAJ_ECOLI (EMBL:ECD842) (464 aa) fasta scores:
                     E()=2.8e-47, 39.348% id in 399 aa; homology does not
                     extend to the N terminus"
                     /db_xref="EnsemblGenomes-Gn:BCAM0210"
                     /db_xref="EnsemblGenomes-Tr:CAR54068"
                     /db_xref="GOA:B4EHP2"
                     /db_xref="InterPro:IPR003362"
                     /db_xref="InterPro:IPR017473"
                     /db_xref="InterPro:IPR017475"
                     /db_xref="UniProtKB/TrEMBL:B4EHP2"
                     /protein_id="CAR54068.1"
                     /translation="MNKKHGPRSEIVVCMVDVAAIVAIAVLTHHDSLWNLDALAIEWL
                     LIGVSALLGAFLLRLAGIGLDGRPRPATRYAVRTLALWLVVQGFVFLKMIALTTATVM
                     MLTWFFDWTIEVGIVLAVFRIALSIARRRSLRVPATPARIAVVGNGERIARIVASLAA
                     AGTPRYRLVSAYSTGGRAMTLAGDALVTTDLASFAACARRQHADEVWIALPLAEDASI
                     TRVIDKFRSDFVELRLMPDVSQHALFGSQVDEILGEPAISLAAPPLSRGALCVKAVFD
                     RAFAAAVLIVLMPLLLVIAAAIKLSSPGPVMFTQKRRGGDGRTFDIYKFRTMRVHVGQ
                     PGKVEQATRNDPRVTKVGAFLRRTSLDELPQFVNVLFGDMSVVGPRPHAVEHDAQYRT
                     LVDGYIHRYRIKPGITGWAQVNGLRGATEQLESMQSRVEYDLYYLRNWSFALDLRIIG
                     ATVLKGIVHPNAY"
     misc_feature    complement(247229..247804)
                     /locus_tag="BCAM0210"
                     /note="HMMPfam hit to PF02397, Bacterial sugar
                     transferase, score 2e-29"
                     /inference="protein motif:HMMPfam:PF02397"
     misc_feature    complement(join(247724..247783,248243..248302,
                     248330..248398,248435..248503,248531..248584))
                     /locus_tag="BCAM0210"
                     /note="5 probable transmembrane helices predicted for
                     BCAM0210 by TMHMM2.0 at aa 12-29, 39-61, 74-96, 106-125
                     and 279-298"
                     /inference="protein motif:TMHMM:2.0"
     CDS             complement(248852..249754)
                     /transl_table=11
                     /locus_tag="BCAM0211"
                     /product="conserved hypothetical protein"
                     /note="Similar to central region of Bacillus cereus
                     (strain ATCC 14579/DSM 31) hypothetical protein.
                     UniProt:Q81DW8 (384 aa) fasta scores: E()=2.9e-18, 30.403%
                     id in 273 aa"
                     /db_xref="EnsemblGenomes-Gn:BCAM0211"
                     /db_xref="EnsemblGenomes-Tr:CAR54069"
                     /db_xref="UniProtKB/TrEMBL:B4EHP3"
                     /protein_id="CAR54069.1"
                     /translation="MDYNLCIVRPPGYAHSGAFTELAEVIAYGLDDLGHLVHVNENNM
                     MPDVRNILIGCHLADPDMTAHVPDDTIVVNTEQLHVDEQPWNRNIYRWASRYETWDYS
                     ERNLAKLHSLGIGHARYLKLGFHPKLRRIPADVEQDIDVLFYGTIGPRRATILDALRA
                     RGLNVGIVSGGLYGAEREAFITRTKVVLNLHHYASHIFEVVRAFYLMTNGKAIVGEVS
                     PTTSVDPDYADGFRAAPYDALVDACIELVRDSAQRRRLEAAALATIGRHPQARSLAPL
                     LAPQADAVATAFREHAFTACSQAV"
     CDS             complement(249782..251356)
                     /transl_table=11
                     /locus_tag="BCAM0212"
                     /product="conserved hypothetical protein"
                     /note="Similar to Ralstonia solanacearum (Pseudomonas
                     solanacearum) rs00434 hypothetical protein rsc3164.
                     UniProt:Q8XUM3 (387 aa) fasta scores: E()=4.8e-19, 35.455%
                     id in 330 aa; homology does not extend to N terminus"
                     /db_xref="EnsemblGenomes-Gn:BCAM0212"
                     /db_xref="EnsemblGenomes-Tr:CAR54070"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="UniProtKB/TrEMBL:B4EHP4"
                     /protein_id="CAR54070.1"
                     /translation="MQITSHDTPAFADTDDTMLAALANAASLGIDDAAVATATQTLIE
                     RGAADRAARLAAAHWDLRPDSPAAAFNCGYAMQMAGRHADAIAPYRHTLELAPAWPSL
                     KNNLALAIRLTGGDPEVEFALIEGALDDAPDDARAWTNAVITRIDRFDLDGALRAATR
                     AVSLAPDSALAVNNAATAMKEAQWWGQAERHAQRAVELAPHNPTYRHNVSLLQLARGD
                     FASGWPNYEARWDGSAELRGNLPAFAGPRWRGESLRGKTLLLWGEQGLGDALQFCRYV
                     PLLAERVHREGGRIVWNAFPVMGDLFGRSLARHVDVFDTSMRIEDLPAFDVELPLMSI
                     PGMLGLDGDALATTVPYLHADASATDAWRTALAAEKRLKVGLAWTGSLSHQRNRFRRV
                     GLERYAEAFGGLQQDVAFYSLQPGAQHDIEAARSAGFVVNDCTRDWRTIDDTAAFVGA
                     LDLVITVCTSAAHLSGALGQRTWVLLDANPHWVWQHERRDSPFYPSALLYRQKTFAQW
                     QPVMDAVAADLRRLAG"
     misc_feature    complement(250586..250609)
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
                     /inference="protein motif:Prosite:PS00017"
     CDS             251708..252022
                     /transl_table=11
                     /locus_tag="BCAM0213"
                     /product="putative membrane protein"
                     /note="N terminus is similar to N terminus of Brucella
                     melitensis chloride channel protein. UniProt:Q8YFS5 (555
                     aa) fasta scores: E()=4.9, 32.877% id in 73 aa"
                     /db_xref="EnsemblGenomes-Gn:BCAM0213"
                     /db_xref="EnsemblGenomes-Tr:CAR54071"
                     /db_xref="GOA:B4EHP5"
                     /db_xref="UniProtKB/TrEMBL:B4EHP5"
                     /protein_id="CAR54071.1"
                     /translation="MSAADFLVKGTVIGMVASAATVGMVHVVVEFGTRWSSSGMVVTM
                     ASALLMAMLLLVPPLVDAWRNRKDVVDPFYEPAALKPMLQGRTIGIVVGIVFGVSIVT
                     GW"
     misc_feature    join(251735..251794,251828..251896,251954..252013)
                     /locus_tag="BCAM0213"
                     /note="3 probable transmembrane helices predicted for
                     BCAM0213 by TMHMM2.0 at aa 10-29, 41-63 and 83-102"
                     /inference="protein motif:TMHMM:2.0"
     CDS             252025..252825
                     /transl_table=11
                     /locus_tag="BCAM0214"
                     /product="putative glycosyltransferase"
                     /note="Similar to C terminus of Rhizobium loti
                     (Mesorhizobium loti) mll0582 protein. UniProt:Q98MH1 (931
                     aa) fasta scores: E()=1.7e-15, 27.925% id in 265 aa"
                     /db_xref="EnsemblGenomes-Gn:BCAM0214"
                     /db_xref="EnsemblGenomes-Tr:CAR54072"
                     /db_xref="GOA:B4EHP6"
                     /db_xref="InterPro:IPR002654"
                     /db_xref="UniProtKB/TrEMBL:B4EHP6"
                     /protein_id="CAR54072.1"
                     /translation="MSMPVTDRTDADMVHVNAPGIDAPTVCKTLCVISLRGERGRRDA
                     FRANNPALAFEFVDAIDGRALSDDDIARSGLFAPALPYTRGAIGIAMTTHRLWTDIAA
                     GNELVTIVEDDAIFRPDFDETAMQFLAAHANRYDFVAWGYNFDSILRGAIFNGRTPVT
                     MRFDEAALAQAVDEFRTDRGPVLVMDLLEFYGICAYTISPAGARFLLDHCFPLQPETL
                     FSHGLGRALPNYGIDVAMNKFYGAMRSVAAFPPLAVTMNARATSTIQR"
     misc_feature    252103..252681
                     /locus_tag="BCAM0214"
                     /note="HMMPfam hit to PF01755, Glycosyltransferase family
                     25 (LPS bi, score 1.2e-05"
                     /inference="protein motif:HMMPfam:PF01755"
     CDS             253360..254202
                     /transl_table=11
                     /gene="RS04811"
                     /locus_tag="BCAM0215"
                     /product="putative peptidylprolyl isomerase"
                     /db_xref="EnsemblGenomes-Gn:BCAM0215"
                     /db_xref="EnsemblGenomes-Tr:CAR54073"
                     /db_xref="GOA:B4EHP7"
                     /db_xref="InterPro:IPR000297"
                     /db_xref="InterPro:IPR027304"
                     /db_xref="UniProtKB/TrEMBL:B4EHP7"
                     /protein_id="CAR54073.1"
                     /translation="MKKHHISIVSTLIALACACGAPVARAAGTKTDTPLPPGVEAVVN
                     DTPIARSDVDSMIEATGQTVTPELRAQAKRELIAQHLVEQAAEKANYGSRPEVNRVVM
                     RARTVAATDLYLRDNVHPQAVTDAQVKARYDDIVANAAQFEYRADVIAVADPAEVNAL
                     VAELKQGAAFDAVAKKYNTTPNGGVAQWVELRTPVAEGKTGGLPLPLAQAITSLQPGA
