LOCUS       CP001015             2078953 bp    DNA     circular BCT 30-JAN-2014
DEFINITION  Streptococcus pneumoniae G54, complete genome.
ACCESSION   CP001015 AL449923-AL449953
VERSION     CP001015.1
DBLINK      BioProject: PRJNA29047
            BioSample: SAMN02603350
KEYWORDS    .
SOURCE      Streptococcus pneumoniae G54
  ORGANISM  Streptococcus pneumoniae G54
            Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae;
            Streptococcus.
REFERENCE   1  (bases 1 to 2078953)
  AUTHORS   Dopazo,J., Mendoza,A., Herrero,J., Caldara,F., Humbert,Y.,
            Friedli,L., Guerrier,M., Grand-Schenk,E., Gandin,C., de
            Francesco,M., Polissi,A., Buell,G., Feger,G., Garcia,E., Peitsch,M.
            and Garcia-Bustos,J.F.
  TITLE     Annotated draft genomic sequence from a Streptococcus pneumoniae
            type 19F clinical isolate
  JOURNAL   Microb. Drug Resist. 7 (2), 99-125 (2001)
   PUBMED   11442348
REFERENCE   2  (bases 1 to 2078953)
  AUTHORS   Mulas,L., Trappetti,C., Hakenbeck,R., Iannelli,F., Pozzi,G.,
            Davidsen,T.M., Tettelin,H. and Oggioni,M.
  TITLE     Pneumococcal beta glucoside metabolism investigated by whole genome
            comparison
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 2078953)
  AUTHORS   Mulas,L., Trappetti,C., Iannelli,F., Pozzi,G., Davidsen,T.M.,
            Tettelin,H. and Oggioni,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-MAR-2008) J. Craig Venter Institute, 9712 Medical
            Center Dr, Rockville, MD 20850, USA
COMMENT     On or before Jul 28, 2008 this sequence version replaced
            AL449923.1, AL449924.1, AL449925.1, AL449926.1, AL449927.1,
            AL449928.1, AL449929.1, AL449930.1, AL449931.1, AL449932.1,
            AL449933.1, AL449934.1, AL449935.1, AL449936.1, AL449937.1,
            AL449938.1, AL449939.1, AL449940.1, AL449941.1, AL449942.1,
            AL449943.1, AL449944.1, AL449945.1, AL449946.1, AL449947.1,
            AL449948.1, AL449949.1, AL449950.1, AL449951.1, AL449952.1,
            AL449953.1.
            CP001015 is derived from contigs that were subjected to intra and
            inter-contig reassembly. All gaps confirmed by PCR and closed by
            sequencing. No resequencing of ambiguities throughout the genome
            was performed.
FEATURES             Location/Qualifiers
     source          1..2078953
                     /organism="Streptococcus pneumoniae G54"
                     /mol_type="genomic DNA"
                     /strain="G54"
                     /serotype="19F"
                     /isolation_source="respiratory sample"
                     /db_xref="taxon:512566"
                     /country="Italy: Genova"
                     /collection_date="1991"
                     /collected_by="G. Shito"
                     /note="resistant to macrolides and tetracylcine"
     gene            197..1558
                     /gene="dnaA"
                     /locus_tag="SPG_0001"
     CDS             197..1558
                     /gene="dnaA"
                     /locus_tag="SPG_0001"
                     /note="identified by match to protein family HMM PF00308;
                     match to protein family HMM PF08299; match to protein
                     family HMM TIGR00362"
                     /codon_start=1
                     /transl_table=11
                     /product="chromosomal replication initiator protein DnaA"
                     /protein_id="ACF56248.1"
