LOCUS       HIVHXB2CG               9719 bp    RNA     linear   VRL 21-OCT-2002
DEFINITION  Human immunodeficiency virus type 1 (HXB2), complete genome;
            HIV1/HTLV-III/LAV reference genome.
ACCESSION   K03455 M38432
VERSION     K03455.1
KEYWORDS    TAR protein; acquired immune deficiency syndrome; complete genome;
            env protein; gag protein; long terminal repeat (LTR); pol protein;
            polyprotein; proviral gene; reverse transcriptase; transactivator.
SOURCE      Human immunodeficiency virus 1 (HIV-1)
  ORGANISM  Human immunodeficiency virus 1
            Viruses; Retro-transcribing viruses; Retroviridae;
            Orthoretrovirinae; Lentivirus; Primate lentivirus group.
REFERENCE   1  (sites)
  AUTHORS   van Beveren,C.P., Coffin,J. and Hughes,S.
  TITLE     Appendix B: HTLV-3/LAV genome
  JOURNAL   (in) Weiss,R.L., Teich,N., Varmus,H. and Coffin,J. (Eds.); RNA
            TUMOR VIRUSES, SECOND EDITION, 2, Vol. 2: 1102-1123; Cold Spring
            Harbor Laboratory, Cold Spring Harbor (1985) 
REFERENCE   2  (bases 493 to 674; 9577 to 9718)
  AUTHORS   Ratner,L., Haseltine,W., Patarca,R., Livak,K.J., Starcich,B.,
            Josephs,S.F., Doran,E.R., Rafalski,J.A., Whitehorn,E.A.,
            Baumeister,K., Ivanoff,L., Petteway,S.R. Jr., Pearson,M.L.,
            Lautenberger,J.A., Papas,T.S., Ghrayeb,J., Chang,N.T., Gallo,R.C.
            and Wong-Staal,F. 
  TITLE     Complete nucleotide sequence of the AIDS virus, HTLV-III
  JOURNAL   Nature 313 (6000), 277-284 (1985)
   PUBMED   2578615
REFERENCE   3  (bases 1 to 653)
  AUTHORS   Starcich,B., Ratner,L., Josephs,S.F., Okamoto,T., Gallo,R.C. and
            Wong-Staal,F. 
  TITLE     Characterization of long terminal repeat sequences of HTLV-III
  JOURNAL   Science 227 (4686), 538-540 (1985)
   PUBMED   2981438
REFERENCE   4  (sites)
  AUTHORS   Allan,J.S., Coligan,J.E., Barin,F., McLane,M.F., Sodroski,J.G.,
            Rosen,C.A., Haseltine,W.A., Lee,T.H. and Essex,M. 
  TITLE     Major glycoprotein antigens that induce antibodies in AIDS
            patients are encoded by HTLV-III 
  JOURNAL   Science 228 (4703), 1091-1094 (1985)
   PUBMED   2986290
REFERENCE   5  (sites)
  AUTHORS   Rosen,C.A., Sodroski,J.G. and Haseltine,W.A.
  TITLE     The location of cis-acting regulatory sequences in the human T
            cell lymphotropic virus type III (HTLV-III/LAV) long terminal
            repeat 
  JOURNAL   Cell 41 (3), 813-823 (1985)
   PUBMED   2988790
REFERENCE   6  (sites)
  AUTHORS   Arya,S.K., Guo,C., Josephs,S.F. and Wong-Staal,F.
  TITLE     Trans-activator gene of human T-lymphotropic virus type III
            (HTLV-III) 
  JOURNAL   Science 229 (4708), 69-73 (1985)
   PUBMED   2990040
REFERENCE   7  (sites)
  AUTHORS   Sodroski,J., Patarca,R., Rosen,C., Wong-Staal,F. and Haseltine,W.
  TITLE     Location of the trans-activating region on the genome of human
            T-cell lymphotropic virus type III 
  JOURNAL   Science 229 (4708), 74-77 (1985)
   PUBMED   2990041
REFERENCE   8  (sites)
  AUTHORS   Rabson,A.B., Daugherty,D.F., Venkatesan,S., Boulukos,K.E.,
            Benn,S.I., Folks,T.M., Feorino,P. and Martin,M.A. 
  TITLE     Transcription of novel open reading frames of AIDS retrovirus
            during infection of lymphocytes 
  JOURNAL   Science 229 (4720), 1388-1390 (1985)
   PUBMED   2994220
REFERENCE   9  (sites)
  AUTHORS   Allan,J.S., Coligan,J.E., Lee,T.H., McLane,M.F., Kanki,P.J.,
            Groopman,J.E. and Essex,M. 
  TITLE     A new HTLV-III/LAV encoded antigen detected by antibodies from
            AIDS patients 
  JOURNAL   Science 230 (4727), 810-813 (1985)
   PUBMED   2997921
REFERENCE   10  (sites)
  AUTHORS   Rosen,C.A., Sodroski,J.G., Goh,W.C., Dayton,A.I., Lippke,J. and
            Haseltine,W.A. 
  TITLE     Post-transcriptional regulation accounts for the trans-activation
            of the human T-lymphotropic virus type III 
  JOURNAL   Nature 319 (6054), 555-559 (1986)
   PUBMED   3003584
REFERENCE   11  (sites)
  AUTHORS   di Marzo Veronese,F., Copeland,T.D., DeVico,A.L., Rahman,R.,
            Oroszlan,S., Gallo,R.C. and Sarngadharan,M.G. 
