LOCUS       KZ503501             1498525 bp    DNA     linear   CON 21-DEC-2017
DEFINITION  Dendrobium catenatum unplaced genomic scaffold
            fragScaff_scaffold_1680, whole genome shotgun sequence.
ACCESSION   KZ503501 JSDN02000000
VERSION     KZ503501.1
DBLINK      BioProject: PRJNA262478
            BioSample: SAMN03083363
KEYWORDS    WGS.
SOURCE      Dendrobium catenatum
  ORGANISM  Dendrobium catenatum
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliophyta; Liliopsida; Asparagales; Orchidaceae;
            Epidendroideae; Malaxideae; Dendrobiinae; Dendrobium.
REFERENCE   1  (bases 1 to 1498525)
  AUTHORS   Zhang,G.Q., Xu,Q., Bian,C., Tsai,W.C., Yeh,C.M., Liu,K.W.,
            Yoshida,K., Zhang,L.S., Chang,S.B., Chen,F., Shi,Y., Su,Y.Y.,
            Zhang,Y.Q., Chen,L.J., Yin,Y., Lin,M., Huang,H., Deng,H.,
            Wang,Z.W., Zhu,S.L., Zhao,X., Deng,C., Niu,S.C., Huang,J., Wang,M.,
            Liu,G.H., Yang,H.J., Xiao,X.J., Hsiao,Y.Y., Wu,W.L., Chen,Y.Y.,
            Mitsuda,N., Ohme-Takagi,M., Luo,Y.B., Van de Peer,Y. and Liu,Z.J.
  TITLE     The Dendrobium catenatum Lindl. genome sequence provides insights
            into polysaccharide synthase, floral development and adaptive
            evolution
  JOURNAL   Sci Rep 6, 19029 (2016)
   PUBMED   26754549
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1498525)
  AUTHORS   Zhang,G.Q., Liu,K.W., Li,Z., Lohaus,R., Hsiao,Y.Y., Niu,S.C.,
            Wang,J.Y., Lin,Y.C., Xu,Q., Chen,L.J., Yoshida,K., Fujiwara,S.,
            Wang,Z.W., Zhang,Y.Q., Mitsuda,N., Wang,M., Liu,G.H., Pecoraro,L.,
            Huang,H.X., Xiao,X.J., Lin,M., Wu,X.Y., Wu,W.L., Chen,Y.Y.,
            Chang,S.B., Sakamoto,S., Ohme-Takagi,M., Yagi,M., Zeng,S.J.,
            Shen,C.Y., Yeh,C.M., Luo,Y.B., Tsai,W.C., Van de Peer,Y. and
            Liu,Z.J.
  TITLE     The Apostasia genome and the evolution of orchids
  JOURNAL   Nature 549 (7672), 379-383 (2017)
   PUBMED   28902843
REFERENCE   3  (bases 1 to 1498525)
  AUTHORS   Zhang,G.-Q., Xu,Q., Liu,K.-W., Chen,F., Hsiao,Y.-Y., Yoshida,K.,
            Su,Y.-Y., Zhang,Y.-Q., Chen,L.-J., Deng,H., Zhu,S.-L., Zhao,X.,
            Deng,C., Niu,S.-C., Huang,J., Wang,M., Liu,G.-H., Yang,H.-J.,
            Mitsuda,N., Yeh,C.-M., Tsai,W.-C., Zhang,L.-S., Wang,Z.-W.,
            Luo,Y.-B., Bian,C. and Liu,Z.-J.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-OCT-2014) Shenzhen Key Laboratory for Orchid
            Conservation and Utilization, The National Orchid Conservation
            Center of China, and the Orchid Conservation and Research Center of
            Shenzhen, No. 889 Wangtong Road, Shenzhen, Guangdong 518114, China
REFERENCE   4  (bases 1 to 1498525)
  AUTHORS   Zhang,G.-Q., Xu,Q., Bian,C., Tsai,W.-C., Yeh,C.-M., Liu,K.-W.,
            Yoshida,K., Zhang,L.-S., Chang,S.-B., Chen,F., Shi,Y., Su,Y.-Y.,
            Zhang,Y.-Q., Chen,L.-J., Yin,Y., Lin,M., Huang,H., Deng,H.,
            Wang,Z.-W., Zhu,S.-L., Zhao,X., Deng,C., Niu,S.-C., Huang,J.,
            Wang,M., Liu,G.-H., Yang,H.-J., Xiao,X.-J., Hsiao,Y.-Y., Wu,W.-L.,
            Chen,Y.-Y., Mitsuda,N., Ohme-Takagi,M., Luo,Y.-B., Van De Peer,Y.
            and Liu,Z.-J.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-NOV-2017) Shenzhen Key Laboratory for Orchid
            Conservation and Utilization, The National Orchid Conservation
            Center of China, Wangtong Road, Shenzhen 518114, China
COMMENT     ##Genome-Assembly-Data-START##
            Assembly Date          :: 10-MAY-2014
            Assembly Method        :: platanus v. 1.2.1
            Genome Representation  :: Full
            Expected Final Version :: Yes
            Genome Coverage        :: 202.0x
            Sequencing Technology  :: Illumina HiSeq
            ##Genome-Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..1498525
                     /organism="Dendrobium catenatum"
                     /mol_type="genomic DNA"
                     /submitter_seqid="fragScaff_scaffold_1680"
                     /specimen_voucher="NOCC:Z.J. Liu 4979"
                     /db_xref="taxon:906689"
                     /chromosome="Unknown"
                     /sex="hermaphrodite"
                     /tissue_type="The whole plant"
                     /dev_stage="Growing period"
                     /country="China: Yunan, Guangnan County"
                     /lat_lon="23.57 N 104.59 E"
                     /collection_date="2012-09-17"
                     /collected_by="Zhong-Jian Liu"
     assembly_gap    9109..9208
                     /estimated_length=100
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     assembly_gap    22340..22453
                     /estimated_length=114
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     assembly_gap    30019..41100
                     /estimated_length=11082
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     assembly_gap    44800..45272
                     /estimated_length=473
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     assembly_gap    61837..62408
                     /estimated_length=572
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            complement(77247..88804)
                     /locus_tag="MA16_Dca013349"
     mRNA            complement(join(77247..77339,77452..77529,77606..77683,
                     77769..77843,78053..78139,78734..78862,88748..88804))
                     /locus_tag="MA16_Dca013349"
                     /product="Uncharacterized protein"
     CDS             complement(join(77247..77339,77452..77529,77606..77683,
                     77769..77843,78053..78139,78734..78862,88748..88804))
                     /locus_tag="MA16_Dca013349"
                     /codon_start=1
                     /product="Uncharacterized protein"
                     /protein_id="PKU63305.1"
                     /db_xref="InterPro:IPR002791"
                     /translation="MSGKDSGRARSARKLTRPQLAEVFAKDGLSFLASCQNLVSRPWV
                     IDDLDSFKTNWAKKSWKKAIIFVDNSGADIVLGILPFARELLKRGTQVVLAANDLPSI
                     NDVTYPELVEIISKLKDEKGQLVGVDASGLLVANSGNDLPVIDLANVSPELAYLASDA
                     DLVVLEGMGRSIETNLYAQMKCDSVKIGMVVIAVLLIE"
     gene            131917..158535
                     /locus_tag="MA16_Dca013350"
     mRNA            join(131917..132041,137407..137497,149328..149361,
                     158270..158535)
                     /locus_tag="MA16_Dca013350"
                     /product="hypothetical protein"
     CDS             join(131917..132041,137407..137497,149328..149361,
                     158270..158535)
                     /locus_tag="MA16_Dca013350"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKU63306.1"
                     /translation="MATPFPYRFQEDSRTGVFCANEEFGACRDFRISSLAFFPPLWFP
                     RQQLKAHGFQQRAAKRMPNGIINSTVSSKFQFNCMSKLPLTGHLSVGSRRLCARYSDV
                     YILDDLDDDVDFSVRFVFHKLLFLTIVVIVSTAFLSSCLACRACSFVAVRSCSDHPSG
                     GSSRDRSASIC"
     assembly_gap    135346..136769
                     /estimated_length=1424
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            complement(160172..160672)
                     /locus_tag="MA16_Dca013351"
     mRNA            complement(160172..160672)
                     /locus_tag="MA16_Dca013351"
                     /product="Regulator of ribonuclease-like protein 3"
     CDS             complement(160172..160672)
                     /locus_tag="MA16_Dca013351"
                     /codon_start=1
                     /product="Regulator of ribonuclease-like protein 3"
                     /protein_id="PKU63307.1"
                     /db_xref="InterPro:IPR005493"
                     /translation="MACLATSEICDTNQALVIKGDVRVLQPIFQIYGQCRAFSGPIVT
                     LKVFEDNVLVRDMLESPGDGRVLVIDGGGSTRCALVGGNLGQLAQNMGWAGILVNGCI
                     RDVDEINACDIGVRALGSNPLKSSKKGHGDKHVPVNVWGTVIHDGEWLYADSDGILIS
                     KSELSV"