                     VAGPIRVGNAFAIVKLDEKRATVVPTFEAAKNVLRQQLEGQAQQRAMTALVDKLAGQA
                     TIQQ"
     sig_peptide     253360..253437
                     /gene="RS04811"
                     /locus_tag="BCAM0215"
                     /note="Signal peptide predicted for BCAM0215 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.935 between residues 26 and 27"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    253378..253446
                     /gene="RS04811"
                     /locus_tag="BCAM0215"
                     /note="1 probable transmembrane helix predicted for
                     BCAM0215 by TMHMM2.0 at aa 7-29"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    253378..253410
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     misc_feature    253804..254067
                     /gene="RS04811"
                     /locus_tag="BCAM0215"
                     /note="HMMPfam hit to PF00639, PPIC-type PPIASE domain,
                     score 6.5e-05"
                     /inference="protein motif:HMMPfam:PF00639"
     CDS             complement(254723..255043)
                     /transl_table=11
                     /locus_tag="BCAM0216"
                     /product="conserved hypothetical protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0216"
                     /db_xref="EnsemblGenomes-Tr:CAR54074"
                     /db_xref="GOA:B4EHP8"
                     /db_xref="InterPro:IPR010982"
                     /db_xref="InterPro:IPR039554"
                     /db_xref="UniProtKB/TrEMBL:B4EHP8"
                     /protein_id="CAR54074.1"
                     /translation="MNRDASYQHTDCTPTDSGFDDAGELSAKSALVLKLNALIASQGL
                     SDEEAAALADMARPVVTPEQRERLRNVSLDLLMRALVSFGQQVEIVVRPAGSSRLAGI
                     TVSV"
     CDS             complement(255040..255381)
                     /transl_table=11
                     /locus_tag="BCAM0217"
                     /product="conserved hypothetical protein"
                     /note="Similar to Yersinia pestis hypothetical protein
                     UniProt:Q8CLT6 (74 aa) fasta scores: E()=1.1, 38.596% id
                     in 57 aa; homology does not extend to N- and C-termini"
                     /db_xref="EnsemblGenomes-Gn:BCAM0217"
                     /db_xref="EnsemblGenomes-Tr:CAR54075"
                     /db_xref="GOA:B4EHP9"
                     /db_xref="InterPro:IPR014944"
                     /db_xref="UniProtKB/TrEMBL:B4EHP9"
                     /protein_id="CAR54075.1"
                     /translation="MANANHSAPTFFQDCFVHSHESFQTRRIFPRLRFAETAPPVFHL
                     WMKLSGRWIEEAGFEPEQRLQIEVTHQRLVITPIAEEGRDCFGKDERPDVDPATGQAL
                     RQLAAMTGNAQ"
     CDS             complement(255662..258694)
                     /transl_table=11
                     /locus_tag="BCAM0218"
                     /product="hybrid two-component system kinase-response
                     regulator protein"
                     /note="C terminus is similar to C terminus of Rhodobacter
                     sphaeroides (Rhodopseudomonas sphaeroides) dors
                     dmso/tmao-sensor kinase. UniProt:O30740 (815 aa) fasta
                     scores: E()=1.9e-36, 33.663% id in 505 aa"
                     /db_xref="EnsemblGenomes-Gn:BCAM0218"
                     /db_xref="EnsemblGenomes-Tr:CAR54076"
                     /db_xref="GOA:B4EHQ0"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR008207"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="InterPro:IPR035965"
                     /db_xref="InterPro:IPR036097"
                     /db_xref="InterPro:IPR036641"
                     /db_xref="InterPro:IPR036890"
                     /db_xref="UniProtKB/TrEMBL:B4EHQ0"
                     /protein_id="CAR54076.1"
                     /translation="MPIRHLFASHTDASEPFASIDDDARDLSLLNRYQRFTLYGGAVV
                     LSLVILIAAGILLVGSVRDYITERRDLFLTHKALVQLEMDAKQASMRRAVINAELLWN
                     GHPPHAREASDALRKDGHVLLAPMRGVSEIFLAASPDALANDETDRYVQLMERQTISV
                     AAAERQTGRAVRGYAYSPDRNVIAITPPPSMPYPDLLAHIGVPDTHALIQHLAFDVAD
                     WSNPAIARYWRLSRRIAWQAPAIDPLTGKTVFRLVEPAFDGQKHFMTFVSDFDVDVIA
                     DRLRHAPEDAVAMLVDQHGRVVLDVDRTDNSEDGAALMKHALAEGTWRRGLVNFDESY
                     RHGVFTITDRISDTGYAIVYAYSWHTIAYAIWATMLREFGTIATILIVLWTLVIAFDL
                     RVFAPLFRRSRRVFESERMSRTIVATAPFGIGLVSPDTHQVLLRNRMLELYDREAGAP
                     PLHERLLARYREHADASPAQLDVELPVTLDDGRTRDLLVNFVRVRYKGKDALLCSFSD
                     ITTRADAQRALDSANRAKSTFLATISHEIRTPLNAMLGNLELLDKAPDPSRQKPRLHA
                     VTSAARMLLDMLNNVLDMTKIEADRMTLEATGFRIDELMRDVADLFEPVAGARGIALR
                     IDVDPAVTHTYLGDPMRVRQIAVNLVSNAIKFTDRGAVALSVSASGGGATPVTIRVSD
                     SGIGMTADQLAHVFEPFAQADESIARRFGGTGIGLALSYKLAESMGGRIEADSVPGVG
                     STFVVTLPLPLDRQPGALRSRADGDAPNARVLFVDDNPVNRSLIHDQLDVLGYQADVA
                     SNVAEALDLVDRHDYAVVLTDLNMPGLDGYAFARVLRERGRVQPILAVTAHAEPDELK
                     LAWEAGIDEIVTKPTSLKSLEQAITKHAGTWRRPVHPPVPSRAAGPLPKDLHTVLVDA
                     TRRSNAAIARALQDGDLKVARSEIHSMRGAFAMIGERDISGLCASIEALALAGDAAAF
                     AREFERYRQSASEILARRAASDAKQAADTFSNTSVMKR"
     misc_feature    complement(255728..255979)
                     /locus_tag="BCAM0218"
                     /note="HMMPfam hit to PF01627, Hpt domain, score 2.3e-06"
                     /inference="protein motif:HMMPfam:PF01627"
     misc_feature    complement(256052..256390)
                     /locus_tag="BCAM0218"
                     /note="HMMPfam hit to PF00072, Response regulator receiver
                     domain, score 2.3e-29"
                     /inference="protein motif:HMMPfam:PF00072"
     misc_feature    complement(256445..256786)
                     /locus_tag="BCAM0218"
                     /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
                     gyrase B-, and HS, score 3.3e-41"
                     /inference="protein motif:HMMPfam:PF02518"
     misc_feature    complement(256925..257122)
                     /locus_tag="BCAM0218"
                     /note="HMMPfam hit to PF00512, His Kinase A
                     (phosphoacceptor) domain, score 2.7e-20"
                     /inference="protein motif:HMMPfam:PF00512"
     misc_feature    complement(join(257510..257578,258518..258586))
                     /locus_tag="BCAM0218"
                     /note="2 probable transmembrane helices predicted for
                     BCAM0218 by TMHMM2.0 at aa 37-59 and 373-395"
                     /inference="protein motif:TMHMM:2.0"
     CDS             259169..268030
                     /transl_table=11
                     /locus_tag="BCAM0219"
                     /product="putative haemagglutinin-related autotransporter
                     protein"
                     /note="Contains many Hep_Hag repeats and haemagglutinin
                     motifs"
                     /db_xref="EnsemblGenomes-Gn:BCAM0219"
                     /db_xref="EnsemblGenomes-Tr:CAR54077"
                     /db_xref="GOA:B4EHQ1"
                     /db_xref="InterPro:IPR005594"
                     /db_xref="InterPro:IPR008635"
                     /db_xref="InterPro:IPR008640"
                     /db_xref="InterPro:IPR011049"
                     /db_xref="InterPro:IPR024973"
                     /db_xref="UniProtKB/TrEMBL:B4EHQ1"
                     /protein_id="CAR54077.1"
                     /translation="MNKSYRTVWNATTGTWTAAAETARMRTKSKSNSAMRSSVTAAVA
                     VMAGVGGGAMSADANAQAANGNGSLTLCTPGGSGGYYGSVFGGGSISGTRLTGCGAAV
                     STFRLSEGHVRSFQLYNNSAANGSGAGQASAATEAGISGTVDGHLFLLGGSGVHLRGP
                     VDVDSNVDMTNHRINNLAAGTAGTDAVNVNQLNTAIANAKAADNPYIKIIGSAAGISD
                     TAASASSGSVAMGRGAVAGAVYTTAIGNDSHANGQSSTAVGVTSSASGSQSVVVGNST
                     FAGNQGTAIGYGANARGTNAAALGTRAAASGGDSLALGTNASAAGTGAVALGYGSEAT
                     RNNTVSVGKTGAERQIANVAAGTQGTDAVNLNQLNTAIAGVKTSDNPYVKIVGNTAAE
                     ASGMGSVSIGSGSVARSGSSGGNIAIGNGATADTSGGGYGTMALGYGAKAGTSGYSGG