  TITLE     Characterization of highly immunogenic p66/p51 as the reverse
            transcriptase of HTLV-III/LAV 
  JOURNAL   Science 231 (4743), 1289-1291 (1986)
   PUBMED   2418504
REFERENCE   12  (sites)
  AUTHORS   Kramer,R.A., Schaber,M.D., Skalka,A.M., Ganguly,K., Wong-Staal,F.
            and Reddy,E.P. 
  TITLE     HTLV-III gag protein is processed in yeast cells by the virus
            pol-protease 
  JOURNAL   Science 231 (4745), 1580-1584 (1986)
   PUBMED   2420008
REFERENCE   13  (sites)
  AUTHORS   Dayton,A.I., Sodroski,J.G., Rosen,C.A., Goh,W.C. and
            Haseltine,W.A. 
  TITLE     The trans-activator gene of the human T cell lymphotropic virus
            type III is required for replication 
  JOURNAL   Cell 44 (6), 941-947 (1986)
   PUBMED   2420471
REFERENCE   14  (sites)
  AUTHORS   Lee,T.H., Coligan,J.E., Allan,J.S., McLane,M.F., Groopman,J.E. and
            Essex,M. 
  TITLE     A new HTLV-III/LAV protein encoded by a gene found in cytopathic
            retroviruses 
  JOURNAL   Science 231 (4745), 1546-1549 (1986)
   PUBMED   3006243
REFERENCE   15  (sites)
  AUTHORS   Sodroski,J., Goh,W.C., Rosen,C., Tartar,A., Portetelle,D.,
            Burny,A. and Haseltine,W. 
  TITLE     Replicative and cytopathic potential of HTLV-III/LAV with sor gene
            deletions 
  JOURNAL   Science 231 (4745), 1549-1553 (1986)
   PUBMED   3006244
REFERENCE   16  (sites)
  AUTHORS   Kan,N.C., Franchini,G., Wong-Staal,F., DuBois,G.C., Robey,W.G.,
            Lautenberger,J.A. and Papas,T.S. 
  TITLE     Identification of HTLV-III/LAV sor gene product and detection of
            antibodies in human sera 
  JOURNAL   Science 231 (4745), 1553-1555 (1986)
   PUBMED   3006245
REFERENCE   17  (sites)
  AUTHORS   Arya,S.K. and Gallo,R.C.
  TITLE     Three novel genes of human T-lymphotropic virus type III: immune
            reactivity of their products with sera from acquired immune
            deficiency syndrome patients 
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 83 (7), 2209-2213 (1986)
   PUBMED   3008154
REFERENCE   18  (sites)
  AUTHORS   Jones,K.A., Kadonaga,J.T., Luciw,P.A. and Tjian,R.
  TITLE     Activation of the AIDS retrovirus promoter by the cellular
            transcription factor, Sp1 
  JOURNAL   Science 232 (4751), 755-759 (1986)
   PUBMED   3008338
REFERENCE   19  (sites)
  AUTHORS   Sodroski,J., Goh,W.C., Rosen,C., Dayton,A., Terwilliger,E. and
            Haseltine,W. 
  TITLE     A second post-transcriptional trans-activator gene required for
            HTLV-III replication 
  JOURNAL   Nature 321 (6068), 412-417 (1986)
   PUBMED   3012355
REFERENCE   20  (sites)
  AUTHORS   Starcich,B.R., Hahn,B.H., Shaw,G.M., McNeely,P.D., Modrow,S.,
            Wolf,H., Parks,E.S., Parks,W.P., Josephs,S.F., Gallo,R.C. and
            Wong-Staal,F. 
  TITLE     Identification and characterization of conserved and variable
            regions in the envelope gene of HTLV-III/LAV, the retrovirus of
            AIDS 
  JOURNAL   Cell 45 (5), 637-648 (1986)
   PUBMED   2423250
REFERENCE   21  (sites)
  AUTHORS   Willey,R.L., Rutledge,R.A., Dias,S., Folks,T., Theodore,T.,
            Buckler,C.E. and Martin,M.A. 
  TITLE     Identification of conserved and divergent domains within the
            envelope gene of the acquired immunodeficiency syndrome retrovirus 
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 83 (14), 5038-5042 (1986)
   PUBMED   3014529
REFERENCE   22  (bases 8761 to 9060)
  AUTHORS   Fisher,A.G., Ratner,L., Mitsuya,H., Marselle,L.M., Harper,M.E.,
            Broder,S., Gallo,R.C. and Wong-Staal,F. 
  TITLE     Infectious mutants of HTLV-III with changes in the 3' region and
            markedly reduced cytopathic effects 
  JOURNAL   Science 233 (4764), 655-659 (1986)
   PUBMED   3014663
REFERENCE   23  (sites)
  AUTHORS   Feinberg,M.B., Jarrett,R.F., Aldovini,A., Gallo,R.C. and
            Wong-Staal,F. 
  TITLE     HTLV-III expression and production involve complex regulation at
            the levels of splicing and translation of viral RNA 
  JOURNAL   Cell 46 (6), 807-817 (1986)
   PUBMED   3638988
REFERENCE   24  (sites)
  AUTHORS   Lightfoote,M.M., Coligan,J.E., Folks,T.M., Fauci,A.S., Martin,M.A.
            and Venkatesan,S. 