     gene            complement(168976..176850)
                     /gene="UVR8"
                     /locus_tag="MA16_Dca013352"
     mRNA            complement(join(168976..169463,175273..175585,
                     175921..176137,176531..176850))
                     /gene="UVR8"
                     /locus_tag="MA16_Dca013352"
                     /product="Ultraviolet-B receptor UVR8"
     CDS             complement(join(168976..169463,175273..175585,
                     175921..176137,176531..176850))
                     /gene="UVR8"
                     /locus_tag="MA16_Dca013352"
                     /codon_start=1
                     /product="Ultraviolet-B receptor UVR8"
                     /protein_id="PKU63308.1"
                     /db_xref="InterPro:IPR000408"
                     /translation="MKRSLLNGARLRTCGGAIVVAARSICSGGSWRSTSVWSFGDNSN
                     GALGISSPLLDAYEPTKVPSLPANVTTIASGHYHSLAVNADGEVWAWGRNEEGQLGRG
                     LDAPRDKWRQPERVLGLDDVNVQAAYASGVVSAAVGDDGSLWVWGRSKRGQLGLGKGV
                     TEAVKPTKVEALLGHEICKVSFGWGHALAFTRDGKLFGWGYAEDGRLGKMGEALISSS
                     VQEPNFYSSLDKSVSMFDVAEKLVAEKMEKENNMPIIWAPSLVQELSSIEVSDAACGL
                     DHSLVLCCDGTVFSSGDNTLGQLGRDTEGTKMLPVQINNFHPISLAAGLGHSLFLYLI
                     PSKGEAEEATGILSWGWNCSSQLGRHGPEKVPSPVAGLDVKRLVSVSAGRVHSISLTS
                     KGEVFTWGSGRNGRLGLGSSADEAEPTFVECLEGLEVLQAIAGFDHNLLLIAD"
     gene            177604..177846
                     /locus_tag="MA16_Dca013353"
     mRNA            177604..177846
                     /locus_tag="MA16_Dca013353"
                     /product="hypothetical protein"
     CDS             177604..177846
                     /locus_tag="MA16_Dca013353"
                     /note="GO_function: GO:0008270 - zinc ion binding
                     [Evidence IEA]"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKU63309.1"
                     /db_xref="InterPro:IPR010666"
                     /translation="MSSVNSSVRQEIRQHSQVYCHCHLKCVVYTCYRGLNRGKQFYRC
                     IHNRTDDDCNFFKWINELEEPSLDTHYAWRGIDEKV"
     gene            complement(179134..180614)
                     /locus_tag="MA16_Dca013354"
     mRNA            complement(join(179134..179664,179739..180614))
                     /locus_tag="MA16_Dca013354"
                     /product="hypothetical protein"
     CDS             complement(join(179134..179664,179739..180614))
                     /locus_tag="MA16_Dca013354"
                     /note="GO_function: GO:0008270 - zinc ion binding
                     [Evidence IEA]"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKU63310.1"
                     /db_xref="InterPro:IPR004332"
                     /db_xref="InterPro:IPR006564"
                     /db_xref="InterPro:IPR007527"
                     /db_xref="InterPro:IPR018289"
                     /translation="MGAKDLEVGTLFNDAITFKNALRSIAIRNNFGVIIKASDKKRVI
                     ATCSYQTCQWRIRASLCEDTQSFQIRRVDGVHTCPGVNRAGNRLATSAWVANEIQDLV
                     KRHPDIPPKEIKSNLEKEYGLSVPYMKLWRAREQARDAIFGSVDDSYKWVPTLKAELL
                     ERNPGSHITYTFDSSDHAFQRFYVSFKVCADGFLSGCRPLISVDACHLKSKYLGMLLS
                     ANALDGNNGLFNIAYAVVETESKQTWTWFLSNLGDTIGRNLHPLAFISDMEKGLGDAI
                     REIYPEAEHRVCIRHLCLHNTIDFNEKLAEVSNVSPKVHSYLLSLPYKWSISQFMIGI
                     NHAANTNNFAESFNSWIVEARNKPVVDLVDIIRGMLMEQRDMRKMNSMTWHRELVPQE
                     EEYIRNITTRKDHLIVRQSSVWKAEVEGVHSRHIVDVEKRECTCRVWEVTGLPCIHVV
                     AFIGMKEHPLWHSYIDEH"
     gene            complement(185005..185313)
                     /locus_tag="MA16_Dca013355"
     mRNA            complement(185005..185313)
                     /locus_tag="MA16_Dca013355"
                     /product="hypothetical protein"
     CDS             complement(185005..185313)
                     /locus_tag="MA16_Dca013355"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKU63311.1"
                     /translation="MSSSQRTLVVYPNSTSAQPLNSNEKGSFGPLIAVVSVILVLTVA
                     ACIIGHFCARRYLRPRPRRDQPVYYSKDDLEGLPESRSPAAAAGGGIPAGGSAIHGAA
                     "
     gene            195850..208718
                     /locus_tag="MA16_Dca013356"
     mRNA            join(195850..195852,202097..202231,202306..202461,
                     202937..203059,207490..207633,208176..208718)
                     /locus_tag="MA16_Dca013356"
                     /product="hypothetical protein"
     CDS             join(195850..195852,202097..202231,202306..202461,
                     202937..203059,207490..207633,208176..208718)
                     /locus_tag="MA16_Dca013356"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKU63312.1"
                     /db_xref="InterPro:IPR003863"
                     /translation="MALANDNKMKQSLDAHVCERQRWLATPSSLQELLMKIPHRLHNC
                     LQSGLKKHKQKLDNTNFLAIGEKDSCKTWKVDLERQMQAWRENSYWLDHPPELKVSVP
                     EGSLCNLNVKCNVGLPPDAVFNIVIDPENKRVFKNIKEVISRRVLVDEGPRQVVEVEQ
                     AVIWRFLWWSGTMSIQVLVDQNRMDHTIKFKQGKSGFMKRFEGTWKVEPLFLDKELCS
                     PCEPKSWLEYDTCSGGKGRVGSIVSLDQLIQPALVPPPPISWYLRGVTERTTEMLIYD
                     LFAEARRLRGAAAMNSTPKHGLEAAHDQQRGVAVNRSTEIQERWRMQRVAAEADKIIG
                     FAVNGSTDIKERWRHRRSKRKQSSYKALFADAC"
     gene            216075..219142
                     /gene="MYB305"
                     /locus_tag="MA16_Dca013357"
     mRNA            join(216075..216240,216372..216501,218821..219142)
                     /gene="MYB305"
                     /locus_tag="MA16_Dca013357"
                     /product="Myb-related protein 305"
     CDS             join(216075..216240,216372..216501,218821..219142)
                     /gene="MYB305"
                     /locus_tag="MA16_Dca013357"
                     /note="GO_function: GO:0003682 - chromatin binding
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Myb-related protein 305"
                     /protein_id="PKU63313.1"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR017930"
                     /translation="MGDQVEAISVDKRINNNEESEVVRKGPWTMEEDLILINYIAIHG
                     EGVWNNLARSAGLKRTGKSCRLRWLNYLRPDVRRGNITPEEQLLIMDLHSRWGNRWSK
                     IARQLPGRTDNEIKNYWRTRIQKKVKDGEPVDCSSQIVNDEGSSSHAGGLEEAMAAQP
                     SYPIYSDIANPHEAYVPAAYSGSINTSETYLSAEDFWAVQSLNGL"
     assembly_gap    241693..241702
                     /estimated_length=10
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            complement(258869..259150)
                     /gene="RAD"
                     /locus_tag="MA16_Dca013358"
     mRNA            complement(258869..259150)
                     /gene="RAD"
                     /locus_tag="MA16_Dca013358"
                     /product="Transcription factor RADIALIS"
     CDS             complement(258869..259150)
                     /gene="RAD"
                     /locus_tag="MA16_Dca013358"
                     /note="GO_function: GO:0003682 - chromatin binding
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Transcription factor RADIALIS"
                     /protein_id="PKU63314.1"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR017884"
                     /translation="MASSTASRNSSSGWSKSQNKLFERALAVYDKDTPDRWQNVARFV
                     GGGKSVDDVRLHYERLLEDVRRIESGHVPYPNYRSTGGNEEQRYVRSNR"
     gene            complement(276761..277193)
                     /locus_tag="MA16_Dca013359"
     mRNA            complement(join(276761..276926,277015..277193))
                     /locus_tag="MA16_Dca013359"
                     /product="Anaphase-promoting complex subunit 10"
     CDS             complement(join(276761..276926,277015..277193))
                     /locus_tag="MA16_Dca013359"
                     /codon_start=1
                     /product="Anaphase-promoting complex subunit 10"
                     /protein_id="PKU63315.1"
                     /db_xref="InterPro:IPR004939"
                     /translation="MATESDGEEDTTGKLSGSQNLAVDDDSREMAKKAAWSVSSCKPG