                     MAIGLGANSTHGNVAIGDGAQASGKAGDAATYRGVTAIGNNATANAASSVALGYLSVA
                     DRDNSVSVGSSTLQRQITNVAAGTADTDAVNVSQLKGSGLIGDDGKSIAAVTYDRNAD
                     GTPNYGTVTLGNGNGPTQIKNVADAKDDHDALNLGQLKDAGLVGDDGAGKLTSAAVTY
                     DKNADGTINHDKATLAGTSGTTLSNVKAGVADMDAVNVSQLKGSGLIGDDGKSIAAVT
                     YDRNADGTPNYGTVTLGNGNGPTQIKNVADAKDDHDALNLGQLKDTGLVGEDGAGKLT
                     SLAVTYDGAAKDSVTLGGTGATAPVALHNVADGVLSATSKDAVNGSQLFATNTRVGDL
                     EDSLSKGGVIDPVTGESLAVVYDSNAKDTVTLKGTNGTTLSNVKAGAADMDAVNVSQL
                     KGSGLIGDDGKSIAAVTYDRNADGTPNYGTVTLGNGNGPTQVKNVATGVEDTDAVNVK
                     QLTSGLSDLKDEMSRADLRFVKVNADPVTGTPAIASGALAVAIGSDARATSANSLALG
                     SGARVTGAGSVAIGYNSVANQNNVVSVGDVGRERKIVNVADGDVAFQSTDAVNGGQLY
                     AALNTLSTSVTSKTQQAIDTFSTEIDKKTKAAIDEVSSRSMQPMDVSDPLVAIEGLQG
                     NNVASLNGADPATATAAAIGSSTAASGANAVAIGLQSGAGSNNSVALGSFAQTGAGQD
                     YSVAMGSNVQTNGTQAVAMGANTQANGDYALAIGNNGAQAVGDSSIAVGNGANVRAGA
                     TNAMAIGTGANVARNVEGAMALGANSTSGAANSIALGSNSFSNRADTLSVGRAGAERQ
                     IVNVAAGTQATDAVNVSQLKGVTDSLGGGTTIGADGSITKPTYNVGGTDYHNVGDALD
                     ALEKSSGSNPLAVAYDSAAKDTVTLGGVGATTPVALKNVADAKDDHDALNLGQLKNAG
                     LVGDDGAGKLTSAAVTYDKNADGTINHDKATLAGTSGTTLSNVKAGVADMDAVNVSQL
                     KGSGLIGDDGKSIAAVTYDRNADGTPNYGSVTLGNGTGPTQLKNVADAKDDHDALNLG
                     QLKDTGLVGEDGAGKLTSAAVTYDKNADGTINHDKATLAGTSGTTLSNVKAGVADMDA
                     VNVSQLKDAGLIDPSTGKPMAAVTYDSAAKDTVTLGGVGATTPVALKNVADAKDDHDA
                     LNLGQLKDTGLVGEDGAGKLTSLAVTYDGASKDSVTLGGTGATAPVALHNIADGVLSA
                     TSKDAVNGSQLFATNTRVGDLEDSLKQGGVIDPTTGESLAVVYDSTAKNSVTLGNAGT
                     PVGIHNLAAGTVNATSNDAINGSQLFTVSKSVADKIGGGAGVGADGSITDPTYSVGGQ
                     DYHNVGDALDALDKNSGNNPLAVAYDSAAKDTVTLGGVGATTPVALKNVADAKDDHDA
                     LNLGQLKNAGLVGDDGAGNLTSAAVTYDKNADGTINHDKATLAGTSGTTLSNVKAGVA
                     DMDAVNVSQLKGSGLIGDDGKSIAAVTYDRNADGTPNYGSVTLGNGTGPTQLKNVADA
                     TDDGDALNLGQLKNAGLVGEDGAGKLTSAAVTYDKNADGTINHDKATLAGTSGTTLSN
                     VKAGVADMDAVNVSQLKGSGLIGDDGKSIAAVTYDRNADGTPNYGSVTLGNGTGPTQL
                     KNVADAKDDHDALNLGQMKDAGLVGEDGAGKLTSAAVTYDKNADGTINHDKATLAGTS
                     GTTLSNVKAGVADMDAVNVSQLKDAGLIDPSTGKSLAAVTYDDATKSTVTLGGVGATT
                     PVALKNVADGTDRHDAINLGQLQDAGLVAPVDPTDPGKGLKSLAVAYDSATQDVVTLK
                     GTDGTTITNVKAGAVTATSTDAINGSQLHATAQSVADSLGGGSTVDADGKVTNPSYSL
                     ADPTDASKKAEYSNVGDALANLDGRTSTNTENITVINKQLADSGLVDPATGQSIAAVT
                     YDRNADGTPNKGSVTLGGAGATAPVALKNVADGVDAHDAVNLGQLQGAGLVAPVDPTN
                     PGAGLTSLAVTYDKHADGSANFDQITLKGTDGSTITNVKAGAVNATSTDAVNGSQLYG
                     ASKSVADSLGGGSTVDANGNVTNPTYTVNNQKFDNVGDAIENISNSLVHGSIGLVQQD
                     DVTRDITVAKDTDGTTVNFAGTAGDRVLTGVGAGAVSATSNDAINGSQLHGTAQSVAD
                     VIGGGTTVDADGKLADTSIEVNGNKYKTVAEAVQAAAQYGATDSLAVRYDLNADGTPN
                     YGSVTLGGSGSAPVRLTNVADGASKYDAVNFGQLSELNDKIGGLDDRVGALEQNPGPG
                     TPNPGGPGNEYFAGTDIGSDGTTPANAGDGTGNTAAGSNARVGTGVNNGTAIGSGAGV
                     SKDGGVAIGSNAASAAEGAVAIGRGSDASGSKSTAIGDGAKASGANSVALGSGSQATE
                     ANTVSFGDGSEDGNRRIVNIRDGINETDAATKGQLDRAVGGLQGQVNDLSRNAYSGIA
                     AATALTMIPGVDPGKTVSFGIGGATYKGYQAVAFGGEARITQNLKMKAGVGLSSGGNT
                     VGVGASYQW"
     sig_peptide     259271..259333
                     /locus_tag="BCAM0219"
                     /note="Signal peptide predicted for BCAM0219 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.506 between residues 21 and 22"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    259682..259744
                     /locus_tag="BCAM0219"
                     /note="HMMPfam hit to PF05662, Haemagglutinin, score
                     2.9e-05"
                     /inference="protein motif:HMMPfam:PF05662"
     misc_feature    259832..259915
                     /locus_tag="BCAM0219"
                     /note="HMMPfam hit to PF05658, Hep_Hag, score 0.00055"
                     /inference="protein motif:HMMPfam:PF05658"
     misc_feature    259916..259999
                     /locus_tag="BCAM0219"
                     /note="HMMPfam hit to PF05658, Hep_Hag, score 0.003"
                     /inference="protein motif:HMMPfam:PF05658"
     misc_feature    260000..260080
                     /locus_tag="BCAM0219"
                     /note="HMMPfam hit to PF05658, Hep_Hag, score 0.58"
                     /inference="protein motif:HMMPfam:PF05658"
     misc_feature    260081..260164
                     /locus_tag="BCAM0219"
                     /note="HMMPfam hit to PF05658, Hep_Hag, score 2.5e-05"
                     /inference="protein motif:HMMPfam:PF05658"
     misc_feature    260210..260272
                     /locus_tag="BCAM0219"
                     /note="HMMPfam hit to PF05662, Haemagglutinin, score
                     3.4e-06"
                     /inference="protein motif:HMMPfam:PF05662"
     misc_feature    260345..260437
                     /locus_tag="BCAM0219"
                     /note="HMMPfam hit to PF05658, Hep_Hag, score 1.2"
                     /inference="protein motif:HMMPfam:PF05658"
     misc_feature    260648..260731
                     /locus_tag="BCAM0219"
                     /note="HMMPfam hit to PF05658, Hep_Hag, score 0.00046"
                     /inference="protein motif:HMMPfam:PF05658"
     misc_feature    260735..260797
                     /locus_tag="BCAM0219"
                     /note="HMMPfam hit to PF05662, Haemagglutinin, score
                     1.7e-08"
                     /inference="protein motif:HMMPfam:PF05662"
     misc_feature    260915..260977
                     /locus_tag="BCAM0219"
                     /note="HMMPfam hit to PF05662, Haemagglutinin, score
                     7.5e-05"
                     /inference="protein motif:HMMPfam:PF05662"
     misc_feature    261101..261163
                     /locus_tag="BCAM0219"
                     /note="HMMPfam hit to PF05662, Haemagglutinin, score
                     0.00013"
                     /inference="protein motif:HMMPfam:PF05662"
     misc_feature    261281..261343
                     /locus_tag="BCAM0219"
                     /note="HMMPfam hit to PF05662, Haemagglutinin, score
                     7.5e-05"
                     /inference="protein motif:HMMPfam:PF05662"
     misc_feature    261854..261916
                     /locus_tag="BCAM0219"
                     /note="HMMPfam hit to PF05662, Haemagglutinin, score
                     3.5e-06"
                     /inference="protein motif:HMMPfam:PF05662"
     misc_feature    262013..262096
                     /locus_tag="BCAM0219"
                     /note="HMMPfam hit to PF05658, Hep_Hag, score 6.8e-05"
                     /inference="protein motif:HMMPfam:PF05658"
     misc_feature    262097..262180
                     /locus_tag="BCAM0219"
                     /note="HMMPfam hit to PF05658, Hep_Hag, score 0.0029"
                     /inference="protein motif:HMMPfam:PF05658"
     misc_feature    262184..262255
                     /locus_tag="BCAM0219"
                     /note="HMMPfam hit to PF05662, Haemagglutinin, score
                     2.4e-06"
                     /inference="protein motif:HMMPfam:PF05662"
     misc_feature    262547..262636
                     /locus_tag="BCAM0219"
                     /note="HMMPfam hit to PF05658, Hep_Hag, score 0.05"
                     /inference="protein motif:HMMPfam:PF05658"
     misc_feature    262637..262720
                     /locus_tag="BCAM0219"
                     /note="HMMPfam hit to PF05658, Hep_Hag, score 0.00062"
                     /inference="protein motif:HMMPfam:PF05658"
     misc_feature    262724..262813
                     /locus_tag="BCAM0219"
                     /note="HMMPfam hit to PF05658, Hep_Hag, score 0.055"
                     /inference="protein motif:HMMPfam:PF05658"
     misc_feature    262826..262903