  TITLE     Structural characterization of reverse transcriptase and
            endonuclease polypeptides of the acquired immunodeficiency
            syndrome retrovirus 
  JOURNAL   J. Virol. 60 (2), 771-775 (1986)
   PUBMED   2430111
REFERENCE   25  (sites)
  AUTHORS   Terwilliger,E., Sodroski,J.G., Rosen,C.A. and Haseltine,W.A.
  TITLE     Effects of mutations within the 3' orf open reading frame region
            of human T-cell lymphotropic virus type III (HTLV-III/LAV) on
            replication and cytopathogenicity 
  JOURNAL   J. Virol. 60 (2), 754-760 (1986)
   PUBMED   3490583
REFERENCE   26  (sites)
  AUTHORS   Wright,C.M., Felber,B.K., Paskalis,H. and Pavlakis,G.N.
  TITLE     Expression and characterization of the trans-activator of
            HTLV-III/LAV virus 
  JOURNAL   Science 234 (4779), 988-992 (1986)
   PUBMED   3490693
REFERENCE   27  (sites)
  AUTHORS   Patarca,R., Heath,C., Goldenberg,G.J., Rosen,C.A., Sodroski,J.G.,
            Haseltine,W.A. and Hansen,U.M. 
  TITLE     Transcription directed by the HIV long terminal repeat in vitro
  JOURNAL   AIDS Res. Hum. Retroviruses 3 (1), 41-55 (1987)
   PUBMED   3040054
REFERENCE   28  (bases 1 to 9635)
  AUTHORS   Ratner,L., Fisher,A., Jagodzinski,L.L., Mitsuya,H., Liou,R.S.,
            Gallo,R.C. and Wong-Staal,F. 
  TITLE     Complete nucleotide sequences of functional clones of the AIDS
            virus 
  JOURNAL   AIDS Res. Hum. Retroviruses 3 (1), 57-69 (1987)
   PUBMED   3040055
REFERENCE   29  (sites)
  AUTHORS   Wong-Staal,F., Chanda,P.K. and Ghrayeb,J.
  TITLE     Human immunodeficiency virus: the eighth gene
  JOURNAL   AIDS Res. Hum. Retroviruses 3 (1), 33-39 (1987)
   PUBMED   3476127
REFERENCE   30  (sites)
  AUTHORS   Modrow,S., Hahn,B.H., Shaw,G.M., Gallo,R.C., Wong-Staal,F. and
            Wolf,H. 
  TITLE     Computer-assisted analysis of envelope protein sequences of seven
            human immunodeficiency virus isolates: prediction of antigenic
            epitopes in conserved and variable regions 
  JOURNAL   J. Virol. 61 (2), 570-578 (1987)
   PUBMED   2433466
REFERENCE   31  (sites)
  AUTHORS   Goh,W.C., Sodroski,J.G., Rosen,C.A. and Haseltine,W.A.
  TITLE     Expression of the art gene protein of human T-lymphotropic virus
            type III (HTLV-III/LAV) in bacteria 
  JOURNAL   J. Virol. 61 (2), 633-637 (1987)
   PUBMED   3543401
REFERENCE   32  (sites)
  AUTHORS   Muesing,M.A., Smith,D.H. and Capon,D.J.
  TITLE     Regulation of mRNA accumulation by a human immunodeficiency virus
            trans-activator protein 
  JOURNAL   Cell 48 (4), 691-701 (1987)
   PUBMED   3643816
REFERENCE   33  (sites)
  AUTHORS   Nabel,G. and Baltimore,D.
  TITLE     An inducible transcription factor activates expression of human
            immunodeficiency virus in T cells 
  JOURNAL   Nature 326 (6114), 711-713 (1987)
   PUBMED   3031512
  REMARK    Erratum:[Nature 1990 Mar 8;344(6262):178]
REFERENCE   34  (sites)
  AUTHORS   Fisher,A.G., Ensoli,B., Ivanoff,L., Chamberlain,M., Petteway,S.,
            Ratner,L., Gallo,R.C. and Wong-Staal,F. 
  TITLE     The sor gene of HIV-1 is required for efficient virus transmission
            in vitro 
  JOURNAL   Science 237 (4817), 888-893 (1987)
   PUBMED   3497453
REFERENCE   35  (bases 6225 to 8795)
  AUTHORS   Reitz,M.S. Jr., Wilson,C., Naugle,C., Gallo,R.C. and
            Robert-Guroff,M. 
  TITLE     Generation of a neutralization-resistant variant of HIV-1 is due
            to selection for a point mutation in the envelope gene 
  JOURNAL   Cell 54 (1), 57-63 (1988)
   PUBMED   2838179
REFERENCE   36  (bases 790 to 2292)
  AUTHORS   Pal,R., Reitz,M.S. Jr., Tschachler,E., Gallo,R.C.,
            Sarngadharan,M.G. and Veronese,F.D. 
  TITLE     Myristoylation of gag proteins of HIV-1 plays an important role in
            virus assembly 
  JOURNAL   AIDS Res. Hum. Retroviruses 6 (6), 721-730 (1990)
   PUBMED   2194551
REFERENCE   37  (sites)
  AUTHORS   Ido,E., Han,H.P., Kezdy,F.J. and Tang,J.
  TITLE     Kinetic studies of human immunodeficiency virus type 1 protease
            and its active-site hydrogen bond mutant A28S 
  JOURNAL   J. Biol. Chem. 266 (36), 24359-24366 (1991)
   PUBMED   1761538
COMMENT     On Mar 25, 1997 this sequence version replaced gi:327742.
            [6]  sites; tat mRNA and other transcript boundaries. [7]  sites;
            tat mRNA.