                     /translation="MKEKQFWNRILEFAQERLTRSMYDFYAIQAELIKVEENVATIFL
                     PRSEMEMVWEKQLKDIIVVAGFEIYDAEITPHYIFTKPQDTTSSQVEEATNLTLYNYS
                     PKLVSIPYSDTGLKEKYTFDNFIQGDGNVWAVSAALAVSEDLALTYNPLFIYGGPGLG
                     KTHLLNAIGNEILKNIPNARVKYIPAESFINDFLDHLRLGEMEKFKKTYRSLDLLLID
                     DIQSLSGKKVATQEEFFNTFNALHDKQKQIVLTSDRSPKHLEGLEERLVTRFSWGLTQ
                     TITPPDFETRIAILQSKTEHLGYNFQSDTLEYLAGQFDSNVRDLEGAINDITLIARVK
                     KIKDITIDIAAEAIRARKQDVSQMLVIPIDKIQTEVGNFYGVSIKEMKGSRRLQNIVL
                     ARQVAMYLSRELTDNSLPKIGKEFGGKDHTTVIHAHAKIKSLIDQDDNLRLEIESIKK
                     KIK"
     gene            1717..2853
                     /gene="dnaN"
                     /locus_tag="SPG_0002"
     CDS             1717..2853
                     /gene="dnaN"
                     /locus_tag="SPG_0002"
                     /EC_number="2.7.7.7"
                     /note="identified by match to protein family HMM PF00712;
                     match to protein family HMM PF02767; match to protein
                     family HMM PF02768; match to protein family HMM TIGR00663"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III beta subunit"
                     /protein_id="ACF55669.1"
                     /translation="MIHFSINKNLFLQALNTTKRAISSKNAIPILSTVKIDVTNEGIT
                     LIGSNGQISIENFISQKNEDAGLLITSLGSILLEASFFINVVSSLPDVTLDFKEIEQN
                     QIVLTSGKSEITLKGKDSEQYPRIQEISASTPLILETKLLKKIINETAFAASTQESRP
                     ILTGVHFVLSQHKELKTVATDSHRLSQKKLTLEKNSDDFDVVIPSRSLREFSAVFTDD
                     IETVEIFFANNQILFRSENISFYTRLLEGNYPDTDRLIPTDFNTTITFNVVNLRQSME
                     RARLLSSATQNGTVKLEIKDGVVSAHVHSPEVGKVNEEIDTDQVTGEDLTISFNPTYL
                     IDSLKALNSEKVTISFISAVRPFTLVPADTDEDFMQLITPVRTN"
     gene            2918..3112
                     /locus_tag="SPG_0003"
     CDS             2918..3112
                     /locus_tag="SPG_0003"
                     /note="identified by match to protein family HMM PF06107"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved domain protein"
                     /protein_id="ACF55058.1"
                     /translation="MYQVGNFVEMKKSHACTIKSTGKKANRWEITRVGADIKIKCSNC
                     EHVVMMGRYDFERKMNKIID"
     gene            3196..4311
                     /locus_tag="SPG_0004"
     CDS             3196..4311
                     /locus_tag="SPG_0004"
                     /note="identified by match to protein family HMM PF01926;
                     match to protein family HMM PF06071; match to protein
                     family HMM TIGR00092"
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-binding protein"
                     /protein_id="ACF56406.1"
                     /translation="MALTAGIVGLPNVGKSTLFNAITKAGAEAANYPFATIDPNVGMV
                     EVPDERLQKLTEMITPKKTVPTTFEFTDIAGIVKGASKGEGLGNKFLANIREVDAIVH
                     VVRAFDDENVMREQGREDAFVDPLADIDTINLELILADLESVNKRYARVEKMARTQKD
                     KESVAEFNVLQKIKPVLEDGKSARTIEFTDEEQKVVKGLFLLTTKPVLYVANVDEDVV
                     SEPDSIDYVKQIREFAATENAEVVVISARAEEEISELDDEDKKEFLEAIGLTESGVDK
                     LTRAAYHLLGLGTYFTAGEKEVRAWTFKRGMKATQAAGIIHSDFEKGFIRAVTMSYED
                     LVKYGSEKAVKEAGRLREEGKEYIVQDGDIMEFRFNV"
     gene            4382..4951
                     /gene="pth"
                     /locus_tag="SPG_0005"
     CDS             4382..4951
                     /gene="pth"
                     /locus_tag="SPG_0005"