                     NGVPSLRDDNLETYWQSDGAQPHLVNIQFQKKVKLHVMFCLRFFFLACSRNFDLRMIF
                     FLFFFPVIGTLC"
     gene            complement(284570..302053)
                     /gene="RER1B"
                     /locus_tag="MA16_Dca013360"
     mRNA            complement(join(284570..284777,301704..302053))
                     /gene="RER1B"
                     /locus_tag="MA16_Dca013360"
                     /product="Protein RER1B"
     CDS             complement(join(284570..284777,301704..302053))
                     /gene="RER1B"
                     /locus_tag="MA16_Dca013360"
                     /note="GO_component: GO:0016021 - integral to membrane
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Protein RER1B"
                     /protein_id="PKU63316.1"
                     /db_xref="InterPro:IPR004932"
                     /translation="MEGASGDASGAYIALARWKNDFSRAFQYYLDRSTPHRVERWLGT
                     LAVALIYLLRVYLIQGFYIVTYGLGIYLLNLLIGFLSPIADPEVEGLDGASLPTRGSD
                     EFKPFIRRLPEFKFWYSITKAICIAFVMSFFSFFDVPVFWPILLFYWIVLFFLTMKRQ
                     IMHMIKYKYIPFNTGKQVSVVHYLL"
     assembly_gap    314266..314365
                     /estimated_length=100
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            318683..319927
                     /locus_tag="MA16_Dca013361"
     mRNA            318683..319927
                     /locus_tag="MA16_Dca013361"
                     /product="hypothetical protein"
     CDS             318683..319927
                     /locus_tag="MA16_Dca013361"
                     /note="GO_process: GO:0015074 - DNA integration [Evidence
                     IEA]"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKU63317.1"
                     /db_xref="InterPro:IPR001584"
                     /translation="MAPITECLKLKAFNWGTEQELSFNKIKEALTTAPILALPSFEKL
                     FTVDTDASSIGIGAVLSQEGRPVAYFSEKLCPARRNWAAYEQELYAVVRALKQWESYL
                     LHQDFVLCSDNKALQHINTQKNISRMHACWLVFLQRFSFTLKHKPGTENRVADALSRR
                     AILLTWMQAELVGLEHVTELYADDEDFAAIWAKCLQSSHCEEYSIRQGFLFKHHLLCI
                     PISSWRQHLICETHCGGLAAHLGQDNTLRQLQARFYWPRLRRDTLRFVESCAVCQAYK
                     GGAQNSGLYMPLPVPKSIWEDISMDFVLGLPRTRRGNDSILVVVDRFSKMSHFLSCKK
                     TSNALNIATLFFNEVVRLHGLPKSITSDRDVKFISHFWRELWKRLGTDLKFSSAYHPQ
                     PDGQTEVVNRTLGNMLRCLVHE"
     gene            320114..320464
                     /locus_tag="MA16_Dca013362"
     mRNA            320114..320464
                     /locus_tag="MA16_Dca013362"
                     /product="hypothetical protein"
     CDS             320114..320464
                     /locus_tag="MA16_Dca013362"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKU63318.1"
                     /translation="MLAEVRQQIIKSNARYKAAADVHRRERLFKEGDLVMVRLRRERF
                     PPGAYSKLAKRKIGPVPILAKINDNAYRIELPADCNTSSTFNVADISPYKPADDAIVL
                     ISSSESSSSEAGED"
     gene            343895..352391
                     /locus_tag="MA16_Dca013363"
     mRNA            join(343895..345485,345683..345708,351684..352391)
                     /locus_tag="MA16_Dca013363"
                     /product="F-box protein"
     CDS             join(343895..345485,345683..345708,351684..352391)
                     /locus_tag="MA16_Dca013363"
                     /codon_start=1
                     /product="F-box protein"
                     /protein_id="PKU63319.1"
                     /translation="MSDNDAPTCKEGDVIEQFRGKNISASQTPYMGQWMAHWMQPCKS
                     SSSKDCQLHSDALADNILHKFEGHDSSELDRLKSKEFKFVRVDMNQRYSFVDKGKSNL
                     AAEDDPSSYDIRSGEPCVDREKFKIKENFSMRRNVEPINDGRTFCKKLSAQQLTESSI
                     KWKKIGSYCCHSLDVSESNFEHLPMLDINREIETMLASKEKSAYGAVSVKMVKENLSL
                     CESIGTSSLVELAPGSCLAARKITDDAEKMMTTYEGFLPDSAVGMDGASSPVIHGCKY
                     QKENMIACIFSSGLTNVDPHNKLTCVQHNLCSCSSSSKSRTTETKGKIYSISKGFRNS
                     WTSLKGGSNHVLSESSPTDFLYSFSTEGHGSEVKADSSSWLLLDQRRLGKPDGSDINH
                     LPCQMPKCSIHDMSLTESCQNLKSVEIGERFHKFSSTVKYLLVTDKMGKDQCLRERTM
                     GDSPFTQVNGNTLSKTVTIPTELSCGKKEKSAVRLENFVSDEDRDDRNDSGVHLMGEH
                     NEFSTKVDTISTHPLHGSSSLPGESISSPQKATAYSNLRNSKTTSASSAREVSIRNAE
                     IGMAKREEHLASIDEVTHASHTEASVSSTESLAADHIVKVPDVSSSSLLADHTSGSET
                     CSRWIKRLRGNHSESLSLCTKRFKKGEDSIEIQQSSSRIQNHNPLSSGSLGFMKEHDN
                     SENVLPCGDSDESLQLWIRRWCRNDHEVSQTLSTPSVPLALQPEKLGVPHEKFEGKMS
                     ASIGAMALMGRAMNKYTPCRFRREEASLVWNTEE"
     gene            complement(355300..356725)
                     /locus_tag="MA16_Dca013364"
     mRNA            complement(join(355300..355384,355731..355819,
                     356220..356339,356633..356725))
                     /locus_tag="MA16_Dca013364"
                     /product="Aspartic proteinase oryzasin-1"
     CDS             complement(join(355300..355384,355731..355819,
                     356220..356339,356633..356725))
                     /locus_tag="MA16_Dca013364"
                     /note="GO_function: GO:0004190 - aspartic-type
                     endopeptidase activity [Evidence IEA];
                     GO_process: GO:0006508 - proteolysis [Evidence IEA];
                     GO_process: GO:0006629 - lipid metabolic process [Evidence
                     IEA]"
                     /codon_start=1
                     /product="Aspartic proteinase oryzasin-1"
                     /protein_id="PKU63320.1"
                     /db_xref="InterPro:IPR001461"
                     /db_xref="InterPro:IPR007856"
                     /db_xref="InterPro:IPR008139"
                     /translation="MCSACEMAVVWMQNQLKQNQTVELILNYVNQLCERLPSPMGESA
                     VDCNSLSLMPAVSFTIGGKKFDLTAEQYVLKVGEGPIAQCISGFTALDVPPPRGPLWI
                     LGDVFMGVYHTEFDYGNLRVGFAKAS"
     assembly_gap    372094..372141
                     /estimated_length=48
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            377045..397929
                     /gene="ISPG"
                     /locus_tag="MA16_Dca013365"
     mRNA            join(377045..377264,377983..378140,378329..378435,
                     378523..378623,378707..378783,384881..385000,
                     385099..385329,385837..386004,386755..386871,
                     387004..387078,387151..387228,387453..387512,
                     387616..387678,390927..391199,394783..394927,
                     395464..395605,395753..395830,396056..396189,
                     396505..396533,396595..396699,397828..397929)
                     /gene="ISPG"
                     /locus_tag="MA16_Dca013365"
                     /product="4-hydroxy-3-methylbut-2-en-1-yl diphosphate
                     synthase, chloroplastic"
     CDS             join(377045..377264,377983..378140,378329..378435,
                     378523..378623,378707..378783,384881..385000,
                     385099..385329,385837..386004,386755..386871,
                     387004..387078,387151..387228,387453..387512,
                     387616..387678,390927..391199,394783..394927,
                     395464..395605,395753..395830,396056..396189,
                     396505..396533,396595..396699,397828..397929)
                     /gene="ISPG"
                     /locus_tag="MA16_Dca013365"
                     /note="GO_function: GO:0046429 -
                     4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
                     activity [Evidence IEA];
                     GO_process: GO:0016114 - terpenoid biosynthetic process
                     [Evidence IEA];
                     GO_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="4-hydroxy-3-methylbut-2-en-1-yl diphosphate
                     synthase, chloroplastic"
                     /protein_id="PKU63321.1"
                     /db_xref="InterPro:IPR004588"