            [8]  sites; mRNA splice sites.
            [9]  sites; 27K antigen cds.
            [5]  sites; gp160 and gp120 coding sequences.
            [1]  sites; regulatory sequences in the LTR.
            [(in) Weiss,R., Teich,N., Varmus,H. and Coffin,J. (Eds.);RNA Tumor
            Viruses, Secon]  review; bases 1 to 9718.
            [15]  sites; trans-activator function and TAR sequence. [19]
            sites; pol coding sequence.
            [22]  sites; 23K sor gene product.
            [23]  sites; pol NH2-terminal region.
            [20]  sites; sor 23K protein.
            [21]  sites; sor 23K protein.
            [24]  sites; Sp1 binding sites in the promoter region. [17]  sites;
            acceptor and donor splice sites for tat and 27K. [10]  sites;
            deletion mutants in the tat gene.
            [18]  sites; env gene conserved/varable regions; separate entries.
            [16]  sites; trs cds boundaries.
            [12]  sites; trs cds boundaries.
            [11]  sites; env gene conserved/variable regions; separate entries.
            [26]  sites; tar or transactivator target.
            [13]  sites; 3' orf mutations.
            [14]  sites; pol p34 terminus.
            [31]  sites; promoter, TAR, tat-III mutants.
            [32]  sites; envelope protein epitopes.
            [33]  sites; trs/art protein.
            [34]  sites; inducible enhancer element.
            [27]  revises [30].
            [29]  sites; long terminal repeat.
            [28]  sites; R orf.
            [35]  sites; sor.
            Sequence for [25] kindly provided in computer-readable form by
            L.Ratner, 19-AUG-1986.
            The HXB2 sequence is being used as a reference genome for all the
            HIV entries because it has been derived from a demonstrably
            infectious clone.  Hence not all of the 'sites' references above
            were concerned with this isolate.
FEATURES             Location/Qualifiers
     source          1..9719
                     /organism="Human immunodeficiency virus 1"
                     /proviral
                     /mol_type="genomic RNA"
                     /isolate="HXB2"
                     /db_xref="taxon:11676"
                     /note="HTLV-III/LAV"
     LTR             1..634
                     /note="5' LTR"
     repeat_region   454..551
                     /note="R repeat 5' copy"
     mRNA            455..9635
                     /product="HXB2 genomic mRNA"
     prim_transcript 455..9635
                     /note="tat, trs, 27K subgenomic mRNA"
     intron          744..5777
                     /note="tat, trs, 27K mRNA intron 1"
     CDS             790..2292
                     /note="gag polyprotein"
                     /codon_start=1
                     /protein_id="AAB50258.1"
                     /db_xref="GI:327745"
                     /translation="MGARASVLSGGELDRWEKIRLRPGGKKKYKLKHIVWASRELERF
                     AVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTVATLYCVHQRIEIKDTKEALD
                     KIEEEQNKSKKKAQQAAADTGHSNQVSQNYPIVQNIQGQMVHQAISPRTLNAWVKVVE
                     EKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRVHPV
                     HAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRM
                     YSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTIL
                     KALGPAATLEEMMTACQGVGGPGHKARVLAEAMSQVTNSATIMMQRGNFRNQRKIVKC
                     FNCGKEGHTARNCRAPRKKGCWKCGKEGHQMKDCTERQANFLGKIWPSYKGRPGNFLQ
                     SRPEPTAPPEESFRSGVETTTPPQKQEPIDKELYPLTSLRSLFGNDPSSQ"
     CDS             2358..5096
                     /note="pol polyprotein (NH2-terminus uncertain)"
                     /codon_start=1
                     /protein_id="AAB50259.1"
                     /db_xref="GI:1906384"
                     /translation="MSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGP
                     TPVNIIGRNLLTQIGCTLNFPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEIC
                     TEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPH
                     PAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWK
                     GSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRW
                     GLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQI
                     YPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAE
                     IQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKT
                     PKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDG
                     AANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYA
                     LGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKVL
                     FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSP
                     GIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTD
                     NGSNFTGATVRAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKT
                     AVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRN
                     PLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED"
     CDS             5041..5619
                     /note="sor 23K protein"
                     /codon_start=1
                     /protein_id="AAB50260.1"
                     /db_xref="GI:327747"
                     /translation="MENRWQVMIVWQVDRMRIRTWKSLVKHHMYVSGKARGWFYRHHY
                     ESPHPRISSEVHIPLGDARLVITTYWGLHTGERDWHLGQGVSIEWRKKRYSTQVDPEL
                     ADQLIHLYYFDCFSDSAIRKALLGHIVSPRCEYQAGHNKVGSLQYLALAALITPKKIK
                     PPLPSVTKLTEDRWNKPQKTKGHRGSHTMNGH"
     CDS             5559..5795
                     /note="R (ORF) protein"
                     /codon_start=1
                     /protein_id="AAB50261.1"
                     /db_xref="GI:327748"
                     /translation="MEQAPEDQGPQREPHNEWTLELLEELKNEAVRHFPRIWLHGLGQ
                     HIYETYGDTWAGVEAIIRILQQLLFIHFQNWVST"
     CDS             join(5831..6045,8379..8424)
                     /note="tat protein"
                     /codon_start=1
                     /protein_id="AAB50256.1"
                     /db_xref="GI:1906383"
                     /translation="MEPVDPRLEPWKHPGSQPKTACTNCYCKKCCFHCQVCFITKALG
                     ISYGRKKRRQRRRAHQNSQTHQASLSKQPTSQPRGDPTGPKE"
     exon            5831..6045
                     /note="tat protein, first expressed exon"
                     /number=2
     CDS             join(5970..6045,8379..8653)
                     /note="trs protein"
                     /codon_start=1
                     /protein_id="AAB50257.1"
                     /db_xref="GI:327744"
                     /translation="MAGRSGDSDEELIRTVRLIKLLYQSNPPPNPEGTRQARRNRRRR
                     WRERQRQIHSISERILGTYLGRSAEPVPLQLPPLERLTLDCNEDCGTSGTQGVGSPQI
                     LVESPTVLESGTKE"
     exon            5970..6045
                     /note="trs protein, first expressed exon"
                     /number=2
     intron          6046..8378
                     /note="tat, trs, 27K mRNA intron 2"
     CDS             6225..8795
                     /note="envelope polyprotein"
                     /codon_start=1
                     /protein_id="AAB50262.1"
                     /db_xref="GI:1906385"
                     /translation="MRVKEKYQHLWRWGWRWGTMLLGMLMICSATEKLWVTVYYGVPV
                     WKEATTTLFCASDAKAYDTEVHNVWATHACVPTDPNPQEVVLVNVTENFNMWKNDMVE
                     QMHEDIISLWDQSLKPCVKLTPLCVSLKCTDLKNDTNTNSSSGRMIMEKGEIKNCSFN
                     ISTSIRGKVQKEYAFFYKLDIIPIDNDTTSYKLTSCNTSVITQACPKVSFEPIPIHYC
                     APAGFAILKCNNKTFNGTGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIRSVN
                     FTDNAKTIIVQLNTSVEINCTRPNNNTRKRIRIQRGPGRAFVTIGKIGNMRQAHCNIS
                     RAKWNNTLKQIASKLREQFGNNKTIIFKQSSGGDPEIVTHSFNCGGEFFYCNSTQLFN
                     STWFNSTWSTEGSNNTEGSDTITLPCRIKQIINMWQKVGKAMYAPPISGQIRCSSNIT
                     GLLLTRDGGNSNNESEIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTKAKRRVVQR
                     EKRAVGIGALFLGFLGAAGSTMGAASMTLTVQARQLLSGIVQQQNNLLRAIEAQQHLL
                     QLTVWGIKQLQARILAVERYLKDQQLLGIWGCSGKLICTTAVPWNASWSNKSLEQIWN
                     HTTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWFNITNWLWYI
                     KLFIMIVGGLVGLRIVFAVLSIVNRVRQGYSPLSFQTHLPTPRGPDRPEGIEEEGGER
                     DRDRSIRLVNGSLALIWDDLRSLCLFSYHRLRDLLLIVTRIVELLGRRGWEALKYWWN
                     LLQYWSQELKNSAVSLLNATAIAVAEGTDRVIEVVQGACRAIRHIPRRIRQGLERILL
                     "
     exon            8379..8652
                     /note="trs protein"
                     /number=3
     exon            8379..8424
                     /note="tat protein"