                     /EC_number="3.1.1.29"
                     /note="identified by match to protein family HMM PF01195;
                     match to protein family HMM TIGR00447"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-tRNA hydrolase"
                     /protein_id="ACF56061.1"
                     /translation="MTKLLVGLGNPGDKYFETKHNVGFMLIDQLAKKQNVTFTHDKIF
                     QADLASFFLNGEKIYLVKPTTFMNESGKAVHALLTYYGLDIDDLLIIYDDLDMEVGKI
                     RLRAKGSAGGHNGIKSIIQHIGTQVFNRVKIGIGRPKNGMSVVHHVLSKFDRDDYIGI
                     LQSVDKVDDSVNYYLQEKNFEKTMQRYNG"
     gene            4952..8461
                     /gene="mfd"
                     /locus_tag="SPG_0006"
     CDS             4952..8461
                     /gene="mfd"
                     /locus_tag="SPG_0006"
                     /EC_number="3.6.1.-"
                     /note="identified by match to protein family HMM PF00270;
                     match to protein family HMM PF00271; match to protein
                     family HMM PF02559; match to protein family HMM PF03461;
                     match to protein family HMM PF04851; match to protein
                     family HMM TIGR00580"
                     /codon_start=1
                     /transl_table=11
                     /product="transcription-repair coupling factor"
                     /protein_id="ACF55220.1"
                     /translation="MVTLLDLFSENDQIKKWHQNLTDKKRQLILGLSTSTKALAIASS
                     LEKEDRIVLLTSTYGEAEGLVSDLISILGEELVYPFLVDDAPMVEFLMSSQEKIISRV
                     EALRFLTDSSKKGILVCNIAASRLILPSPNAFKDSIVKISVGEEYDQHAFIHQLKENG
                     YRKVTQVQTQGEFSLRGDILDIFEMSQLEPCRIEFFGDEIDGIRSFEVETQLSKENKI
                     ELTIFPASDMLLREKDYQRGQSALEKQISKTLSPILKSYLEEILSSFHQKQSHADSRK
                     FLSLCYDKTWTVFDYIEKDTPIFFDDYQKLMNQYEVFERELAQYFTEELQNSKAFSDM
                     QYFSDIEQIYKKQSPVTFFSNLQKGLGNLKFDKIYQFNQYPMQEFFNQFSFLKEEIER
                     YKKMDYTIILQSSNSMGSKTLEDMLEEYQIKLDSRDKTSICKESVNLIEGNLRHGFHF
                     VDEKILLITEHEIFQKKLKRRFRRQHVSNAERLKDYNELEKGDYVVHHIHGIGQYLGI
                     ETIEIKGIHRDYVSVQYQNGDQISIPVEQIHLLSKYISSDGKAPKLNKLNDGHFKKAK
                     QKVKNQVEDIADDLIKLYSERSQLKGFAFSADDDDQDAFDDAFPYVETDDQLRSIEEI
                     KRDMQASQPMDRLLVGDVGFGKTEVAMRAAFKAVNDHKQVVILVPTTVLAQQHYTNFK
                     ERFQNFAVNVDVLSRFRSKKEQTATLEKLKNGQVDILIGTHRVLSKDVVFADLGLMII
                     DEEQRFGVKHKETLKELKKQVDVLTLTATPIPRTLHMSMLGIRDLSVIETPPTNRYPV
                     QTYVLEKNDSVIRDAVLREMERGGQVYYLYNKVDTIVQKVSELQELIPEASIGYVHGR
                     MSEVQLENTLLDFIEGQYDILVTTTIIETGVDIPNANTLFIENADHMGLSTLYQLRGR
                     VGRSNRIAYAYLMYRPEKSISEVSEKRLEAIKGFTELGSGFKIAMRDLSIRGAGNLLG
                     KSQSGFIDSVGFELYSQLLEEAIAKRNGNANANTRTKGNAELVLQIDAYLPDTYISDQ
                     RHKIEIYKKIRQIDNRVNYEELQEELIDRFGEYPDVVAYLLEIGLVKSYLDKVFVQRV
                     ERKDNKITIQFEKVTQRLFLAQDYFKALSVTNLKAGIAENKGLMELVFDVQNKKDYEI
                     LEGLLIFGESLLEIKESKEENSI"
     gene            8519..8785
                     /locus_tag="SPG_0007"
     CDS             8519..8785
                     /locus_tag="SPG_0007"
                     /note="identified by match to protein family HMM PF01479"
                     /codon_start=1
                     /transl_table=11
                     /product="S4 domain"
                     /protein_id="ACF54885.1"
                     /translation="MRLDKYLKVSRIIKRRTVAKEVADKGRIKVNGILAKSSTDLKVN