                     /translation="MMVAGTISTCFPTLKGTEYGLSFAKTVDFAKIASDPNSKKSWHC
                     KSKVFMIRNSSSGSETVELQPASEGSPLLVPRQKYCESVHKTVRRKTRTVMVGNVALG
                     SQHPIRIQTMTTSDTKDVAKTVEEVMRIADKGADIVRITVQGKREADACFEIKNSLVQ
                     NNYNIPLVADIHFAPSVALRVAECFDKIRVNPGNFADRRAQFVKLEYDEEDYQKELEH
                     IEEVFSPLVDKCKKYGRAMRIGTNHGSLSDRIMSYYGDSPRGMVESAFEFARICRKLD
                     FHNFIFSMKASNPVIMVQAYRLLVAEMYVQGWDYPLHLGVTEAGEGEDGRMKSAIGIG
                     TLLQKRTATKGCGSSLQKAGGRWLVLLEEEQQLSGGLVEKQKQSRTVGRRAIAFRKEE
                     FADGLGDTIRVSLTEPPEEEIDPCRKLASLGMRAANIQKGVAPFEEKNRRYFDFQRRS
                     GQLPVQKEGDEVDYRGVLHRDGSVLMSVSLDKLKTPELLYRSLAAKLVVGMPFKDLAT
                     VDSILLKEVPPVDDADAWKSIDMLFSFSRVKEGVQEDSGDNWRLFIFCGDFFHHFLHI
                     RQPLEGEISPREQSKHRRQHFGASWTAAAKSGALGQQSSSSIFCFLAFDKRLALKRLI
                     DISMGILVPLSEQLTRPLQNAIVLVNLKELSTGAYKLLPEGTRLAVTVRGDERYEELD
                     ILMKVADITMLLQCLPYSEEKVGRVHSSRRLFEYLQENSLNFPVIHHLQFPDGTERDD
                     LVIGAGSEAGALLVDGLGDGILIEAQDHDFDFLRDTSFNLLQVSSSSFQLQLIAIMGC
                     IVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRGIAMEGATEALIQLIKDHDRWVDP
                     PAEE"
     gene            404596..426489
                     /gene="TGD3"
                     /locus_tag="MA16_Dca013366"
     mRNA            join(404596..404790,407888..408016,411625..411720,
                     411944..412021,420239..420300,420425..420500,
                     424141..424248,426000..426175,426270..426354,
                     426451..426489)
                     /gene="TGD3"
                     /locus_tag="MA16_Dca013366"
                     /product="Protein TRIGALACTOSYLDIACYLGLYCEROL 3,
                     chloroplastic"
     CDS             join(404596..404790,407888..408016,411625..411720,
                     411944..412021,420239..420300,420425..420500,
                     424141..424248,426000..426175,426270..426354,
                     426451..426489)
                     /gene="TGD3"
                     /locus_tag="MA16_Dca013366"
                     /note="GO_function: GO:0000166 - nucleotide binding
                     [Evidence IEA];
                     GO_function: GO:0005524 - ATP binding [Evidence IEA];
                     GO_function: GO:0016887 - ATPase activity [Evidence IEA];
                     GO_function: GO:0017111 - nucleoside-triphosphatase
                     activity [Evidence IEA]"
                     /codon_start=1
                     /product="Protein TRIGALACTOSYLDIACYLGLYCEROL 3,
                     chloroplastic"
                     /protein_id="PKU63322.1"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /translation="MSSSVVYWANAWSMPMTGLQRASRLGGLLPGCRSWCSCSSSRKI
                     LCASTALPRNLGDGLASLESNSSNVGENSLEGTHVNDETNILIECKDVHKSFGEKQIL
                     RGLSFKIRHGEAVGIIGPSGTGKSTVLKIMAGLLAPDRGEVLICGRKRHGLVDDEEIA
                     GLRIGLVFQSAALFDSLTVRENVGFQLYENARMPQDKIAELVKENLAAVGLKGVEDRL
                     PSELSGGMKKRVALARSIIYDNTKEIVEPEVLLYDEPTAGLDPIASTVVEDLIRSVHL
                     KGESATRRLGKIASYVVVTHQHSTIRRAVDRLLFLYDGTIVWEGMTQEFTTSTNPIVK
                     QFASGSLDGPIKY"
     gene            complement(429295..463797)
                     /gene="DDB1"
                     /locus_tag="MA16_Dca013367"
     mRNA            complement(join(429295..429876,435028..435312,
                     438441..438792,439212..439486,439601..439876,
                     440154..440264,440462..440677,440778..440978,
                     441264..441372,441511..441617,441746..441955,
                     442144..442219,450450..450593,458676..458767,
                     458876..458935,463082..463130,463694..463797))
                     /gene="DDB1"
                     /locus_tag="MA16_Dca013367"
                     /product="DNA damage-binding protein 1"
     CDS             complement(join(429295..429876,435028..435312,
                     438441..438792,439212..439486,439601..439876,
                     440154..440264,440462..440677,440778..440978,
                     441264..441372,441511..441617,441746..441955,
                     442144..442219,450450..450593,458676..458767,
                     458876..458935,463082..463130,463694..463797))
                     /gene="DDB1"
                     /locus_tag="MA16_Dca013367"
                     /note="GO_component: GO:0005634 - nucleus [Evidence IEA];
                     GO_function: GO:0003676 - nucleic acid binding [Evidence
                     IEA]"
                     /codon_start=1
                     /product="DNA damage-binding protein 1"
                     /protein_id="PKU63323.1"
                     /db_xref="InterPro:IPR004871"
                     /translation="MSFWNYVVTAHKPTAVSHSCVGNFTSPQELNLIIAKCTRIEIHL
                     LSAHGLQPMLDVPIYGRIATLELFRPHGESQDLLFIATERYKFCVLQWDGEASELITR
                     YPMNADLSFSHSFLVGSLYNISLIAVVLFYEVIPFDNKGQLKEAFNIRLEELQVLDIK
                     FLYGCSKPTIAVLYQDNKDARHLKTYEVALKDKDFIEGPWSQNNLDNGAGLLIPVPLP
                     LGGVIIIGEETIVYCNGSSFKAIPIRPSITRAYGRIDPDGSRFLLGDNSGLLYLLVIS
                     HERERITGLKIEHLGETSVASSISYLDNAVVYVGSKYGDSQLIKLNLQPDEKGSYVEV
                     LEKYVNLGPIVDFCVVDLERQGQGQVVTCSGAYKDGSLRIVRNGIGINEQASVELQGI
                     KGLWSLRSSTTDPNDTFLVVSFISETRILAMNMEDELEETEIEGFYAQAQTLFCQNAL
                     HDQLVQVTASSVRLVSCTSRELQDQWIAPTGFSVNVATANATQVLLAIGGGHLVYLEI
                     GDGKLTEVKHIQLEYEISCLDINPIGEKANSSALAVVGMWTDISVRIFSLPSLDLITK
                     ESLGGEIIPRSVLICSFEGISYLLCALGDGHLFNFLLNLATGELSDRKKVSLGTQPIT
                     LRTFSSKDTTHVFAASDRPTVIYSSNKKLLYSNVNLKEVSHMCPFNSAAFPDSLAIAK
                     EGELSIGTIDDIQKLHIRSIPLGEHARRICHQEQSRTFAICSLKNCLINNDETEVHFV
                     RLLDDQTFEFISTYQLDTFEYGCSIISCSFSDDNNVYYSVGTAYVLPEENEPTKGRIL
                     VFVVEDGKLQLIAEKETKGAVYSLNAFNGKLLAAINQKIQLYKLMLREDGTRELQSEC
                     GHHGHILALYVQTRGDFIVVGDLMKSISLLLYKHEEGAIEERARDYNANWMTAVEILD
                     DDVYLGAENNFNLFTVRRNSDGATDEERGRLEVVGEYHLGEFVNRFRHGSLVMRLPDS
                     EAGNIPTVIFGTVNGVIGIVASLPHDHYVFLEKLQSNLVKVIKGVGGLSHEQWRSFNN
                     EKKTVDARNFLDGDLIESFLDLSRSRMEEISKTIGVSVEELCKRVEELTRLH"
     gene            complement(465365..482339)
                     /gene="ARF17"
                     /locus_tag="MA16_Dca013368"
     mRNA            complement(join(465365..465563,468848..469032,
                     470442..471616,471818..471965,472182..472257,
                     472471..472593,472656..472820,472911..473001,
                     479908..479992,480106..480261,480337..480393,
                     480483..480581,481380..481492,482282..482339))
                     /gene="ARF17"
                     /locus_tag="MA16_Dca013368"
                     /product="Auxin response factor 17"
     CDS             complement(join(465365..465563,468848..469032,
                     470442..471616,471818..471965,472182..472257,
                     472471..472593,472656..472820,472911..473001,
                     479908..479992,480106..480261,480337..480393,
                     480483..480581,481380..481492,482282..482339))
                     /gene="ARF17"
                     /locus_tag="MA16_Dca013368"
                     /note="GO_component: GO:0005634 - nucleus [Evidence IEA];
                     GO_function: GO:0003677 - DNA binding [Evidence IEA];
                     GO_function: GO:0046983 - protein dimerization activity
                     [Evidence IEA];
                     GO_process: GO:0006355 - regulation of transcription,
                     DNA-dependent [Evidence IEA];
                     GO_process: GO:0009725 - response to hormone stimulus
                     [Evidence IEA]"
                     /codon_start=1
                     /product="Auxin response factor 17"
                     /protein_id="PKU63324.1"
                     /db_xref="InterPro:IPR003311"