                     /locus_tag="BCAM0219"
                     /note="HMMPfam hit to PF05658, Hep_Hag, score 0.012"
                     /inference="protein motif:HMMPfam:PF05658"
     misc_feature    262949..263011
                     /locus_tag="BCAM0219"
                     /note="HMMPfam hit to PF05662, Haemagglutinin, score
                     1.3e-07"
                     /inference="protein motif:HMMPfam:PF05662"
     misc_feature    263414..263476
                     /locus_tag="BCAM0219"
                     /note="HMMPfam hit to PF05662, Haemagglutinin, score
                     0.00013"
                     /inference="protein motif:HMMPfam:PF05662"
     misc_feature    263780..263842
                     /locus_tag="BCAM0219"
                     /note="HMMPfam hit to PF05662, Haemagglutinin, score
                     0.00013"
                     /inference="protein motif:HMMPfam:PF05662"
     misc_feature    264350..264421
                     /locus_tag="BCAM0219"
                     /note="HMMPfam hit to PF05662, Haemagglutinin, score
                     0.00027"
                     /inference="protein motif:HMMPfam:PF05662"
     misc_feature    264836..264898
                     /locus_tag="BCAM0219"
                     /note="HMMPfam hit to PF05662, Haemagglutinin, score
                     0.00013"
                     /inference="protein motif:HMMPfam:PF05662"
     misc_feature    265202..265264
                     /locus_tag="BCAM0219"
                     /note="HMMPfam hit to PF05662, Haemagglutinin, score
                     0.00013"
                     /inference="protein motif:HMMPfam:PF05662"
     misc_feature    265568..265630
                     /locus_tag="BCAM0219"
                     /note="HMMPfam hit to PF05662, Haemagglutinin, score
                     0.00013"
                     /inference="protein motif:HMMPfam:PF05662"
     misc_feature    265925..265996
                     /locus_tag="BCAM0219"
                     /note="HMMPfam hit to PF05662, Haemagglutinin, score
                     1e-06"
                     /inference="protein motif:HMMPfam:PF05662"
     misc_feature    266333..266395
                     /locus_tag="BCAM0219"
                     /note="HMMPfam hit to PF05662, Haemagglutinin, score
                     0.00011"
                     /inference="protein motif:HMMPfam:PF05662"
     misc_feature    266531..266602
                     /locus_tag="BCAM0219"
                     /note="HMMPfam hit to PF05662, Haemagglutinin, score
                     1.3e-06"
                     /inference="protein motif:HMMPfam:PF05662"
     misc_feature    266858..266929
                     /locus_tag="BCAM0219"
                     /note="HMMPfam hit to PF05662, Haemagglutinin, score
                     0.0002"
                     /inference="protein motif:HMMPfam:PF05662"
     misc_feature    267170..267232
                     /locus_tag="BCAM0219"
                     /note="HMMPfam hit to PF05662, Haemagglutinin, score
                     3.4e-05"
                     /inference="protein motif:HMMPfam:PF05662"
     misc_feature    267386..267475
                     /locus_tag="BCAM0219"
                     /note="HMMPfam hit to PF05658, Hep_Hag, score 1.9"
                     /inference="protein motif:HMMPfam:PF05658"
     misc_feature    267476..267559
                     /locus_tag="BCAM0219"
                     /note="HMMPfam hit to PF05658, Hep_Hag, score 0.0049"
                     /inference="protein motif:HMMPfam:PF05658"
     misc_feature    267560..267643
                     /locus_tag="BCAM0219"
                     /note="HMMPfam hit to PF05658, Hep_Hag, score 1.6e-07"
                     /inference="protein motif:HMMPfam:PF05658"
     misc_feature    267797..268027
                     /locus_tag="BCAM0219"
                     /note="HMMPfam hit to PF03895, YadA-like C-terminal
                     region, score 4.4e-07"
                     /inference="protein motif:HMMPfam:PF03895"
     misc_feature    267902..267949
                     /note="PS00225 Crystallins beta and gamma 'Greek key'
                     motif signature."
                     /inference="protein motif:Prosite:PS00225"
     CDS             268132..268851
                     /transl_table=11
                     /locus_tag="BCAM0220"
                     /product="putative outer membrane protein"
                     /note="Similar to Bordetella avium ompa outer membrane
                     protein A precursor. UniProt:OMPA_BORAV (EMBL:A45275) (194
                     aa) fasta scores: E()=2.6e-08, 39.552% id in 134 aa;
                     homology does not extend to the N terminus"
                     /db_xref="EnsemblGenomes-Gn:BCAM0220"
                     /db_xref="EnsemblGenomes-Tr:CAR54078"
                     /db_xref="GOA:B4EHQ2"
                     /db_xref="InterPro:IPR006664"
                     /db_xref="InterPro:IPR006665"
                     /db_xref="InterPro:IPR036737"
                     /db_xref="UniProtKB/TrEMBL:B4EHQ2"
                     /protein_id="CAR54078.1"
                     /translation="MTMKTLLLRAASIGAIAMALGACTTQSGVTYDIRAVSIPGKADN
                     VFRVSCDGLLGSANSCARAAEEFCRGQGFTPLEMIDRVRSGAPMKDPREITFMCGKPQ
                     PVVQATPPAPPPPPQPAPQPVPQRQVLLQGDANFAFDSAALTPDARAQLDRFVDINSG
                     IEFRRVAITGFTDSTGSNTHNLALSASRARNVMNYLRSNGLKAQSFVSEGLGAADPVA
                     SNATAEGRAQNRRVEIRIDAK"
     sig_peptide     268132..268197
                     /locus_tag="BCAM0220"
                     /note="Signal peptide predicted for BCAM0220 by SignalP
                     2.0 HMM (Signal peptide probability 0.999) with cleavage
                     site probability 0.424 between residues 22 and 23"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    268168..268200
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
                     /inference="protein motif:Prosite:PS00013"
     misc_feature    268534..268821
                     /locus_tag="BCAM0220"
                     /note="HMMPfam hit to PF00691, OmpA family, score 1.7e-25"
                     /inference="protein motif:HMMPfam:PF00691"
     CDS             269146..269865
                     /transl_table=11
                     /locus_tag="BCAM0221"
                     /product="two-component regulatory system, response
                     regulator protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0221"
                     /db_xref="EnsemblGenomes-Tr:CAR54079"
                     /db_xref="GOA:B4EHQ3"
                     /db_xref="InterPro:IPR000792"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="InterPro:IPR016032"
                     /db_xref="UniProtKB/TrEMBL:B4EHQ3"
                     /protein_id="CAR54079.1"
                     /translation="MGSYLIRVVLADDHPAMLVGVEHGLSSVPTIQLTGKAVNSTELI
                     RLVEAGVCDVVVSDYAMPGSAHGDGITLFSYLQRNHPAVKLVVLTMLDNPAVIGALTR
                     LGIECIVSKSDTIDHLIPAIHAAATGGSYFSPSVEKVVRTLTSHSSARAADQKRELSD
                     RELEVVRLYASGLTVNEIADQLSRSKKTISTQKARAMEKLGIEKDIDLLRYAIEHGIV
                     AASASEGRGGDANEEGRVDPA"
     misc_feature    269161..269514
                     /locus_tag="BCAM0221"
                     /note="HMMPfam hit to PF00072, Response regulator receiver
                     domain, score 9.2e-12"
                     /inference="protein motif:HMMPfam:PF00072"
     misc_feature    269587..269745
                     /locus_tag="BCAM0221"
                     /note="HMMPfam hit to PF08281, Sigma-70, region, score
                     1.8e-05"
                     /inference="protein motif:HMMPfam:PF08281"
     misc_feature    269608..269781
                     /locus_tag="BCAM0221"
                     /note="HMMPfam hit to PF00196, Bacterial regulatory
                     proteins, luxR fami, score 9.9e-18"
                     /inference="protein motif:HMMPfam:PF00196"
     misc_feature    269659..269742
                     /note="PS00622 Bacterial regulatory proteins, luxR family
                     signature."