                     DQVEIRFGNKLLLVKVLEMKDSTKKEDAAGMYEIISETRVEENV"
     gene            8778..9146
                     /locus_tag="SPG_0008"
     CDS             8778..9146
                     /locus_tag="SPG_0008"
                     /note="identified by match to protein family HMM PF04977"
                     /codon_start=1
                     /transl_table=11
                     /product="septum formation initiator, putative"
                     /protein_id="ACF56207.1"
                     /translation="MSKNIVQLNNSFIQNEYQRRRYLMKERQKRNRFMGGVLILIMLL
                     FILPTFNLAQSYQQLLQRRQQLADLQTQYQTLSDEKDKETAFATKLKDEDYAAKYTRA
                     KYYYSKSREKVYTIPDLLQR"
     gene            9151..9273
                     /locus_tag="SPG_0009"
     CDS             9151..9273
                     /locus_tag="SPG_0009"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF55609.1"
                     /translation="MENLLDVIEQFLSLSDEKLEELADKNQLLRLQEEKERKNA"
     gene            9266..10534
                     /locus_tag="SPG_0010"
     CDS             9266..10534
                     /locus_tag="SPG_0010"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF55108.1"
                     /translation="MRKFLIILLLPSFLTISKVVSTEKEVVYTSKEIYYLSQSDFGIY
                     FREKLSSPMVYGEVPVYANEDLVVESGKLTPKTSFQITEWRLNKQGIPVFKLSNHQFI
                     AADKRFLYDQSEVTPTIKKVWLESDFKLYNSPYDLKEVKSSLSAYSQVSIDKTMFVEG
                     REFLHIDQAGWVAKESTSEEDNRMSKAQEMLSEKYQKDSFSIYVKQLTTGKEAGINQD
                     EKMYAASVLKLSYLYYTQEKINEGLYQLDTTVKYVSAVNDFPGSYKPEGSGSLPKKED
                     NKEYSLKDLITKVSKESDNVAHNLLGYYISNQSDATFKSKMSAIMGDDWDPKEKLISS
                     KMAGKFMEAIYNQNGFVLESLTKTDFDSQRIAKGVSVKVAHKIGDADEFKHDTGVVYA
                     DSPFILSIFTKNSDYDTISKIAKDVYEVLK"
     gene            10531..11808
                     /gene="tilS"
                     /locus_tag="SPG_0011"
     CDS             10531..11808
                     /gene="tilS"
                     /locus_tag="SPG_0011"
                     /EC_number="6.3.4.-"
                     /note="identified by match to protein family HMM PF01171;
                     match to protein family HMM TIGR02432; match to protein
                     family HMM TIGR02433"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA(Ile)-lysidine synthase"
                     /protein_id="ACF56646.1"
                     /translation="MREQDFLNHFLKKGYFKKHAKAVLALSGGLDSMFLFKVLSTYQK
                     ELEIELILAHVNHKQRIESDWEEKELRKLAAEAELPIYISNFSGEFSEARARNFRYDF
                     FQEVMKKTGATALVTAHHADDQVETILMRLIRGTRLRYLSGIKEKQVVGEIEIIRPFL
                     HFQKKDFPSIFHFEDTSNQENHYFRNRIRNSYLPELEKENPRFRDAILGIGNEILDYD
                     LAIAELSNNIDVENLQQLFSYSESTQRVLLQTYLNRFPDLNLTKAQFAEVQQILKSKS
                     QYRHPIKNGYELIKEYQQFQICKISPQADEKEDELVLHYQNQVAYQGYLFSFGLPLEG
                     ELIQQIPVSRETSIHIRHRKTGDVLIQNGHRKKLRRLFIDLKIPMEKRNSALIIEQFG
                     EIVSILGIATNNLSKKTKNDIMNTVLYIEKIDR"
     gene            11812..12354
                     /gene="hpt"
                     /locus_tag="SPG_0012"
     CDS             11812..12354
                     /gene="hpt"
                     /locus_tag="SPG_0012"
                     /EC_number="2.4.2.8"
                     /note="identified by match to protein family HMM PF00156;
                     match to protein family HMM TIGR01203"
                     /codon_start=1
                     /transl_table=11
                     /product="hypoxanthine-guanine phosphoribosyltransferase"