                     /db_xref="InterPro:IPR003340"
                     /db_xref="InterPro:IPR010525"
                     /db_xref="InterPro:IPR011525"
                     /translation="MRLSSSSLSSSDLTQQPQEGEQRCLNSELWHACAGPLVSLPVVG
                     TRVVYFPQGHSEQVAASTNKEIDSHIPNYPSLPPQLICQLHDVTMHADVETDEVYAQM
                     TLQPLNPQEQKDPYLPAELGAASKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPP
                     LDFSQQPPAQELVARDLHGNEWKFRHIFRGQPKRHLLTTGWSVFVSAKRLVTGDSVLF
                     IWNENNQLLLGIRRANRPQTVMPSSVISSDSMHIGLLAAAAHAAATNSRFTIFFNPRA
                     CPSEFVIPLAKYIKAVYHTRVSVGMRFRMLFETEESSVRRYMGTITGISDLNPVHWPN
                     SHWRSVKVGWDESTAAERQPRVSLWEIEPLTTFPMYPSPFSLRLKRPWPPGLPPLYGG
                     NIGDLGLNSALAWLRDSGNLGVQPLNFQGIGVSPYNQTRFDNSFGLKPDIYQATTAEA
                     IQDMRPMEPLKQVPTNLQFQHTPSIINRPNNLLSNQASQHSQSQHPFVQNSQENQGHN
                     HAQSSFLLQQLQQCQSFGDQQQQLKQIQQNPQVQRQQQQQQQQQHKQFYDQVISGIML
                     GQTMQPSVSQSLSPSLQKISSISHPLSFPDSNGNYVSTPGTSSLNGVLQPFSYEETSN
                     LFSSPMTSPLITSSPWLSKQTALEPLLPSGAQCVLPQVDQFSSLFSDIPRDTTMLAPF
                     PGRDCSNNHEGVDPQHLLFGANLELSPLLVQNGVSGLRSIGCETNTARVSHAANNFLS
                     VTEVDFQLNQALTNSGGLEESGLLHSPDNIGQEISQNGTYVKVYKSGTFGRSLDITRY
                     NSYPELRSELGRLFGLDLEDPLRSGWQLVFVDRENDVLLVGDDPWPEFVNNVWCIKIL
                     SLQEVQQMAKQGVNLINSAPLRKLSTGSCDNYIAQQESRNLSSEIMPVASLDY"
     gene            complement(501695..503254)
                     /gene="PRD1"
                     /locus_tag="MA16_Dca013369"
     mRNA            complement(501695..503254)
                     /gene="PRD1"
                     /locus_tag="MA16_Dca013369"
                     /product="Protein PRD1"
     CDS             complement(501695..503254)
                     /gene="PRD1"
                     /locus_tag="MA16_Dca013369"
                     /codon_start=1
                     /product="Protein PRD1"
                     /protein_id="PKU63325.1"
                     /translation="MLYLSINQDIHLHSLLREQRELQHSGSMGLKFLDLPMFNRYIMQ
                     NEGKLFQSSYPKSFGDLVGKNGVIIVHGEQQKRLHAIVDVRSKRVAINLMINQLMGVS
                     SASEIKEMACKFSDFLDGCIYVPINLGGFTYHTAMKERKGIIAKFKNIIANGQQQGGS
                     IERSGVLGSLVEEENLNDNPIADFILNLQSGSEAQTQTFANNLISSNLLTLCFAYLGL
                     FPTDQMRSNVYLILDRAFGPSFGQPMRDVFFYLPVDLLDLLFFLGQKSSIDPQLALCQ
                     CASLLFLYVSSHLGEGFADDTPVLASLEQYILVNSNYLFCMTGDSLMLAQSVHLYGLH
                     RGFQRNAKMSYSPETEKTLLNLLAIDDLELFSFCIHPMALKWLFQQERIMTYLSNQIL
                     KFCRLSRANESQLIVYPYGSQTMKMQLISALVVSGDNYVAQLLVSLMIELQGDGGEDD
                     MICVLNTMTEILSLLFAGNITFSSLQPDWFTIGSLLLAFTHPNKFVDIYQSCKIFDPG
                     GLLMIITPISF"
     gene            508039..512758
                     /gene="DRB6"
                     /locus_tag="MA16_Dca013370"
     mRNA            join(508039..508284,510618..510837,511704..512758)
                     /gene="DRB6"
                     /locus_tag="MA16_Dca013370"
                     /product="Double-stranded RNA-binding protein 6"
     CDS             join(508039..508284,510618..510837,511704..512758)
                     /gene="DRB6"
                     /locus_tag="MA16_Dca013370"
                     /codon_start=1
                     /product="Double-stranded RNA-binding protein 6"
                     /protein_id="PKU63326.1"
                     /db_xref="InterPro:IPR014720"
                     /translation="MYKNQLQELAQRSCFCLPSYTCIREGPDHAPRFKATVNFNGEIF
                     ESPSFCTTLRQAEHAAAEIALNALSSRGPSHSLAARILDETGVYKNLLQEVAQRVGAP
                     LPSYKTVRCGHGHHTSFTCAVELAEILFTGEPAKSKKQAEKNAAMAAWNSLKQLTRQE
                     VCSVTEPENNDELEQITVARALLNYRLKEKIAMENNPNAPPFPKRFLVHPDKKPPSLQ
                     TSSSASKILPMIRPRSTPRTRPSSPRATEDFCFQSHLSPLENQMAQQLKFHSAGAAPY
                     RSTYQHFRMSSAGMAAPVNIRTSVPVFSAPPLPPPPVYQHLPPVMNSPWRMAPPVHIR
                     PAVPVFEAPPALFSSQLQVTQIQVKEKHAVSPLHEIQFKEQFPSVSPHSAIQPKEQQP
                     SASKVSGTQAKFVPGRATVTAEEEKEEPSLLTAVQVKEETPAKVTVEPALMNSVLVNQ
                     EPVHVTSAQSKDITKTEASVEAPERAIVVSESSNSPAAKNDFPELEMLENLRTLKL"
     gene            complement(518243..530719)
                     /locus_tag="MA16_Dca013371"
     mRNA            complement(join(518243..518434,521586..521769,
                     530505..530719))
                     /locus_tag="MA16_Dca013371"
                     /product="CASP-like protein 2"
     CDS             complement(join(518243..518434,521586..521769,
                     530505..530719))
                     /locus_tag="MA16_Dca013371"
                     /codon_start=1
                     /product="CASP-like protein 2"
                     /protein_id="PKU63327.1"
                     /db_xref="InterPro:IPR006702"
                     /translation="MFSSRPSVHPVEAPPLTDVTENHPPRVRMKDIQGMPGTSGGLAL
                     RFFQFMFAAAALGVMVSANDFSSVTSFRLVVILRIANCNFSSFDRYLVAAAILQSLWS
                     LSLALLDVYALLVKRSLRNPLVNVLFAIGDGITSTLTFAAACASAGITVLIGNDLNIC
                     SQNHCTTFETATAMAFISWFAVSPSFLLNFWSLASR"
     assembly_gap    554590..559451
                     /estimated_length=4862
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     assembly_gap    587096..587195
                     /estimated_length=100
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     assembly_gap    611680..612297
                     /estimated_length=618
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     assembly_gap    629405..629933
                     /estimated_length=529
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     assembly_gap    687457..687556
                     /estimated_length=100
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     assembly_gap    691316..691415
                     /estimated_length=100
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     assembly_gap    695362..695461
                     /estimated_length=100
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     assembly_gap    699201..699300
                     /estimated_length=100
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            complement(705315..707180)
                     /locus_tag="MA16_Dca013372"
     mRNA            complement(join(705315..705543,706110..706183,
                     706623..706991,707166..707180))
                     /locus_tag="MA16_Dca013372"
                     /product="3-dehydrosphinganine reductase"
     CDS             complement(join(705315..705543,706110..706183,
                     706623..706991,707166..707180))
                     /locus_tag="MA16_Dca013372"
                     /note="GO_function: GO:0016491 - oxidoreductase activity
                     [Evidence IEA];
                     GO_process: GO:0008152 - metabolic process [Evidence IEA]"
                     /codon_start=1
                     /product="3-dehydrosphinganine reductase"
                     /protein_id="PKU63328.1"
                     /db_xref="InterPro:IPR002198"
                     /translation="MYYTEDTPEGTRVSILAQNPKRLEEAREAVHLTTSEEINVFNID
                     VRDTKAMSQAVEETGPIDVLVCNQGVLLPLELEKQELKEIKFMVDVNMMGTFHLIKAA
                     LPAMKWRTEETGLPASIALMSSQAGQVSMVKQHTLQANFLFEALVRRCSTRRARERRP
                     ELTNIIAGSSKGMEADDVAKASKNGIKSGRFIIPCNFEGTIIAIATCGLSPQSSFITT
                     FIEVAIANFL"
     gene            complement(791808..792029)
                     /gene="RPL35AC"
                     /locus_tag="MA16_Dca013373"
     mRNA            complement(791808..792029)
                     /gene="RPL35AC"
                     /locus_tag="MA16_Dca013373"
                     /product="60S ribosomal protein L35a-3"
     CDS             complement(791808..792029)
                     /gene="RPL35AC"
                     /locus_tag="MA16_Dca013373"
                     /note="GO_component: GO:0005622 - intracellular [Evidence