                     /inference="protein motif:Prosite:PS00622"
     misc_feature    269662..269727
                     /note="Predicted helix-turn-helix motif with score
                     1045.000, SD 2.75 at aa 173-194, sequence
                     LTVNEIADQLSRSKKTISTQKA"
                     /inference="protein motif:helixturnhelix:EMBOSS"
     CDS             complement(269998..270690)
                     /transl_table=11
                     /locus_tag="BCAM0222"
                     /product="two-component regulatory system, response
                     regulator protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0222"
                     /db_xref="EnsemblGenomes-Tr:CAR54080"
                     /db_xref="GOA:B4EHQ4"
                     /db_xref="InterPro:IPR000792"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="InterPro:IPR016032"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="UniProtKB/TrEMBL:B4EHQ4"
                     /protein_id="CAR54080.1"
                     /translation="MNRTFPIRIVIADDHPAVVIGARYELSATNTVAVVATAHNSTEL
                     MDALSHHPCDVLVSDYAMPGTEYGDGLAMFTILLKRFPGLKIVVMTMMENAVALRALM
                     DIGIACIVSKSDMPNHLTMAIHAAYTNGRYLSPSMDRILRNTGSVGGKAPALSVREVE
                     VIRLFASGLSVNEIAEKLNRSKKTISTQKSSAMQKLGIERDVDLVRYAIACGLVTDYG
                     YAPPVRSDEANA"
     misc_feature    complement(270067..270240)
                     /locus_tag="BCAM0222"
                     /note="HMMPfam hit to PF00196, Bacterial regulatory
                     proteins, luxR fami, score 6.7e-21"
                     /inference="protein motif:HMMPfam:PF00196"
     misc_feature    complement(270106..270189)
                     /note="PS00622 Bacterial regulatory proteins, luxR family
                     signature."
                     /inference="protein motif:Prosite:PS00622"
     misc_feature    complement(270121..270186)
                     /note="Predicted helix-turn-helix motif with score
                     1195.000, SD 3.26 at aa 169-190, sequence
                     LSVNEIAEKLNRSKKTISTQKS"
                     /inference="protein motif:helixturnhelix:EMBOSS"
     misc_feature    complement(270319..270672)
                     /locus_tag="BCAM0222"
                     /note="HMMPfam hit to PF00072, Response regulator receiver
                     domain, score 1e-11"
                     /inference="protein motif:HMMPfam:PF00072"
     CDS             complement(270927..275579)
                     /transl_table=11
                     /locus_tag="BCAM0223"
                     /product="putative haemagglutinin-related autotransporter
                     protein"
                     /note="Contains many Hep_Hag repeats and haemagglutinin
                     motif"
                     /db_xref="EnsemblGenomes-Gn:BCAM0223"
                     /db_xref="EnsemblGenomes-Tr:CAR54081"
                     /db_xref="GOA:B4EHQ5"
                     /db_xref="InterPro:IPR005594"
                     /db_xref="InterPro:IPR008635"
                     /db_xref="InterPro:IPR008640"
                     /db_xref="InterPro:IPR011049"
                     /db_xref="InterPro:IPR024973"
                     /db_xref="UniProtKB/TrEMBL:B4EHQ5"
                     /protein_id="CAR54081.1"
                     /translation="MNKTYRSVWNAVTNTWTAAAETAKSHSKGSSRIARQALIAIALG
                     GTAIGGAAAAEVCTTEDGSSGTVDEAGVCKAAGGGAIGTMGAIGTMATLDDARIKVGG
                     TGLASIGGGNAIAIGSGSLAGSSGAISIGYNATTTGQNDIAVGRGALANASSAPGSGV
                     SDYSMAVGYGASAVGGRSVAIGPGAIATNGVGATALEAVSIGSAASVSEIGGVAIGRN
                     SSVATNATDGVALGRGSTASAANTVSVGNIMLQRRITNMDRGIDDTDAVNVGQMNAGL
                     STTNASIAATNTALSTTNASLSTTNSTLAATNATLSTTNATLSTTNTTLATTNATLST
                     ANTQIAALNGDMTTAKTGISTNTSDITKLNDKLSELSNGTVGLVQQANAGDDLTVGAN
                     TDGAAVNFAGTAGDRKLSGIAEGTLDSDAVNVGQMNAGLSTTNAAIAATNAGLSTTNT
                     NLAETKATLSTTSTQVAELGSDMTIAKDNIATHTTEIKSINDQLSELSSGTIGLVQQS
                     AAGDDLTVGANTDGAAVNFAGTAGDRKLSGIAEGTLDSDAVNVGQMNAGLSTTNAAIA
                     ATNAMLSTTNATLSTTNTTLADTNATLSTANTQIAALNGDMTTAKDNIATHTTEIKSI
                     NDQLSDLSSGTIGLVQQSAAGADLTVGANTDGAAVNFAGTAGDRKLSGIATGTLDSDA
                     VNVGQMNAGLSTTNAAITATNAELSTTNTTLAATNTALSTTNTNLAETNATLSTTSTQ
                     VAELGSDMTIAKDNITQHTTEIKSINDQLSELSSGTIGLVQQSAAGADLTVGANTDGA
                     AVNFAGTAGDRKLSGIATGTLDSDAVNVGQMNAGLSTTNASITSLDGRVTSNETTITN
                     LDGRVTSNETTITNLDGRVTNNETAITNLDGRVTSNETAITNLDGRVTNNETSITNLD
                     GRMTTSETAITNLDGRVTSNETAITNLDGRVTSNETSITNLDGRVTSNETSITNLDGR
                     MTTSETAITNIDNRVTINEGAITKLADEIGSGSLGLVRQANAGADLTVGANADGAAVN
                     FAGTAGNRKLSGIAEGTLDSDAVNVGQMNAGLSTTNASITSLDGRVTNNETSITNLDG
                     RMTTSETTITNIDNRVTANEGSITSLDNRVTVNEGAITKLADQIGSGSLGLVQQASAG
                     DDLTVGANTDGAAVNFAGTAGNRKLTGVDAGAVSAASTEAINGMQLHGVSESVASALG
                     GTSTVDADGKLTNVSFDINGTKYSTVEQAIQAAAAFGASDPLSVRYDLNGDGTPNFGS
                     VTLGGIGAAPVILTNVADGVNPYDAVNFGQLSALNDKFSDLDGRVGSLEQNAGGSGPG
                     GPGDGSGTPGTGGPGSIVVGDGADASGANSSAIGQGAVASGNNGSAVGQGAIASGNNG
                     TAIGQGSLASGENSTALGQGASATGSGSVAIGQGSVATETNTVSFGNGTEEGNRRLVN
                     IADGINASDAATKGQLDRAMESVDARFNDTNRAINDVAKNAYAGIAAAMAMPNMTPSA
                     PGKTVVAVGTANFKSGSAIAAGATYRSRNGKWLVNGAASLTSVGDAGVRAQVGYEF"
     misc_feature    complement(270930..271163)
                     /locus_tag="BCAM0223"
                     /note="HMMPfam hit to PF03895, YadA-like C-terminal
                     region, score 3.6e-07"
                     /inference="protein motif:HMMPfam:PF03895"
     misc_feature    complement(271296..271379)
                     /locus_tag="BCAM0223"
                     /note="HMMPfam hit to PF05658, Hep_Hag, score 5.1e-06"
                     /inference="protein motif:HMMPfam:PF05658"
     misc_feature    complement(271380..271463)
                     /locus_tag="BCAM0223"
                     /note="HMMPfam hit to PF05658, Hep_Hag, score 1.4e-05"
                     /inference="protein motif:HMMPfam:PF05658"
     misc_feature    complement(271464..271547)
                     /locus_tag="BCAM0223"
                     /note="HMMPfam hit to PF05658, Hep_Hag, score 0.0013"
                     /inference="protein motif:HMMPfam:PF05658"
     misc_feature    complement(274764..274826)
                     /locus_tag="BCAM0223"
                     /note="HMMPfam hit to PF05662, Haemagglutinin, score
                     2.8e-05"
                     /inference="protein motif:HMMPfam:PF05662"
     misc_feature    complement(274830..274913)
                     /locus_tag="BCAM0223"
                     /note="HMMPfam hit to PF05658, Hep_Hag, score 0.48"
                     /inference="protein motif:HMMPfam:PF05658"
     misc_feature    complement(274920..275003)
                     /locus_tag="BCAM0223"
                     /note="HMMPfam hit to PF05658, Hep_Hag, score 0.0026"
                     /inference="protein motif:HMMPfam:PF05658"
     misc_feature    complement(275022..275105)
                     /locus_tag="BCAM0223"
                     /note="HMMPfam hit to PF05658, Hep_Hag, score 0.44"
                     /inference="protein motif:HMMPfam:PF05658"
     misc_feature    complement(275133..275216)
                     /locus_tag="BCAM0223"
                     /note="HMMPfam hit to PF05658, Hep_Hag, score 0.26"
                     /inference="protein motif:HMMPfam:PF05658"
     sig_peptide     complement(275418..275579)
                     /locus_tag="BCAM0223"
                     /note="Signal peptide predicted for BCAM0223 by SignalP
                     2.0 HMM (Signal peptide probability 0.933) with cleavage
                     site probability 0.455 between residues 54 and 55"
                     /inference="protein motif:SignalP:2.0"
     CDS             complement(275952..278813)
                     /transl_table=11
                     /locus_tag="BCAM0224"
                     /product="putative haemagglutinin-related autotransporter
                     protein"
                     /note="contains many Hep_Hag repeats and haemagglutinin
                     motifs"
                     /db_xref="EnsemblGenomes-Gn:BCAM0224"
                     /db_xref="EnsemblGenomes-Tr:CAR54082"