                     /protein_id="ACF55523.1"
                     /translation="MLENDIKKVLVSHDEITEAAKKLGAQLTKDYAGKNPILVGILKG
                     SIPFMAELVKHIDTHIEMDFMMVSSYHGGTASSGVINIKQDVTQDIKGRHVLFVEDII
                     DTGQTLKNLRDMFKEREAASVKIATLLDKPEGRVVEIEADYTCFTIPNEFVVGYGLDY
                     KENYRNLPYIGVLKEEVYSN"
     gene            12370..14328
                     /locus_tag="SPG_0013"
     CDS             12370..14328
                     /locus_tag="SPG_0013"
                     /EC_number="3.4.24.-"
                     /note="identified by match to protein family HMM PF00004;
                     match to protein family HMM PF01434; match to protein
                     family HMM PF06480; match to protein family HMM TIGR01241"
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsH"
                     /protein_id="ACF54905.1"
                     /translation="MKKQNNGLIKNPFLWLLFIFFLVTGFQYFYSGNNSGGSQQINYT
                     ELVQEITDGNVKELTYQPNGSVIEVSGVYKNPKTSKEGTGIQFFTPSVTKVEKFTSTI
                     LPADTTVSELQKLATDHKAEVTVKHESSSGIWINLLVSIVPFGILFFFLFSMMGNMGG
                     GNGRNPMSFGRSKAKAANKEDIKVRFSDVAGAEEEKQELVEVVEFLKDPKRFTKLGAR
                     IPAGVLLEGPPGTGKTLLAKAVAGEAGVPFFSISGSDFVEMFVGVGASRVRSLFEDAK
                     KAAPAIIFIDEIDAVGRQRGVGLGGGNDEREQTLNQLLIEMDGFEGNEGIIVIAATNR
                     SDVLDPALLRPGRFDRKVLVGRPDVKGREAILKVHAKNKPLAEDVDLKLVAQQTPGFV
                     GADLENVLNEAALVAARRNKSIIDASDIDEAEDRVIAGPSKKDKTVSQKERELVAYHE
                     AGHTIVGLVLSNARVVHKVTIVPRGRAGGYMIALPKEDQMLLSKEDMKEQLAGLMGGR
                     VAEEIIFNVQTTGASNDFEQATQMARAMVTEYGMSEKLGPVQYEGNHAMLGAQSPQKS
                     ISEQTAYEIDEEVRSLLNEARNKAAEIIQSNRETHKLIAEALLKYETLDSTQIKALYE
                     TGKMPEAVEEESHALSYDEVKSKMNDEK"
     gene            14450..14929
                     /locus_tag="SPG_0014"
     CDS             14450..14929
                     /locus_tag="SPG_0014"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator ComX1"
                     /protein_id="ACF54775.1"
                     /translation="MIKELYEEVQGTVYKCRNEYYLHLWELSDWDQEGMLCLHELISR
                     EEGLADDIPRLRKYFKTKFRNRILDYIRKQESQKRRYDKEPYEEVGEISHRISEGGLW
                     LDDYYLFHETLRDYRNKQSKEKQEELERVLSNERFRGRQRVLRDLRIVFKEFTIRTH"
     gene            15023..15094
                     /locus_tag="SPG_0015"
     tRNA            15023..15094
                     /locus_tag="SPG_0015"
                     /product="tRNA-Glu"
     gene            15360..16817
                     /gene="rrsA"
                     /locus_tag="SPG_0016"
     rRNA            15360..16817
                     /gene="rrsA"
                     /locus_tag="SPG_0016"
                     /product="16S ribosomal RNA"
     gene            16944..17016
                     /locus_tag="SPG_0017"
     tRNA            16944..17016
                     /locus_tag="SPG_0017"
                     /product="tRNA-Ala"
     gene            17141..20042
                     /gene="rrlA"
                     /locus_tag="SPG_0018"
     rRNA            17141..20042
                     /gene="rrlA"
                     /locus_tag="SPG_0018"
                     /product="23S ribosomal RNA"
     gene            20119..20234
                     /gene="rrfA"
                     /locus_tag="SPG_0019"
     rRNA            20119..20234
                     /gene="rrfA"
                     /locus_tag="SPG_0019"