                     /number=3
     CDS             8797..9168
                     /note="27K protein (premature termination)"
                     /codon_start=1
                     /protein_id="AAB50263.1"
                     /db_xref="GI:1906386"
                     /translation="MGGKWSKSSVIGWPTVRERMRRAEPAADRVGAASRDLEKHGAIT
                     SSNTAATNAACAWLEAQEEEEVGFPVTPQVPLRPMTYKAAVDLSHFLKEKGGLEGLIH
                     SQRRQDILDLWIYHTQGYFPD"
     LTR             9086..9719
                     /note="3' LTR"
     repeat_region   9540..9636
                     /note="R repeat 3' copy"
     polyA_signal    9612..9617
                     /note="HXB2 mRNA polyadenyation signal"
BASE COUNT         3411 a         1772 c         2373 g         2163 t
ORIGIN      
        1 tggaagggct aattcactcc caacgaagac aagatatcct tgatctgtgg atctaccaca
       61 cacaaggcta cttccctgat tagcagaact acacaccagg gccagggatc agatatccac
      121 tgacctttgg atggtgctac aagctagtac cagttgagcc agagaagtta gaagaagcca
      181 acaaaggaga gaacaccagc ttgttacacc ctgtgagcct gcatggaatg gatgacccgg
      241 agagagaagt gttagagtgg aggtttgaca gccgcctagc atttcatcac atggcccgag
      301 agctgcatcc ggagtacttc aagaactgct gacatcgagc ttgctacaag ggactttccg
      361 ctggggactt tccagggagg cgtggcctgg gcgggactgg ggagtggcga gccctcagat
      421 cctgcatata agcagctgct ttttgcctgt actgggtctc tctggttaga ccagatctga
      481 gcctgggagc tctctggcta actagggaac ccactgctta agcctcaata aagcttgcct
      541 tgagtgcttc aagtagtgtg tgcccgtctg ttgtgtgact ctggtaacta gagatccctc
      601 agaccctttt agtcagtgtg gaaaatctct agcagtggcg cccgaacagg gacctgaaag
      661 cgaaagggaa accagaggag ctctctcgac gcaggactcg gcttgctgaa gcgcgcacgg
      721 caagaggcga ggggcggcga ctggtgagta cgccaaaaat tttgactagc ggaggctaga
      781 aggagagaga tgggtgcgag agcgtcagta ttaagcgggg gagaattaga tcgatgggaa
      841 aaaattcggt taaggccagg gggaaagaaa aaatataaat taaaacatat agtatgggca
      901 agcagggagc tagaacgatt cgcagttaat cctggcctgt tagaaacatc agaaggctgt
      961 agacaaatac tgggacagct acaaccatcc cttcagacag gatcagaaga acttagatca
     1021 ttatataata cagtagcaac cctctattgt gtgcatcaaa ggatagagat aaaagacacc
     1081 aaggaagctt tagacaagat agaggaagag caaaacaaaa gtaagaaaaa agcacagcaa
     1141 gcagcagctg acacaggaca cagcaatcag gtcagccaaa attaccctat agtgcagaac
     1201 atccaggggc aaatggtaca tcaggccata tcacctagaa ctttaaatgc atgggtaaaa
     1261 gtagtagaag agaaggcttt cagcccagaa gtgataccca tgttttcagc attatcagaa
     1321 ggagccaccc cacaagattt aaacaccatg ctaaacacag tggggggaca tcaagcagcc
     1381 atgcaaatgt taaaagagac catcaatgag gaagctgcag aatgggatag agtgcatcca
     1441 gtgcatgcag ggcctattgc accaggccag atgagagaac caaggggaag tgacatagca
     1501 ggaactacta gtacccttca ggaacaaata ggatggatga caaataatcc acctatccca
     1561 gtaggagaaa tttataaaag atggataatc ctgggattaa ataaaatagt aagaatgtat
     1621 agccctacca gcattctgga cataagacaa ggaccaaagg aaccctttag agactatgta
     1681 gaccggttct ataaaactct aagagccgag caagcttcac aggaggtaaa aaattggatg
     1741 acagaaacct tgttggtcca aaatgcgaac ccagattgta agactatttt aaaagcattg
     1801 ggaccagcgg ctacactaga agaaatgatg acagcatgtc agggagtagg aggacccggc
     1861 cataaggcaa gagttttggc tgaagcaatg agccaagtaa caaattcagc taccataatg
     1921 atgcagagag gcaattttag gaaccaaaga aagattgtta agtgtttcaa ttgtggcaaa
     1981 gaagggcaca cagccagaaa ttgcagggcc cctaggaaaa agggctgttg gaaatgtgga
     2041 aaggaaggac accaaatgaa agattgtact gagagacagg ctaatttttt agggaagatc
     2101 tggccttcct acaagggaag gccagggaat tttcttcaga gcagaccaga gccaacagcc
     2161 ccaccagaag agagcttcag gtctggggta gagacaacaa ctccccctca gaagcaggag
     2221 ccgatagaca aggaactgta tcctttaact tccctcaggt cactctttgg caacgacccc
     2281 tcgtcacaat aaagataggg gggcaactaa aggaagctct attagataca ggagcagatg
     2341 atacagtatt agaagaaatg agtttgccag gaagatggaa accaaaaatg atagggggaa
     2401 ttggaggttt tatcaaagta agacagtatg atcagatact catagaaatc tgtggacata
     2461 aagctatagg tacagtatta gtaggaccta cacctgtcaa cataattgga agaaatctgt
     2521 tgactcagat tggttgcact ttaaattttc ccattagccc tattgagact gtaccagtaa
     2581 aattaaagcc aggaatggat ggcccaaaag ttaaacaatg gccattgaca gaagaaaaaa
     2641 taaaagcatt agtagaaatt tgtacagaga tggaaaagga agggaaaatt tcaaaaattg
     2701 ggcctgaaaa tccatacaat actccagtat ttgccataaa gaaaaaagac agtactaaat
     2761 ggagaaaatt agtagatttc agagaactta ataagagaac tcaagacttc tgggaagttc