                     /db_xref="GOA:B4EHQ6"
                     /db_xref="InterPro:IPR005594"
                     /db_xref="InterPro:IPR008635"
                     /db_xref="InterPro:IPR008640"
                     /db_xref="InterPro:IPR011049"
                     /db_xref="InterPro:IPR024973"
                     /db_xref="UniProtKB/TrEMBL:B4EHQ6"
                     /protein_id="CAR54082.1"
                     /translation="MNKTYRSIWNAVTNTWTAAAETAKSHSRGSSRVARQAVIAIALG
                     GAAIGAAAAAEVCTAEDGANGTVDTAGVCQTTTHNLIGPMETTSSIGVMAGGWSGGNG
                     ISIWTGTGTAANATNASDIAIGNGASSIAGNGVALGTNATITSGSAGLAMGAYSTASA
                     SYGIAIGGATGSGRGAVVEGTGSVAIGTISHVTSGTSNAVALGMGSVAHESNTVSVGA
                     GVPNIDGHTFTRRIVNVSPGIADTDVVNVSQLAPVVTALGGGAAIDPTTGAVTGPTYT
                     LANGGTQTTIGGALGALDGALTTTNGNVTALTTRMDTAETDISDLQTAVGSGSVGLVQ
                     QAGAGANLTVGKDTDGAAVNFAGTAGNRKLTGVAAGDVSAASTEAVNGSQLHGVSESV
                     ASAIGGGSTVNPDGSISAPSFTVGDGHGGTTTVGTVADAVSNLDGRTTTNEGAITDLA
                     SQIGSGTLGLVQQANAGDNITVGASTDGAAVNFAGTAGNRKLTGIAAGDVSAASTEAV
                     NGSQLHGVSESVASAIGGGSTVNPDGSISAPSFTVGDGSGGTKVVNSVGDAVTNLDGR
                     TTINEGAITNLAAQIGSGTLGIVQQDPASGAITVGAASGGSMVNFAGTGGARVLSGVA
                     NGVADDDVVTVSQLRATGLIDYSGKEVGAVTYDSGLSFDSVTFAGTNGTVLHRVAAGD
                     ISATSMDAVNGSQLYALQQEFAQKYGDLSGRVGDLEAGGGSDGGSGSGVGTGTGGPGS
                     IVVGDGADASGSNSSAIGQGSVASGNNGSAVGQGAVASGNNGTATGQGAVASGDNSSA
                     FGQGAVASGGSSTAIGQNANASGNNSVALGAGSVADRDNAVSVGSAGAERQITNVAAG
                     TAPTDAVNVQQMNNTVSSARQDAMGGVAAAMAVAGLPQSTQPGRTFVSMAGSTYGGEY
                     GSAMGLSYMTRDGKWTVKAAVNTSSRGEVGGVIGGGFYW"
     misc_feature    complement(275955..276191)
                     /locus_tag="BCAM0224"
                     /note="HMMPfam hit to PF03895, YadA-like C-terminal
                     region, score 4.5e-15"
                     /inference="protein motif:HMMPfam:PF03895"
     misc_feature    complement(276210..276272)
                     /locus_tag="BCAM0224"
                     /note="HMMPfam hit to PF05662, Haemagglutinin, score
                     7.6e-07"
                     /inference="protein motif:HMMPfam:PF05662"
     misc_feature    complement(276276..276359)
                     /locus_tag="BCAM0224"
                     /note="HMMPfam hit to PF05658, Hep_Hag, score 0.0063"
                     /inference="protein motif:HMMPfam:PF05658"
     misc_feature    complement(276360..276443)
                     /locus_tag="BCAM0224"
                     /note="HMMPfam hit to PF05658, Hep_Hag, score 2.6e-05"
                     /inference="protein motif:HMMPfam:PF05658"
     misc_feature    complement(276444..276527)
                     /locus_tag="BCAM0224"
                     /note="HMMPfam hit to PF05658, Hep_Hag, score 0.071"
                     /inference="protein motif:HMMPfam:PF05658"
     misc_feature    complement(276528..276611)
                     /locus_tag="BCAM0224"
                     /note="HMMPfam hit to PF05658, Hep_Hag, score 0.017"
                     /inference="protein motif:HMMPfam:PF05658"
     misc_feature    complement(277659..277730)
                     /locus_tag="BCAM0224"
                     /note="HMMPfam hit to PF05662, Haemagglutinin, score
                     9.9e-05"
                     /inference="protein motif:HMMPfam:PF05662"
     misc_feature    complement(277734..277808)
                     /note="PS00583 pfkB family of carbohydrate kinases
                     signature 1."
                     /inference="protein motif:Prosite:PS00583"
     misc_feature    complement(278064..278126)
                     /locus_tag="BCAM0224"
                     /note="HMMPfam hit to PF05662, Haemagglutinin, score
                     0.00024"
                     /inference="protein motif:HMMPfam:PF05662"
     misc_feature    complement(278193..278282)
                     /locus_tag="BCAM0224"
                     /note="HMMPfam hit to PF05658, Hep_Hag, score 0.73"
                     /inference="protein motif:HMMPfam:PF05658"
     misc_feature    complement(278301..278384)
                     /locus_tag="BCAM0224"
                     /note="HMMPfam hit to PF05658, Hep_Hag, score 0.16"
                     /inference="protein motif:HMMPfam:PF05658"
     misc_feature    complement(278388..278471)
                     /locus_tag="BCAM0224"
                     /note="HMMPfam hit to PF05658, Hep_Hag, score 0.068"
                     /inference="protein motif:HMMPfam:PF05658"
     sig_peptide     complement(278655..278813)
                     /locus_tag="BCAM0224"
                     /note="Signal peptide predicted for BCAM0224 by SignalP
                     2.0 HMM (Signal peptide probability 0.955) with cleavage
                     site probability 0.623 between residues 53 and 54"
                     /inference="protein motif:SignalP:2.0"
     CDS             complement(279139..279774)
                     /pseudo
                     /transl_table=11
                     /locus_tag="BCAM0225"
                     /product="putative haemagglutinin-related protein
                     (fragment)"
                     /note="Possible gene remnant. Partial similarity to
                     Escherichia coli O6 putative adhesin. UniProt:Q8FCB2 (1778
                     aa) fasta scores: E()=1e-05, 36.527% id in 167 aa"
                     /note="contains two haemagglutinin motifs"
                     /db_xref="PSEUDO:CAR54083.1"
     misc_feature    complement(279562..279624)
                     /locus_tag="BCAM0225"
                     /note="HMMPfam hit to PF05662, Haemagglutinin, score
                     7.4e-07"
                     /inference="protein motif:HMMPfam:PF05662"
     sig_peptide     complement(279688..279774)
                     /locus_tag="BCAM0225"
                     /note="Signal peptide predicted for BCAM0225 by SignalP
                     2.0 HMM (Signal peptide probability 0.997) with cleavage
                     site probability 0.675 between residues 29 and 30"
                     /inference="protein motif:SignalP:2.0"
     CDS             join(281058..281186,281190..281309)
                     /pseudo
                     /transl_table=11
                     /locus_tag="BCAM0225A"
                     /product="putative haemagglutinin-related protein
                     (fragment)"
                     /note="Probable gene remnant. Similar to an internal
                     region of Burkholderia xenovorans (strain LB400) outer
                     membrane protein, putative autotransporter and adhesin
                     UniProt:Q13WU9 (EMBL:CP000270 (810 aa) fasta scores:
                     E()=3e-07, 51.190% id in 84 aa"
     CDS             complement(281630..284665)
                     /transl_table=11
                     /locus_tag="BCAM0227"
                     /product="hybrid two-component system kinase-response
                     regulator protein"
                     /note="C terminus similar to C terminus of Bordetella
                     pertussis bvgs virulence sensor protein bvgs precursor (ec
                     2.7.3.-). UniProt:BVGS_BORPE (EMBL:A40185) (1238 aa) fasta
                     scores: E()=1.7e-42, 33.185% id in 672 aa"
                     /db_xref="EnsemblGenomes-Gn:BCAM0227"
                     /db_xref="EnsemblGenomes-Tr:CAR54085"
                     /db_xref="GOA:B4EHQ8"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="InterPro:IPR036097"
                     /db_xref="InterPro:IPR036641"
                     /db_xref="InterPro:IPR036890"
                     /db_xref="UniProtKB/TrEMBL:B4EHQ8"
                     /protein_id="CAR54085.1"
                     /translation="MGAPWPTAPLSMDHRAAPDPARSAAAHAPAAPTRVGRRQRALLY
                     AGGAAVTVSILLASGLMLYTMAREAIQARYTTFAVRQFLVQIEFKMRTTGMDTLVTHD
                     EAVWNSRAIDPARVAALAAGRGRLIIQGSPTFPPTLVLADLSPAHPADSYAHDLAMAS
                     DMSYRVGAYVAKHDADRAIAGYAYRPDRSFAVVIPEPVPPDPLTASPATDAATLVAKV
                     AAGVGTPSPGQYEWHPPVYDPVQRRDVFRIAGAVYDAQSPRAVFLSTLPVDVLRTRLS
                     AGDTTDAAIIVDAHGRTLLRAGSADDDDATRAAIERLDARTREAARRGGPRTAFGDGL
                     FSLSQPIPETDWTLVQTFTLRSLLATIGLRAGWYVAIMLAVIALVWWLLVRFDRRVLK
                     PDDARTRRVIDSENLNRTIVEAAPSGIALLSLADGAVLLQNDTMRDYDARRAGEPSLP