                     /product="5S ribosomal RNA"
     gene            20240..20313
                     /locus_tag="SPG_0020"
     tRNA            20240..20313
                     /locus_tag="SPG_0020"
                     /product="tRNA-Asn"
     gene            complement(20407..20724)
                     /locus_tag="SPG_0021"
     CDS             complement(20407..20724)
                     /locus_tag="SPG_0021"
                     /codon_start=1
                     /transl_table=11
                     /product="IS1167 transposase"
                     /protein_id="ACF56285.1"
                     /translation="MHLTNKEILDKLLSYSEDLKHHYNLYQLLLFHLFFRLCLKPSSK
                     IKKKSSTAFNYLIPTPNWKPPIISSNLSSTMPLVLGTLKTSKKKGRNLSFLKLSFSST
                     HYS"
     gene            complement(20757..20900)
                     /locus_tag="SPG_0022"
     CDS             complement(20757..20900)
                     /locus_tag="SPG_0022"
                     /codon_start=1
                     /transl_table=11
                     /product="IS1167 transposase"
                     /protein_id="ACF55379.1"
                     /translation="MSFIAQDFDKLNIITVLESRTQAIIRNPMNTVLSSDTESSFNKI
                     VRN"
     gene            complement(20948..21154)
                     /locus_tag="SPG_0023"
     CDS             complement(20948..21154)
                     /locus_tag="SPG_0023"
                     /codon_start=1
                     /transl_table=11
                     /product="IS1167 transposase"
                     /protein_id="ACF55587.1"
                     /translation="MRVAETSIVKKNHQIPCIINQKIAQKLIKKTSMTDIDHQLSIST
                     STVIRKINDFHFEHDFSRLPEIMS"
     gene            21470..21706
                     /locus_tag="SPG_0024"
     CDS             21470..21706
                     /locus_tag="SPG_0024"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF55111.1"
                     /translation="MLQKIYEQMANFYDSIEEEYGPTFGDNFDWEHVHFKFLIYYLVR
                     YGIGCRRDFIVYHYRVAYRLYLEKLVMNRGFISC"
     gene            21895..23223
                     /gene="purA"
                     /locus_tag="SPG_0025"
     CDS             21895..23223
                     /gene="purA"
                     /locus_tag="SPG_0025"
                     /EC_number="6.3.4.4"
                     /note="Dagkessamanskaia A,Mol Microbiol. 2004
                     Feb;51(4):1071-86.; identified by match to protein family
                     HMM PF00709; match to protein family HMM TIGR00184"
                     /codon_start=1
                     /transl_table=11
                     /product="adenylosuccinate synthetase"
                     /protein_id="ACF56085.1"
                     /translation="MYVRKEEPEGSDKIMTSVVVVGTQWGDEGKGKITDFLSANAEVI
                     ARYQGGDNAGHTIVIDGKKFKLHLIPSGIFFPEKISVIGNGMVVNPKSLVKELSYLHE
                     EGVTTDNLRISDRAHVILPYHIELDRLQEEAKGDNKIGTTIKGIGPAYMDKAARVGIR
                     IADLLDKDIFRERLERNLAEKNRLFEKLYDSKAIVFDDIFEEYYEYGQQIKKYVIDTS
                     VILNDALDNGKRVLFEGAQGVMLDIDQGTYPFVTSSNPVAGGVTIGSGVGPSKIDKVV
                     GVCKAYTSRVGDGPFPTELFDEVGERIREVGHEYGTTTGRPRRVGWFDSVVMRHSRRV
                     SGITNLSLNSIDVLSGLDTVKICVAYDLDGQRIDYYPASLEQLKRCKPIYEELPGWSE
                     DITGVRNLEDLPENARNYVRRVSELVGVRISTFSVGPGREQTNILESVWS"
     gene            23424..23744
                     /locus_tag="SPG_0026"
     CDS             23424..23744
                     /locus_tag="SPG_0026"