                     IEA];
                     GO_component: GO:0005840 - ribosome [Evidence IEA];
                     GO_function: GO:0003735 - structural constituent of
                     ribosome [Evidence IEA];
                     GO_process: GO:0006412 - translation [Evidence IEA]"
                     /codon_start=1
                     /product="60S ribosomal protein L35a-3"
                     /protein_id="PKU63329.1"
                     /db_xref="InterPro:IPR001780"
                     /translation="MSTKEDMGWYTGKRMVYNYKSNMKKKVTHYHCILGKVTRSHENS
                     GIVRAKCNTNLPPRSMGHKVRVYMYPSNI"
     assembly_gap    798442..798541
                     /estimated_length=100
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     assembly_gap    803581..807559
                     /estimated_length=3979
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     assembly_gap    826755..826854
                     /estimated_length=100
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     assembly_gap    916604..917293
                     /estimated_length=690
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     assembly_gap    936011..936771
                     /estimated_length=761
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            complement(950611..952476)
                     /gene="BURP12"
                     /locus_tag="MA16_Dca013374"
     mRNA            complement(950611..952476)
                     /gene="BURP12"
                     /locus_tag="MA16_Dca013374"
                     /product="BURP domain-containing protein 12"
     CDS             complement(950611..952476)
                     /gene="BURP12"
                     /locus_tag="MA16_Dca013374"
                     /codon_start=1
                     /product="BURP domain-containing protein 12"
                     /protein_id="PKU63330.1"
                     /db_xref="InterPro:IPR004873"
                     /translation="MDWFTLLLILISISLSAAATSPAPAKSSLNPFTEKAALLRYWNR
                     KIPNSSPYPAFLVSKLTPLSISNAAKFSTIAASDPFKLSSTLPTFCSAAALLCTAELT
                     PSLASHPGDSAFSTYDNSNFTNYGTEAGGRVSAFKNYFGNETPLSTFRRYGHSSGGHN
                     DTFAAYGPRGNIVGANFTSYGTSSAGSLDKFNSYSNSSNIPVLGFNNYATEGTGTQEK
                     FKHYSDDSNVGQQLFSGYGKRGEGATLDFNSYANKYSNIIESGFSNYGENGSVTDIFK
                     SYSENSNIPDNHFRSYGSGSLAGIEKFNTYREQSNIGDDSFASYHKDANYGSVEFTNY
                     GNESSGSDAFKGYGEGSTNGQITFKSYFEDNTTFKSYAKTGIDFKSYHNSSTAQIHTA
                     SKHPGLKQWVDPGKFFRESSLKKGTVMPMPDIHDRTPPRSFLPRSIAGNIPLSASAVS
                     EIFKFPPGTTMEKAVASTVADCERSPSRGETKRCATSAEDMIDFAVSVLGSDVEVRST
                     ANTNGSQGNILIGDVKGLNGGNVTQSVSCHQSLFPYLVYYCHSVPRVRVYEAEILAVD
                     SGEKINHGTAICHIDTSDWSPTHGAFVALGPGPGKIEVCHWIFEGDMTWTVRDRV"
     gene            complement(962114..963268)
                     /locus_tag="MA16_Dca013375"
     mRNA            complement(962114..963268)
                     /locus_tag="MA16_Dca013375"
                     /product="Retrovirus-related Pol polyprotein from
                     transposon TNT 1-94"
     CDS             complement(962114..963268)
                     /locus_tag="MA16_Dca013375"
                     /codon_start=1
                     /product="Retrovirus-related Pol polyprotein from
                     transposon TNT 1-94"
                     /protein_id="PKU63331.1"
                     /db_xref="InterPro:IPR013103"
                     /translation="MRQPPGFEDSNHPDAVCHLHKSLYGLKQAPRQWFQKLTTALQAR
                     GFRFSRSDPSLLIYTKLHIQIYLLIYVDDIIVTGNDQSQIQLLLCDLKSQFALKQLGQ
                     ICLFLGIQITRSHNGFFLIQGHYAQNLLLEAGLSSCKSAITPITPTSKHLTDNNKPFH
                     DTFLYRRLAGSLQYLSITRPDIAFATNQVCQNMQRPTDRNFQQLKRILRYVKGTISYG
                     LPIMTGDTTLRTYTDADWASDITDRKSVSGFCTFMGPNLISWSVKKHVTVAKSSTEAE
                     YRALSAANSEVLWLRRLAEKLQMPQTSPTTIHCDNISAIAIAKNSVFHARTKLIEIDF
                     QFIRQQIYTGNINIQHISSHEQIADILTKPFSSSRFEYLCSKLSIRPPNA"
     gene            complement(990731..997409)
                     /locus_tag="MA16_Dca013376"
     mRNA            complement(join(990731..990945,991539..991594,
                     997123..997409))
                     /locus_tag="MA16_Dca013376"
                     /product="hypothetical protein"
     CDS             complement(join(990731..990945,991539..991594,
                     997123..997409))
                     /locus_tag="MA16_Dca013376"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKU63332.1"
                     /translation="MLELKFSSMIGGFIALPSSLFQKSLLLSLGFILEWTLPLLLPLS
                     FGFLLVFAVPVAPGCFPVMLFHSLCWLLEFLAGWVSRGCLLGFPWSSFLCFLKFYKGI
                     TGSFQQINSDMKQAKICGWQKRRKLWKWRWNNLEPRCKRNIPDGGKIFWNEGKIFLHR
                     KPFWKHGQHDENIDRDANEDFTNYS"
     gene            complement(1002406..1002867)
                     /locus_tag="MA16_Dca013377"
     mRNA            complement(1002406..1002867)
                     /locus_tag="MA16_Dca013377"
                     /product="hypothetical protein"
     CDS             complement(1002406..1002867)
                     /locus_tag="MA16_Dca013377"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKU63333.1"
                     /translation="MATKKVEALGGELAQIKSGMEEKFSTMERMEGRLGGIEKIIKKL
                     MEMQSQASWAVPITSPHHNLTKGPMAKLKGKEIEREEFDEKSSFHQEPPLRTLIMGGI
                     EVSKGGTAEKCSMVEFMKEVVGDRPLWKAIWIRGVDNRRGRWKSRTMGIGS"
     gene            1004506..1005967
                     /locus_tag="MA16_Dca013378"
     mRNA            join(1004506..1004653,1005885..1005967)
                     /locus_tag="MA16_Dca013378"
                     /product="hypothetical protein"
     CDS             join(1004506..1004653,1005885..1005967)
                     /locus_tag="MA16_Dca013378"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKU63334.1"
                     /translation="MTAYSSSLSYRDQFLASIAPPLLSSSIPRLTTSDQAARTCDTSV
                     KHDLQRVMPDHHSTKILSMSEGGSSAQSDEEE"
     gene            complement(1016051..1022603)
                     /locus_tag="MA16_Dca013379"
     mRNA            complement(join(1016051..1016179,1017820..1019645,
                     1019800..1019976,1020559..1020662,1022434..1022603))
                     /locus_tag="MA16_Dca013379"
                     /product="hypothetical protein"
     CDS             complement(join(1016051..1016179,1017820..1019645,
                     1019800..1019976,1020559..1020662,1022434..1022603))
                     /locus_tag="MA16_Dca013379"
                     /note="GO_function: GO:0005097 - Rab GTPase activator
                     activity [Evidence IEA];
                     GO_process: GO:0032313 - regulation of Rab GTPase activity
                     [Evidence IEA]"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKU63335.1"
                     /db_xref="InterPro:IPR000195"
                     /translation="MEIPLPDSFSIGRSSGGWSRFSSLRGVRWRFYLGILPSSPSVSI
                     DDLRRVTADARRSYASLRRRLLIDPHIPKDGNKSPDLSMDNPLSQNPESTWGRFFRNA
                     ELEKMLEQDLSRLYPEDDHYFQTLACQTMLRRILLVWCLRHPECGYRQGMHELLAPLV
                     YVLHVDLNYLSQVRGLYEDHFNEEFDGADCEVSSNTLMKAKSWDVGANADDFNQIKVP
                     NITSFDDLDRDIRDVLLLSDSYGAEGELGIVLSEKFMEHDAYCMFDGLMSGARGVVAI
                     TEFFCSRPSMGSSTGLPPIIEASSALYHLLSIVDSSLHCHLIELGVEPQYFALRWLRV
                     LFGREFSLSDLLVIWDELFSALNCSCTENDEYRFRILCSPRGAFISAMAVAMLQHVRS
                     SLLASENATSCLKRILNFPRNISVEKLIKKARFCQVLALETNMSVSSKAGLTKISSLA
                     VRTGSPTSKSPIQIMPDSYWEEKWKVLQKTPQNSDSVNAGQIKGLLGETLESLRTESF
                     TSPAKTVNMEKDAHSLDKRCLFFDDLSQIAESLDDVVQRIPFCDDSPSLEEDVKKCLS
                     EEPGYESSVRTSECMGEESLSTGNSSVFSMNTNTNSESNDPEIESEKSGVVSVFFSRE
                     NEDGNNLVKEECSNASYNPIPKEAEANADVAKSGPSVNVEVKGVSGKVRKTAAGKFQW
                     FWRIGKVSFNEKSMDKGAVAETLRSSNIGKESVCQEHPTISASAYSNCADSARAEVGD