     2821 aattaggaat accacatccc gcagggttaa aaaagaaaaa atcagtaaca gtactggatg
     2881 tgggtgatgc atatttttca gttcccttag atgaagactt caggaagtat actgcattta
     2941 ccatacctag tataaacaat gagacaccag ggattagata tcagtacaat gtgcttccac
     3001 agggatggaa aggatcacca gcaatattcc aaagtagcat gacaaaaatc ttagagcctt
     3061 ttagaaaaca aaatccagac atagttatct atcaatacat ggatgatttg tatgtaggat
     3121 ctgacttaga aatagggcag catagaacaa aaatagagga gctgagacaa catctgttga
     3181 ggtggggact taccacacca gacaaaaaac atcagaaaga acctccattc ctttggatgg
     3241 gttatgaact ccatcctgat aaatggacag tacagcctat agtgctgcca gaaaaagaca
     3301 gctggactgt caatgacata cagaagttag tggggaaatt gaattgggca agtcagattt
     3361 acccagggat taaagtaagg caattatgta aactccttag aggaaccaaa gcactaacag
     3421 aagtaatacc actaacagaa gaagcagagc tagaactggc agaaaacaga gagattctaa
     3481 aagaaccagt acatggagtg tattatgacc catcaaaaga cttaatagca gaaatacaga
     3541 agcaggggca aggccaatgg acatatcaaa tttatcaaga gccatttaaa aatctgaaaa
     3601 caggaaaata tgcaagaatg aggggtgccc acactaatga tgtaaaacaa ttaacagagg
     3661 cagtgcaaaa aataaccaca gaaagcatag taatatgggg aaagactcct aaatttaaac
     3721 tgcccataca aaaggaaaca tgggaaacat ggtggacaga gtattggcaa gccacctgga
     3781 ttcctgagtg ggagtttgtt aatacccctc ccttagtgaa attatggtac cagttagaga
     3841 aagaacccat agtaggagca gaaaccttct atgtagatgg ggcagctaac agggagacta
     3901 aattaggaaa agcaggatat gttactaata gaggaagaca aaaagttgtc accctaactg
     3961 acacaacaaa tcagaagact gagttacaag caatttatct agctttgcag gattcgggat
     4021 tagaagtaaa catagtaaca gactcacaat atgcattagg aatcattcaa gcacaaccag
     4081 atcaaagtga atcagagtta gtcaatcaaa taatagagca gttaataaaa aaggaaaagg
     4141 tctatctggc atgggtacca gcacacaaag gaattggagg aaatgaacaa gtagataaat
     4201 tagtcagtgc tggaatcagg aaagtactat ttttagatgg aatagataag gcccaagatg
     4261 aacatgagaa atatcacagt aattggagag caatggctag tgattttaac ctgccacctg
     4321 tagtagcaaa agaaatagta gccagctgtg ataaatgtca gctaaaagga gaagccatgc
     4381 atggacaagt agactgtagt ccaggaatat ggcaactaga ttgtacacat ttagaaggaa
     4441 aagttatcct ggtagcagtt catgtagcca gtggatatat agaagcagaa gttattccag
     4501 cagaaacagg gcaggaaaca gcatattttc ttttaaaatt agcaggaaga tggccagtaa
     4561 aaacaataca tactgacaat ggcagcaatt tcaccggtgc tacggttagg gccgcctgtt
     4621 ggtgggcggg aatcaagcag gaatttggaa ttccctacaa tccccaaagt caaggagtag
     4681 tagaatctat gaataaagaa ttaaagaaaa ttataggaca ggtaagagat caggctgaac
     4741 atcttaagac agcagtacaa atggcagtat tcatccacaa ttttaaaaga aaagggggga
     4801 ttggggggta cagtgcaggg gaaagaatag tagacataat agcaacagac atacaaacta
     4861 aagaattaca aaaacaaatt acaaaaattc aaaattttcg ggtttattac agggacagca
     4921 gaaatccact ttggaaagga ccagcaaagc tcctctggaa aggtgaaggg gcagtagtaa
     4981 tacaagataa tagtgacata aaagtagtgc caagaagaaa agcaaagatc attagggatt
     5041 atggaaaaca gatggcaggt gatgattgtg tggcaagtag acaggatgag gattagaaca
     5101 tggaaaagtt tagtaaaaca ccatatgtat gtttcaggga aagctagggg atggttttat
     5161 agacatcact atgaaagccc tcatccaaga ataagttcag aagtacacat cccactaggg
     5221 gatgctagat tggtaataac aacatattgg ggtctgcata caggagaaag agactggcat
     5281 ttgggtcagg gagtctccat agaatggagg aaaaagagat atagcacaca agtagaccct
     5341 gaactagcag accaactaat tcatctgtat tactttgact gtttttcaga ctctgctata
     5401 agaaaggcct tattaggaca catagttagc cctaggtgtg aatatcaagc aggacataac
     5461 aaggtaggat ctctacaata cttggcacta gcagcattaa taacaccaaa aaagataaag
     5521 ccacctttgc ctagtgttac gaaactgaca gaggatagat ggaacaagcc ccagaagacc
     5581 aagggccaca gagggagcca cacaatgaat ggacactaga gcttttagag gagcttaaga
     5641 atgaagctgt tagacatttt cctaggattt ggctccatgg cttagggcaa catatctatg
     5701 aaacttatgg ggatacttgg gcaggagtgg aagccataat aagaattctg caacaactgc
     5761 tgtttatcca ttttcagaat tgggtgtcga catagcagaa taggcgttac tcgacagagg
     5821 agagcaagaa atggagccag tagatcctag actagagccc tggaagcatc caggaagtca
     5881 gcctaaaact gcttgtacca attgctattg taaaaagtgt tgctttcatt gccaagtttg
     5941 tttcataaca aaagccttag gcatctccta tggcaggaag aagcggagac agcgacgaag
     6001 agctcatcag aacagtcaga ctcatcaagc ttctctatca aagcagtaag tagtacatgt
     6061 aacgcaacct ataccaatag tagcaatagt agcattagta gtagcaataa taatagcaat
     6121 agttgtgtgg tccatagtaa tcatagaata taggaaaata ttaagacaaa gaaaaataga
     6181 caggttaatt gatagactaa tagaaagagc agaagacagt ggcaatgaga gtgaaggaga
     6241 aatatcagca cttgtggaga tgggggtgga gatggggcac catgctcctt gggatgttga