                     /note="contains potential frameshift; identified by match
                     to protein family HMM PF00383"
                     /codon_start=1
                     /transl_table=11
                     /product="Cytosine/adenosine deaminase"
                     /protein_id="ACF56556.1"
                     /translation="MYYTLEEKEVFMREALREAEIALEHDEIPIGCVIVKDGEIIGRG
                     HNAREELQRAVMHAEIMAIEDANLSEESWRLLDCTLFVTIEPCVMCSGAIGLARIPKC
                     GLWG"
     gene            23710..23826
                     /locus_tag="SPG_0027"
     CDS             23710..23826
                     /locus_tag="SPG_0027"
                     /note="contains potential frameshift"
                     /codon_start=1
                     /transl_table=11
                     /product="Cytosine/adenosine deaminase"
                     /protein_id="ACF55099.1"
                     /translation="MPAFPNVVYGAKNQKFGAAGSLYNILTDERLNHLWRLK"
     gene            24077..24520
                     /gene="dut"
                     /locus_tag="SPG_0028"
     CDS             24077..24520
                     /gene="dut"
                     /locus_tag="SPG_0028"
                     /EC_number="3.6.1.23"
                     /note="Dagkessamanskaia A, Mol Microbiol. 2004
                     Feb;51(4):1071-86.; identified by match to protein family
                     HMM PF00692"
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyuridine 5'-triphosphate
                     nucleotidohydrolase"
                     /protein_id="ACF55619.1"
                     /translation="MKIRGFELVSSFTDENLLPKRETAHAAGYDLKVAVRTVVAPGEI
                     VLVPTGVKAYMQPTEVLYLYDRSSNPRKKGLVLINSVGVIDGDYYGNPGNEGHIFVQM
                     KNITDQEVVLEVGERIVQAVFATFLIADGDAADGVRTGGFGSTGH"
     gene            24480..25037
                     /locus_tag="SPG_0029"
     CDS             24480..25037
                     /locus_tag="SPG_0029"
                     /note="identified by match to protein family HMM PF00300"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglycerate mutase family protein"
                     /protein_id="ACF56348.1"
                     /translation="MAFELVDLDRQGTRMKIIFVRHGEPDYRELEERSYIGFGIDLAP
                     LSEMGRQQVQKLSKNPLLSSAEIIVSSAVTRALETASYVVCATGLPLRVEPLLHEWQV
                     YKTGIENFETARRLFLENKGELLPNSPIQYETATEMKSRFLECMSKYREHQTVVVVAH
                     RMLMRQFVPNEKIDFCQVIECELEI"
     gene            25150..26412
                     /gene="radA"
                     /locus_tag="SPG_0030"
     CDS             25150..26412
                     /gene="radA"
                     /locus_tag="SPG_0030"
                     /note="identified by match to protein family HMM
                     TIGR00416"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein RadA"
                     /protein_id="ACF55916.1"
                     /translation="MEEVEVAEVKNARVSLTGEKTKPMKLAEVTSINVNRTKTEMEEF
                     NRVLGGGVVPGSLVLIGGDPGIGKSTLLLQVSTQLSQVGTVLYVSGEESAQQIKLRAE
                     RLGDIDSEFYLYAETNMQSVRAEVERIQPDFLIIDSIQTIMSPEISGVQGSVSQVREV
                     TAELMQLAKTNNIAIFIVGHVTKEGTLAGPRMLEHMVDTVLYFEGERHHTFRILRAVK
                     NRFGSTNEIGIFEMQSGGLVEVLNPSQVFLEERLDGATGSSIVVTMEGTRPILAEVQA
                     LVTPTMFGNAKRTTTGLDFNRASLIMAVLEKRAGLLLQNQDAYLKSAGGVKLDEPAID
                     LAVAVAIASSYKDKPTNPQECFVGELGLTGEIRRVNRIEQRINEAAKLGFTKIYVPKN
                     SLTGITLPKEIQVIGVTTIQEVLKKVFA"
     gene            26485..26982