                     MKTLGTLKILAQSMIENIQVIETVFQQEKVQAGKIFNGNEQAAAIEALKELRKISTIL
                     SEI"
     assembly_gap    1027987..1028777
                     /estimated_length=791
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     assembly_gap    1038060..1038236
                     /estimated_length=177
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     assembly_gap    1066323..1067293
                     /estimated_length=971
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            1108062..1134852
                     /gene="ARA12"
                     /locus_tag="MA16_Dca013380"
     mRNA            join(1108062..1108240,1108974..1109118,1109227..1109621,
                     1111865..1111960,1112050..1112122,1112571..1112856,
                     1131865..1132190,1132322..1132589,1133322..1133603,
                     1134446..1134852)
                     /gene="ARA12"
                     /locus_tag="MA16_Dca013380"
                     /product="Subtilisin-like protease"
     CDS             join(1108062..1108240,1108974..1109118,1109227..1109621,
                     1111865..1111960,1112050..1112122,1112571..1112856,
                     1131865..1132190,1132322..1132589,1133322..1133603,
                     1134446..1134852)
                     /gene="ARA12"
                     /locus_tag="MA16_Dca013380"
                     /note="GO_component: GO:0005618 - cell wall [Evidence
                     IEA];
                     GO_component: GO:0016020 - membrane [Evidence IEA];
                     GO_function: GO:0004252 - serine-type endopeptidase
                     activity [Evidence IEA];
                     GO_function: GO:0042802 - identical protein binding
                     [Evidence IEA];
                     GO_process: GO:0006508 - proteolysis [Evidence IEA];
                     GO_process: GO:0043086 - negative regulation of catalytic
                     activity [Evidence IEA]"
                     /codon_start=1
                     /product="Subtilisin-like protease"
                     /protein_id="PKU63336.1"
                     /db_xref="InterPro:IPR000209"
                     /db_xref="InterPro:IPR003137"
                     /db_xref="InterPro:IPR010259"
                     /db_xref="InterPro:IPR010435"
                     /db_xref="InterPro:IPR015500"
                     /translation="MLNKMDLCLFVFLLLPFVSFGSGDVYLITMEGEPVVSYMGGIDG
                     FSATAEDSMEEMDITSESVTSYSLYLKRKHDELLDLLFEAKSYKKIYSYCHLLNGFSV
                     HLTPEQATALSKAPGVKYVEKDGKVRKLTTHTPQFLGLPTGVWPTGGGFDKAGEDVVI
                     GLIDSGVFPKHPSFATYNTDPYGPLPRYRGKCEIDPETKRSFCNGKIIGAQHFAKAAI
                     AAGAFNPAVDFPSPLDGDGHGTHTAAIAAGNNGIPVRMHGHEFGKASGMAPRARIAIY
                     KVLYRLFGGYVSDVVAAIDQAVQDGVDVINLSVGPNSPPSTTKTTFLNPFDAALLSAV
                     KAGVFVAQAAGNGGPFPKTLVSFSPWITTVAAAVDDRRYKNHITLGNGRTLPGLGLSP
                     ATHANKSFDLVSVSDVLLDSSVMKYNPLDCQRPELLNKNLVEGKILLCGYSFNFVSGT
                     ASIRKVCETAKSLGAAGFVVAVESSYPGTKYDPVPVALPGILITDVSQTKELIDYYNS
                     STKRDWAGRPTGFQATASIADGLAPILHNSAPQVALFSSRGPDVKDFSFQDADVLKPD
                     ILAPGSLIWAAWAPNGTDEANYEGEGFAMVSGTSMATPHIAGIAALMKQKYPHWSPAA
                     IKSALMTTANTMDRAGRPLQAQQYSDTQMMTLSPATPFDYGSGEVDPKAALDPGLILD
                     ASYVDYINFLCSIPGVDPHEVSNITSSQCNATHGKPSDLNSPSITISHLVGTQTVKRT
                     VTNVAETETYVLSTRMSPEIALEANPPAMTILAGSSKEISVSLTVRSVTGTYSFGEIL
                     MKGNRGHLVRIPVVAMGYSS"
     assembly_gap    1139621..1139658
                     /estimated_length=38
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     assembly_gap    1162922..1166749
                     /estimated_length=3828
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     assembly_gap    1171132..1171231
                     /estimated_length=100
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            1172999..1174027
                     /gene="HMGB4"
                     /locus_tag="MA16_Dca013381"
     mRNA            join(1172999..1173048,1173156..1173257,1173346..1173403,
                     1173498..1173542,1173624..1173701,1173786..1173872,
                     1174010..1174027)
                     /gene="HMGB4"
                     /locus_tag="MA16_Dca013381"
                     /product="High mobility group B protein 4"
     CDS             join(1172999..1173048,1173156..1173257,1173346..1173403,
                     1173498..1173542,1173624..1173701,1173786..1173872,
                     1174010..1174027)
                     /gene="HMGB4"
                     /locus_tag="MA16_Dca013381"
                     /codon_start=1
                     /product="High mobility group B protein 4"
                     /protein_id="PKU63337.1"
                     /db_xref="InterPro:IPR009071"
                     /translation="MKEVRPTSGNARKSDGRLAAKKAPEKRKTGSRKAKDPNKPKRPP
                     SAFFVFMDQFRKEFKEKNPENKLVSVVGKAGGNKWKSMSDAEKAPYVAKAGKLKDEYL
                     KKIRFYDGSDVEKKNAAEDESSDKSKSEVSEEGAESDGEEEDD"
     assembly_gap    1196790..1196799
                     /estimated_length=10
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            1232600..1239376
                     /gene="NAC098"
                     /locus_tag="MA16_Dca013382"
     mRNA            join(1232600..1232807,1234754..1235028,1238885..1239376)
                     /gene="NAC098"
                     /locus_tag="MA16_Dca013382"
                     /product="Protein CUP-SHAPED COTYLEDON 2"
     CDS             join(1232600..1232807,1234754..1235028,1238885..1239376)
                     /gene="NAC098"
                     /locus_tag="MA16_Dca013382"
                     /note="GO_function: GO:0003677 - DNA binding [Evidence
                     IEA];
                     GO_process: GO:0006355 - regulation of transcription,
                     DNA-dependent [Evidence IEA]"
                     /codon_start=1
                     /product="Protein CUP-SHAPED COTYLEDON 2"
                     /protein_id="PKU63338.1"
                     /db_xref="InterPro:IPR003441"
                     /translation="MQNQNNRKEGGEMDGAEAEEEKLPPGFRFHPTDEELITYYLTHK
                     ITKANFTARAIAEVDLNKCEPWDLPGKAKMGEKEWYFFSLRDRKYPTGMRTNRATNSG
                     YWKTTGKDKEIYDSRSSELAGMKKTLVFYKGRAPRGEKTNWVMHEYRLQPKSSFKGNL
                     MVDEWVVCRVILKSNSSSKKCSSTSQSHRLISPCSLNIIGPPILPTFFGSHNLAELLR
                     YPTGRPPSSLNFQTINTQFDHSTASFPQPPSSLGRLNLNLGGQQLLRAMNTPLNTTEG
                     VLLPQPFMGNIAECESGYGSGSNIVGAASRIQNLEESCMDLDGYWPTY"
     assembly_gap    1244990..1251144
                     /estimated_length=6155
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     gene            complement(1251160..1251369)
                     /locus_tag="MA16_Dca013383"
     mRNA            complement(1251160..1251369)
                     /locus_tag="MA16_Dca013383"
                     /product="hypothetical protein"
     CDS             complement(1251160..1251369)
                     /locus_tag="MA16_Dca013383"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKU63339.1"
                     /translation="MPPFPDTDRISRILAPYASLCAHGTRTDVLIAPEHNLSSDPELV
                     FRNRFQSSFQIFPDTDRISQDPDPL"
     gene            complement(1267479..1295474)
                     /locus_tag="MA16_Dca013384"
     mRNA            complement(join(1267479..1267588,1288220..1288418,
                     1288520..1288578,1288660..1288789,1295140..1295261,
                     1295414..1295474))
                     /locus_tag="MA16_Dca013384"
                     /product="hypothetical protein"
     CDS             complement(join(1267479..1267588,1288220..1288418,
                     1288520..1288578,1288660..1288789,1295140..1295261,
                     1295414..1295474))
                     /locus_tag="MA16_Dca013384"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKU63340.1"