                     ARLLEHFDRSPAAAAWQPDLHVTLPTAGGETVDLLVNLVRTRFRDTDVVLCNFSDITS
                     QKNIERQLDEAARAADAANDAKSAFLATMSHEIRTPLNAILGNLELIGREPLAATQRE
                     RLQTVEGASSVLLDLINDILDLSKIEAGQMTIEAIPFDLAETIRQTGAMFEPLATAKG
                     LQFDVFVDDALPARYLGDPTRIRQIAANLVGNAIKFTNHGEITLEVYLRDDTDPASPI
                     AIGVSDTGIGMTDAQRAALFRPFTQADTSITRRYGGTGLGLALTKQLTQMMHGTVDVK
                     SEPGKGSTFVVTLPLRPATDAQVAEHDAAQADDTTLPAVTARVLVVDDHPVNRTLLQG
                     QLVTLGYAADSAEEGASALRRCADTRYDLVMTDLNMPGMDGYTLARVLRSQYPEMPVV
                     AVTAHASAAEHARCAEAGIVAVLVKPVLLDTIDRTVRRHAHAAAAQAPARRALVDLAE
                     GPLPPDVHALLEASLTQSLAATHDALAHDDLPALRHELHSLRGAFATIHEHAVADAIG
                     ELQAVVHGGDLTSFDARLADAEALARDALQRRATQAPSA"
     misc_feature    complement(281987..282325)
                     /locus_tag="BCAM0227"
                     /note="HMMPfam hit to PF00072, Response regulator receiver
                     domain, score 2.8e-31"
                     /inference="protein motif:HMMPfam:PF00072"
     misc_feature    complement(282398..282745)
                     /locus_tag="BCAM0227"
                     /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
                     gyrase B-, and HS, score 5e-40"
                     /inference="protein motif:HMMPfam:PF02518"
     misc_feature    complement(282884..283081)
                     /locus_tag="BCAM0227"
                     /note="HMMPfam hit to PF00512, His Kinase A
                     (phosphoacceptor) domain, score 1.2e-23"
                     /inference="protein motif:HMMPfam:PF00512"
     misc_feature    complement(282923..282970)
                     /note="PS00038 Myc-type, 'helix-loop-helix' dimerization
                     domain signature."
                     /inference="protein motif:Prosite:PS00038"
     misc_feature    complement(join(283517..283585,284477..284545))
                     /locus_tag="BCAM0227"
                     /note="2 probable transmembrane helices predicted for
                     BCAM0227 by TMHMM2.0 at aa 41-63 and 361-383"
                     /inference="protein motif:TMHMM:2.0"
     CDS             complement(284809..285693)
                     /transl_table=11
                     /locus_tag="BCAM0228"
                     /product="two-component regulatory system, response
                     regulator protein"
                     /note="Similar to Bordetella parapertussis probable
                     two-component response regulator. UniProt:Q7W2G4 (244 aa)
                     fasta scores: E()=9e-18, 29.911% id in 224 aa; contains 50
                     amino acid N terminal extension"
                     /db_xref="EnsemblGenomes-Gn:BCAM0228"
                     /db_xref="EnsemblGenomes-Tr:CAR54086"
                     /db_xref="GOA:B4EHQ9"
                     /db_xref="InterPro:IPR001867"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="InterPro:IPR016032"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="InterPro:IPR039420"
                     /db_xref="UniProtKB/TrEMBL:B4EHQ9"
                     /protein_id="CAR54086.1"
                     /translation="MDGVTPLAARNLSGHDRALLSSLAHARCDRIVTDAPSTAIAILT
                     IDHPSRGTFDDRLRRAGYGYDRLRIDDILRRAGYRPSRFEYLPDLLTTCDTRAFDLFI
                     VQCETACRRTTDAIQALRARFAGTVAIVSISQRDAELARSACFVAGANEHHSYTVPPD
                     TLIASIATWLRWSHHRATHHRHWRIGAFEFDTATRSVNVAGREHVLTEKHFQIATAFF
                     LNMGRALDRAHVSQLVWGSLVAASSRRLDTHVAYLRDRLELDGRHGVKMMTMYGFGYR
                     LVTCEPGAEPAEEDAARQ"
     misc_feature    complement(284863..285093)
                     /locus_tag="BCAM0228"
                     /note="HMMPfam hit to PF00486, Transcriptional regulatory
                     protein, C ter, score 6.1e-06"
                     /inference="protein motif:HMMPfam:PF00486"
     CDS             285989..287419
                     /transl_table=11
                     /locus_tag="BCAM0229"
                     /product="two-component regulatory system, sensor kinase
                     protein"
                     /note="C terminus is similar to C terminus Chromobacterium
                     violaceum probable two-component sensor (ec 2.7.3.-).
                     UniProt:Q7NVL8 (417 aa) fasta scores: E()=3.3e-20, 36.290%
                     id in 248 aa"
                     /db_xref="EnsemblGenomes-Gn:BCAM0229"
                     /db_xref="EnsemblGenomes-Tr:CAR54087"
                     /db_xref="GOA:B4EHR0"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR036097"
                     /db_xref="InterPro:IPR036890"
                     /db_xref="UniProtKB/TrEMBL:B4EHR0"
                     /protein_id="CAR54087.1"
                     /translation="MKPSFRIAALAAWLSLSLAGTAFVVSRAVSDAYNRFFQDSSITI
                     RLLAQKAAQHEAILATLGASSLAAPPAHMLDNLRERMPQLDGLAYWRPGAGWQTDGGP
                     SPDALPQQRPGKPFTLAFDGPAAYWLIAGTGWAVRVEPGQMLQPGDWSPAISSAALEL
                     RDRRVELLQRVKDDATPLWTMHLDKHLPVQPQAFVLRTTRTLTAADLPWLPIALWNAV
                     AALLAAGALGAWRLREARRREDARARLDRFGRLDTFGEMAAGLAHELNQPLTAIVSHT
                     RAAERLLDQPAERDSVRRALQTSVAQAKRAAAILERMREAVTTAHGGERRPLDPDAIM
                     QTLLFLYRDDCAREQIALVWHNAAVRARPFAEPIAVEQILHNLIQNARDALAGTSRGE
                     IRVSGAHVGKHYRFSVTDNGPGVPEDALPRLFEPFFTTRSRGLGLGLPLCDTLAQRQD
                     GTLTVRNLPSGGVEAALLLPLAGEVA"
     sig_peptide     285989..286060
                     /locus_tag="BCAM0229"
                     /note="Signal peptide predicted for BCAM0229 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 0.522 between residues 24 and 25"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    join(285998..286066,286607..286675)
                     /locus_tag="BCAM0229"
                     /note="2 probable transmembrane helices predicted for
                     BCAM0229 by TMHMM2.0 at aa 4-26 and 207-229"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    286745..286954
                     /locus_tag="BCAM0229"
                     /note="HMMPfam hit to PF00512, His Kinase A
                     (phosphoacceptor) domain, score 7e-09"
                     /inference="protein motif:HMMPfam:PF00512"
     misc_feature    287081..287404
                     /locus_tag="BCAM0229"
                     /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
                     gyrase B-, and HSP90, score 1e-30"
                     /inference="protein motif:HMMPfam:PF02518"
     CDS             287416..288060
                     /transl_table=11
                     /locus_tag="BCAM0230A"
                     /product="two-component regulatory system, response
                     regulator protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0230A"
                     /db_xref="EnsemblGenomes-Tr:CAR54088"
                     /db_xref="GOA:B4EHR1"
                     /db_xref="InterPro:IPR000792"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="InterPro:IPR016032"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="UniProtKB/TrEMBL:B4EHR1"
                     /protein_id="CAR54088.1"
                     /translation="MTDSLRPAATCDASVVAIVDDDEAVRDGLALLLRTVGVPTRRYP
                     DASAFLADADDAALGCVLLDIRMPGMSGLDALDELRARRDLPVIVMTGHGNVDACRRA
                     FKRGALDFLRKPVDDDELIDTVQQALRRQAAQRGQDDADQTRAARLATLSTREREVLE
                     GIVRGGSNKAIARALGLSPRTVETYRANVFDKLQAASLVELVRDYAALAGGSPP"
     misc_feature    287455..287790
                     /locus_tag="BCAM0230A"
                     /note="HMMPfam hit to PF00072, Response regulator receiver
                     domain, score 8.3e-28"
                     /inference="protein motif:HMMPfam:PF00072"
     misc_feature    287836..287994
                     /locus_tag="BCAM0230A"
                     /note="HMMPfam hit to PF08281, Sigma-70, region, score
                     0.0031"
                     /inference="protein motif:HMMPfam:PF08281"
     misc_feature    287857..288033
                     /locus_tag="BCAM0230A"
                     /note="HMMPfam hit to PF00196, Bacterial regulatory
                     proteins, luxR fami, score 1.2e-21"
                     /inference="protein motif:HMMPfam:PF00196"
     misc_feature    287908..287991
                     /note="PS00622 Bacterial regulatory proteins, luxR family
                     signature."