     6301 tgatctgtag tgctacagaa aaattgtggg tcacagtcta ttatggggta cctgtgtgga
     6361 aggaagcaac caccactcta ttttgtgcat cagatgctaa agcatatgat acagaggtac
     6421 ataatgtttg ggccacacat gcctgtgtac ccacagaccc caacccacaa gaagtagtat
     6481 tggtaaatgt gacagaaaat tttaacatgt ggaaaaatga catggtagaa cagatgcatg
     6541 aggatataat cagtttatgg gatcaaagcc taaagccatg tgtaaaatta accccactct
     6601 gtgttagttt aaagtgcact gatttgaaga atgatactaa taccaatagt agtagcggga
     6661 gaatgataat ggagaaagga gagataaaaa actgctcttt caatatcagc acaagcataa
     6721 gaggtaaggt gcagaaagaa tatgcatttt tttataaact tgatataata ccaatagata
     6781 atgatactac cagctataag ttgacaagtt gtaacacctc agtcattaca caggcctgtc
     6841 caaaggtatc ctttgagcca attcccatac attattgtgc cccggctggt tttgcgattc
     6901 taaaatgtaa taataagacg ttcaatggaa caggaccatg tacaaatgtc agcacagtac
     6961 aatgtacaca tggaattagg ccagtagtat caactcaact gctgttaaat ggcagtctag
     7021 cagaagaaga ggtagtaatt agatctgtca atttcacgga caatgctaaa accataatag
     7081 tacagctgaa cacatctgta gaaattaatt gtacaagacc caacaacaat acaagaaaaa
     7141 gaatccgtat ccagagagga ccagggagag catttgttac aataggaaaa ataggaaata
     7201 tgagacaagc acattgtaac attagtagag caaaatggaa taacacttta aaacagatag
     7261 ctagcaaatt aagagaacaa tttggaaata ataaaacaat aatctttaag caatcctcag
     7321 gaggggaccc agaaattgta acgcacagtt ttaattgtgg aggggaattt ttctactgta
     7381 attcaacaca actgtttaat agtacttggt ttaatagtac ttggagtact gaagggtcaa
     7441 ataacactga aggaagtgac acaatcaccc tcccatgcag aataaaacaa attataaaca
     7501 tgtggcagaa agtaggaaaa gcaatgtatg cccctcccat cagtggacaa attagatgtt
     7561 catcaaatat tacagggctg ctattaacaa gagatggtgg taatagcaac aatgagtccg
     7621 agatcttcag acctggagga ggagatatga gggacaattg gagaagtgaa ttatataaat
     7681 ataaagtagt aaaaattgaa ccattaggag tagcacccac caaggcaaag agaagagtgg
     7741 tgcagagaga aaaaagagca gtgggaatag gagctttgtt ccttgggttc ttgggagcag
     7801 caggaagcac tatgggcgca gcctcaatga cgctgacggt acaggccaga caattattgt
     7861 ctggtatagt gcagcagcag aacaatttgc tgagggctat tgaggcgcaa cagcatctgt
     7921 tgcaactcac agtctggggc atcaagcagc tccaggcaag aatcctggct gtggaaagat
     7981 acctaaagga tcaacagctc ctggggattt ggggttgctc tggaaaactc atttgcacca
     8041 ctgctgtgcc ttggaatgct agttggagta ataaatctct ggaacagatt tggaatcaca
     8101 cgacctggat ggagtgggac agagaaatta acaattacac aagcttaata cactccttaa
     8161 ttgaagaatc gcaaaaccag caagaaaaga atgaacaaga attattggaa ttagataaat
     8221 gggcaagttt gtggaattgg tttaacataa caaattggct gtggtatata aaattattca
     8281 taatgatagt aggaggcttg gtaggtttaa gaatagtttt tgctgtactt tctatagtga
     8341 atagagttag gcagggatat tcaccattat cgtttcagac ccacctccca accccgaggg
     8401 gacccgacag gcccgaagga atagaagaag aaggtggaga gagagacaga gacagatcca
     8461 ttcgattagt gaacggatcc ttggcactta tctgggacga tctgcggagc ctgtgcctct
     8521 tcagctacca ccgcttgaga gacttactct tgattgtaac gaggattgtg gaacttctgg
     8581 gacgcagggg gtgggaagcc ctcaaatatt ggtggaatct cctacagtat tggagtcagg
     8641 aactaaagaa tagtgctgtt agcttgctca atgccacagc catagcagta gctgagggga
     8701 cagatagggt tatagaagta gtacaaggag cttgtagagc tattcgccac atacctagaa
     8761 gaataagaca gggcttggaa aggattttgc tataagatgg gtggcaagtg gtcaaaaagt
     8821 agtgtgattg gatggcctac tgtaagggaa agaatgagac gagctgagcc agcagcagat
     8881 agggtgggag cagcatctcg agacctggaa aaacatggag caatcacaag tagcaataca
     8941 gcagctacca atgctgcttg tgcctggcta gaagcacaag aggaggagga ggtgggtttt
     9001 ccagtcacac ctcaggtacc tttaagacca atgacttaca aggcagctgt agatcttagc
     9061 cactttttaa aagaaaaggg gggactggaa gggctaattc actcccaaag aagacaagat
     9121 atccttgatc tgtggatcta ccacacacaa ggctacttcc ctgattagca gaactacaca
     9181 ccagggccag gggtcagata tccactgacc tttggatggt gctacaagct agtaccagtt
     9241 gagccagata agatagaaga ggccaataaa ggagagaaca ccagcttgtt acaccctgtg
     9301 agcctgcatg ggatggatga cccggagaga gaagtgttag agtggaggtt tgacagccgc
     9361 ctagcatttc atcacgtggc ccgagagctg catccggagt acttcaagaa ctgctgacat
     9421 cgagcttgct acaagggact ttccgctggg gactttccag ggaggcgtgg cctgggcggg
     9481 actggggagt ggcgagccct cagatcctgc atataagcag ctgctttttg cctgtactgg
     9541 gtctctctgg ttagaccaga tctgagcctg ggagctctct ggctaactag ggaacccact
     9601 gcttaagcct caataaagct tgccttgagt gcttcaagta gtgtgtgccc gtctgttgtg
     9661 tgactctggt aactagagat ccctcagacc cttttagtca gtgtggaaaa tctctagca
//