                     /translation="MLGISYGELFLIIGATAALIGPKDLPFIAKAAGRLAGRAVGYVQ
                     MARGQFESVMQQSQVNQVHKELQDTMAQLEAIRYEIRGISVMNPIPFTRRLEGVEPPA
                     KNGAVFAEKSDTDHMSVLNNAKDLGSTETNSSSIHSQAMAYARLAKTTIIKFNSSQAS
                     LNNENLNGQDGLPSVLPISAEIAGLLSKRNDDVKGSDILHEAIVEAEVAKNAKQFFSQ
                     PENQIPKE"
     gene            complement(1314934..1317450)
                     /locus_tag="MA16_Dca013385"
     mRNA            complement(join(1314934..1316036,1316727..1317450))
                     /locus_tag="MA16_Dca013385"
                     /product="putative receptor-like protein kinase"
     CDS             complement(join(1314934..1316036,1316727..1317450))
                     /locus_tag="MA16_Dca013385"
                     /note="GO_function: GO:0004672 - protein kinase activity
                     [Evidence IEA];
                     GO_function: GO:0004713 - protein tyrosine kinase activity
                     [Evidence IEA];
                     GO_function: GO:0005524 - ATP binding [Evidence IEA];
                     GO_function: GO:0030247 - polysaccharide binding [Evidence
                     IEA];
                     GO_process: GO:0006468 - protein phosphorylation [Evidence
                     IEA]"
                     /codon_start=1
                     /product="putative receptor-like protein kinase"
                     /protein_id="PKU63341.1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR001245"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR020635"
                     /db_xref="InterPro:IPR025287"
                     /translation="MPWYHLLLLGIFPIAYALSNDCPSPMCGDMEIKFPFTLESSSNS
                     CRTAGASANLSCSSTNETIITLPSSESYRVTSIDYDNYYGIFIQVLLSSSSINCPWRK
                     GIRNLPNVNGSIFTVAVSGFVLLNCTTKLSWRTGYDNIVGPISCLSEPGSFVYALTKY
                     VRMGILPSSCIEIYTGEFLSDSFGQSIQVIASKSMQGETASLYPNVVDNFRACYSCSS
                     QGKKCGYNIRMDKKFCYSEDSHHGIAICTSLVIFLIVALVVLYYFKKYRNKKQKHIKV
                     EKFLATYKSTTLTRYNFADIKKMTKKFKHKLGQGGFGSVYKGELTNGIPVAVKLLEAS
                     KFNGDDFVNEVATIGKIHHVNVVRLLGFCSNGTNRALVYEFMPNNSLEKYIFLGQSEK
                     RHDFFTMEKLHEIAIGIAQGINYLHQGCNQRIVHFDIKPHNILLDYDFNPKISDFGLA
                     KLCSRDQSIVIISAARGTMGYIAPEVYSRNFGPVSHKSDVYSYGMLLLEMIGRRKNID
                     PTIENLSEIYFPEWIYNKLVHSNSLGLALEMEGNEEIMKRLAIIALWCIQWNPAERPS
                     MRKVVQMLTMIFQSLEMPPTPFVPSSDQSDNVYVSRNHKKKN"
     gene            complement(1339183..1355104)
                     /locus_tag="MA16_Dca013386"
     mRNA            complement(join(1339183..1339319,1339658..1339952,
                     1354226..1355104))
                     /locus_tag="MA16_Dca013386"
                     /product="hypothetical protein"
     CDS             complement(join(1339183..1339319,1339658..1339952,
                     1354226..1355104))
                     /locus_tag="MA16_Dca013386"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="PKU63342.1"
                     /db_xref="InterPro:IPR021924"
                     /translation="MADGIAFSGCGDERESLLPRKSSYQRSFSHAADELKSFRSCLRW
                     LCIDHSDSFHAAISWFVFFIFSFAVPLASHFIMSYSPSRRAYDSVVQLALSGSAALSY
                     LSLSTFVRRHGLRRFLFLDKLRLESERVRLGYTNQLNRSFRILSVFVLPCFAGEVVYK
                     LAWYLSGEERVPPGLFFMGNAVLAESVFAFLELASWIYRTAIFFVVCVLFRLMCYLQI
                     LRLEDFAGAFSDGANVACILRAHLRIRRELRIISHRYRIFNVYCVVIVTVSQFVTLLV
                     TTRPSAVVNFFNAGEIALCSIGLVTGLLMCLRSAAKITHKAQAITSLAATWHVSATID
                     SYGEDSEVPSPETSVFVNEAGEEESEHQDSDEDDELEDAKLVSSNIHTFSFQKRQSLV
                     TYMENNRAGITLFGFVVDRTWLHALFMIEFSLVMWLLGKTVGIS"
     gene            1400163..1448938
                     /locus_tag="MA16_Dca013387"
     mRNA            join(1400163..1400359,1400439..1400565,1405275..1405402,
                     1405492..1405561,1405676..1405778,1406636..1406753,
                     1416525..1416606,1428097..1428158,1431407..1431479,
                     1431574..1431657,1444147..1444227,1448735..1448938)
                     /locus_tag="MA16_Dca013387"
                     /product="tRNA-dihydrouridine synthase A"
     CDS             join(1400163..1400359,1400439..1400565,1405275..1405402,
                     1405492..1405561,1405676..1405778,1406636..1406753,
                     1416525..1416606,1428097..1428158,1431407..1431479,
                     1431574..1431657,1444147..1444227,1448735..1448938)
                     /locus_tag="MA16_Dca013387"
                     /note="GO_function: GO:0017150 - tRNA dihydrouridine
                     synthase activity [Evidence IEA];
                     GO_function: GO:0050660 - flavin adenine dinucleotide
                     binding [Evidence IEA];
                     GO_process: GO:0008033 - tRNA processing [Evidence IEA];
                     GO_process: GO:0055114 - oxidation-reduction process
                     [Evidence IEA]"
                     /codon_start=1
                     /product="tRNA-dihydrouridine synthase A"
                     /protein_id="PKU63343.1"
                     /db_xref="InterPro:IPR001269"
                     /translation="MKTAMHTLLCTLIPIYHGNAAAYRKSISMLHDASAQFKRVQSLK
                     RKLEINTETCLDGGKSHPPLFSVAPMMDWTDNHYRTLARLISRHAWLYTEMVVAETIV
                     HQKDNLDRFLAFSPDQHPIVLQIGGSNLENLAKAAELANLYSYDEINFNCGCPSGKVA
                     GHGCFGARLMFNPKLVGHAMSAIAANSDVPVSVKCRIGVDDRDSYNELCDFIYTVSSQ
                     SPTNHFVIHARKALLSGLSPAENRKVPPLKYEYYFALLRDFPELQFTLNGGITCINQV
                     DAAIRQGASGVMVGRAAYNNPWFTLGHVDVAIYGVPFHRCSRRQIIEQYQEYADSVIG
                     KFGSNKPNVRQLVKPLLNLFHSEPGNSRWKRAADAALRHCKTVRSFLEETLPNLPDEV
                     LDSTLVNSPCDHERFADVDAILPPPYRSSGEQLAYEEGEGTRQGSLLSCL"
     assembly_gap    1411613..1413198
                     /estimated_length=1586
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     assembly_gap    1452005..1452104
                     /estimated_length=100
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     assembly_gap    1460537..1461829
                     /estimated_length=1293
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     assembly_gap    1473212..1473636
                     /estimated_length=425
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
     assembly_gap    1487939..1494691
                     /estimated_length=6753
                     /gap_type="within scaffold"
                     /linkage_evidence="paired-ends"
CONTIG      join(JSDN02024866.1:1..9108,gap(100),JSDN02024867.1:1..13131,
            gap(114),JSDN02024868.1:1..7565,gap(11082),JSDN02024869.1:1..3699,
            gap(473),JSDN02024870.1:1..16564,gap(572),JSDN02024871.1:1..72937,
            gap(1424),JSDN02024872.1:1..104923,gap(10),JSDN02024873.1:1..72563,
            gap(100),JSDN02024874.1:1..57728,gap(48),JSDN02024875.1:1..182448,
            gap(4862),JSDN02024876.1:1..27644,gap(100),JSDN02024877.1:1..24484,
            gap(618),JSDN02024878.1:1..17107,gap(529),JSDN02024879.1:1..57523,
            gap(100),JSDN02024880.1:1..3759,gap(100),JSDN02024881.1:1..3946,
            gap(100),JSDN02024882.1:1..3739,gap(100),JSDN02024883.1:1..99141,
            gap(100),JSDN02024884.1:1..5039,gap(3979),JSDN02024885.1:1..19195,
            gap(100),JSDN02024886.1:1..89749,gap(690),JSDN02024887.1:1..18717,
            gap(761),JSDN02024888.1:1..91215,gap(791),JSDN02024889.1:1..9282,
            gap(177),JSDN02024890.1:1..28086,gap(971),JSDN02024891.1:1..72327,
            gap(38),JSDN02024892.1:1..23263,gap(3828),JSDN02024893.1:1..4382,
            gap(100),JSDN02024894.1:1..25558,gap(10),JSDN02024895.1:1..48190,
            gap(6155),JSDN02024896.1:1..160468,gap(1586),
            JSDN02024897.1:1..38806,gap(100),JSDN02024898.1:1..8432,gap(1293),
            JSDN02024899.1:1..11382,gap(425),JSDN02024900.1:1..14302,gap(6753),
            JSDN02024901.1:1..3834)
//