                     /inference="protein motif:Prosite:PS00622"
     misc_feature    287911..287976
                     /note="Predicted helix-turn-helix motif with score
                     1411.000, SD 3.99 at aa 166-187, sequence
                     GSNKAIARALGLSPRTVETYRA"
                     /inference="protein motif:helixturnhelix:EMBOSS"
     CDS             288168..288884
                     /transl_table=11
                     /locus_tag="BCAM0231"
                     /product="opacity family porin protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0231"
                     /db_xref="EnsemblGenomes-Tr:CAR54089"
                     /db_xref="InterPro:IPR011250"
                     /db_xref="InterPro:IPR027385"
                     /db_xref="UniProtKB/TrEMBL:B4EHR2"
                     /protein_id="CAR54089.1"
                     /translation="MIKCFALPSALALLFSGAAFADTVAAPETKKTADAGDAGYYATG
                     RVIGAFDNAVNMELTSPRVASRVGGPETGSNVTGSLGLGYQFGNGWRAEGEYVFKRTN
                     NFTSYWAPFDANANEFHVSAQRLMLNGYKDFDLGRGFSVYGTLGIGVAIVSADGWQTN
                     DTRRFASKTQTNLAYSAGAGVSYAINKRFSIDLGYRYVDMGNIETGFNTFANRINARD
                     EQLKSKLSSNEVFIGLRGRF"
     sig_peptide     288168..288230
                     /locus_tag="BCAM0231"
                     /note="Signal peptide predicted for BCAM0231 by SignalP
                     2.0 HMM (Signal peptide probability 1.000) with cleavage
                     site probability 1.000 between residues 21 and 22"
                     /inference="protein motif:SignalP:2.0"
     misc_feature    288411..288881
                     /locus_tag="BCAM0231"
                     /note="HMMPfam hit to PF02462, Opacity family porin
                     protein, score 0.00046"
                     /inference="protein motif:HMMPfam:PF02462"
     CDS             289221..290228
                     /transl_table=11
                     /locus_tag="BCAM0232"
                     /product="conserved hypothetical protein"
                     /note="C-terminus similar to Chlamydomonas reinhardtii
                     cgcr-4 product (fragment). UniProt:Q39598 (265 aa) fasta
                     scores: E()=0.00014, 35.616% id in 219 aa"
                     /db_xref="EnsemblGenomes-Gn:BCAM0232"
                     /db_xref="EnsemblGenomes-Tr:CAR54090"
                     /db_xref="UniProtKB/TrEMBL:B4EHR3"
                     /protein_id="CAR54090.1"
                     /translation="MSMQDITGHYAIPLVHPFSDVPPPYGRRRRPFVASRRARQLVFD
                     IHGAPRMPAPAEDGGGVAKAARPAKVVRAADFGSDNRAWVRPHPLRRRWRLTLMACAL
                     FGATCILATHLVDERQHAAEHDAAYSAAVTAAPTAAVAATEVARATGRPAEVAIVRAD
                     RAAPTDAQMKAAATVVAETASAEARALHVAGSGSAGEPVAVAMAVASNAVVAEAAAPR
                     ADRGSSARKPVAVAGARPAAKSAGASRGNAVRQAGANASAAQRAVTAARGATPHAQPA
                     ARAADTPTTAPVSSSAQAVGMTAAEFTQWLAATRDTSRSTAGGTDLTVELPSHTRLIP
                     R"
     repeat_region   290274..290290
                     /note="Direct repeat, 17mer, flanking Cenocepacia Island"
     misc_feature    290291..334378
                     /note="Cenocepacia Island"
                     /note="BcenGI11"
     CDS             290334..290681
                     /transl_table=11
                     /locus_tag="BCAM0233"
                     /product="ArsR family regulatory protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0233"
                     /db_xref="EnsemblGenomes-Tr:CAR54091"
                     /db_xref="GOA:B4EHR4"
                     /db_xref="InterPro:IPR001845"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR036388"
                     /db_xref="InterPro:IPR036390"
                     /db_xref="UniProtKB/TrEMBL:B4EHR4"
                     /protein_id="CAR54091.1"
                     /translation="METNETIAALAALAHESRLAVFRALVQAGPQGMPAGQIATLLDV
                     PPSSLSFHLKELAHAQLVTSRQEGRFVFYGANFDTMNGLLGYLTENCCGGNPCSPVSV
                     CSPSGKINRTRRS"
     misc_feature    290376..290525
                     /locus_tag="BCAM0233"
                     /note="HMMPfam hit to PF01022, Bacterial regulatory
                     protein, arsR family, score 0.0026"
                     /inference="protein motif:HMMPfam:PF01022"
     misc_feature    290430..290495
                     /note="Predicted helix-turn-helix motif with score
                     1327.000, SD 3.71 at aa 33-54, sequence
                     MPAGQIATLLDVPPSSLSFHLK"
                     /inference="protein motif:helixturnhelix:EMBOSS"
     CDS             290704..291198
                     /transl_table=11
                     /locus_tag="BCAM0234"
                     /product="putative arsenate reductase"
                     /db_xref="EnsemblGenomes-Gn:BCAM0234"
                     /db_xref="EnsemblGenomes-Tr:CAR54092"
                     /db_xref="InterPro:IPR023485"
                     /db_xref="InterPro:IPR036196"
                     /db_xref="UniProtKB/TrEMBL:B4EHR5"
                     /protein_id="CAR54092.1"
                     /translation="MTTNVLILCTHNSARSVLSEGMLNHWAAKLGKEVRAYSAGSAPS
                     GRLNPFALEALTNAGVDVRGCRSKSWDEFVGDGAPEMRVVITVCDSAASEACPYWPGS
                     PVKVHWGYADPSNATGGDDGKRLAFELTRQAIGYRMLQLLALPLDSMSDDALRAALIE
                     ISRH"
     misc_feature    290710..291135
                     /locus_tag="BCAM0234"
                     /note="HMMPfam hit to PF01451, Low molecular weight
                     phosphotyrosine protein, score 4.9e-24"
                     /inference="protein motif:HMMPfam:PF01451"
     CDS             291263..292360
                     /transl_table=11
                     /locus_tag="BCAM0235"
                     /product="putative sodium bile acid symporter family
                     protein"
                     /db_xref="EnsemblGenomes-Gn:BCAM0235"
                     /db_xref="EnsemblGenomes-Tr:CAR54093"
                     /db_xref="GOA:B4EI46"
                     /db_xref="InterPro:IPR002657"
                     /db_xref="InterPro:IPR004706"
                     /db_xref="InterPro:IPR038770"
                     /db_xref="UniProtKB/TrEMBL:B4EI46"
                     /protein_id="CAR54093.1"
                     /translation="MNTSNVTPPGNAVANPAINFFERYLSVWVALCIVAGIALGQALP
                     GPFQAVGRMAYAQVNLPVGLLIWVMIVPMLVKVDFGALHDVRRHAKGIGVTLVVNWLV
                     KPFSMAFLGWLFIRHLFAPLLPADQIDSYIAGLILLAAAPCTAMVFVWSRLTGGDPLF
                     TLSQVALNDSIMVIAFAPLVGLLLGMSAITVPWATLLTSVVLYIVMPVILAQMLRKRL
                     LAKGPTAFDAAMTRIGPWSIAALLATLVLLFAFQGEAILKQPLVIALLAVPILIQVFF
                     SSALAYGLNRAVGEQHDIACPSALIGASNFFELAVAAAISLFGFHSGAALATVVGVLI
                     EVPVMLLVVRLVNRSKGWYECRARDHGRTDP"
     misc_feature    join(291323..291391,291419..291487,291548..291607,
                     291650..291718,291755..291814,291827..291895,
                     291959..292018,292046..292114,292151..292219,
                     292232..292300)
                     /locus_tag="BCAM0235"
                     /note="10 probable transmembrane helices predicted for
                     BCAM0235 by TMHMM2.0 at aa 21-43, 53-75, 96-115, 130-152,
                     165-184, 189-211, 233-252, 262-284, 297-319 and 324-346"
                     /inference="protein motif:TMHMM:2.0"
     misc_feature    291449..292039
                     /locus_tag="BCAM0235"
                     /note="HMMPfam hit to PF01758, Sodium Bile acid symporter
                     fa