                     /locus_tag="SPG_0031"
     CDS             26485..26982
                     /locus_tag="SPG_0031"
                     /note="identified by match to protein family HMM PF00484"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF56376.1"
                     /translation="MSYFEQFMQANQAYVALHGQLNLPLKPKTRVAIVTCMDSRLHVA
                     QALGLALGDAHILRNAGGRVTEDMIRSLVISQQQMGTREIVVLHHTDCGAQTFENEPF
                     QEYLKEELGVDVSDQDFLPFQDIEESVREDMQLLIESPLIPDDVIISGAIYNVDTGSM
                     TVVEL"
     gene            27007..27537
                     /locus_tag="SPG_0032"
     CDS             27007..27537
                     /locus_tag="SPG_0032"
                     /note="contains potential frameshift"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF55024.1"
                     /translation="MKKSSILLLCIGLQYETIYYTDGSRSXAEYGLMGVSIFLALFYM
                     IPALYFLFHIGKKWELPKKVLILSLLGGMFLSGWLSSFANTYIHDLLGVLFPDSPFLN
                     AFESAIVAPLVEEPLKLLPLVFVLALIPVRKLKFLFLLGIASHWTXSGLAVVGVYLLY
                     RAYKGQKVGKKQGLIV"
     gene            27530..27661
                     /locus_tag="SPG_0033"
     CDS             27530..27661
                     /locus_tag="SPG_0033"
                     /note="contains potential frameshift"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF55482.1"
                     /translation="MFNSPFVELETELPLAIPVVTAIALYGYYHAYCFVEKHNELMT"
     gene            27806..28774
                     /gene="prs1"
                     /locus_tag="SPG_0034"
     CDS             27806..28774
                     /gene="prs1"
                     /locus_tag="SPG_0034"
                     /EC_number="2.7.6.1"
                     /note="identified by match to protein family HMM PF00156;
                     match to protein family HMM TIGR01251"
                     /codon_start=1
                     /transl_table=11
                     /product="ribose-phosphate pyrophosphokinase 1"
                     /protein_id="ACF56211.1"
                     /translation="MSFSDLKLFALSSNKELAERVAQEIGIELGKSSVRQFSDGEIQV
                     NIEESIRGKHVFILQSTSSPVNDNLLEILIMVDALKRASAESVNVVMPYYGYARQDRK
                     ARAREPITSKLVANMLEVAGVDRLLTIDLHAAQIQGFFDIPVDHLMGAPLIADYFERR
                     GMVGSDYVVVSPDHGGVTRARKLAEFLKTSIAIIDKRRSVDKMNTSEVMNIIGKVEGK
                     TCILIDDMIDTAGTICHAADALAEAGAVEVYASCTHPVLSGPATDNIQKSAIKKLVVL
                     DTIYLPEERLIDKIEQISIAHLLGDAIVRIHEKRPLSPLFDIEKKI"
     gene            complement(29315..29548)
                     /locus_tag="SPG_0035"
     CDS             complement(29315..29548)
                     /locus_tag="SPG_0035"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF55597.1"
                     /translation="MFSQLHMREEQVLLAQDYALETARAEGLEQGLERGKVEGRAERK
                     LFAFLDIVRQGLLTSEVASQQLGMSVSEFEALL"
     gene            complement(29541..29657)
                     /locus_tag="SPG_0036"
     CDS             complement(29541..29657)
                     /locus_tag="SPG_0036"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF56323.1"
                     /translation="MVGVFRQQALYPATATSHYPSKSTAGLQELVRGGQENV"
     gene            complement(29872..30186)
                     /locus_tag="SPG_0037"
     CDS             complement(29872..30186)
                     /locus_tag="SPG_0037"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF56761.1"
                     /translation="MIAKKIFSNPEITCQFIRDMLDLPAKNVTILEGSDIHVLLSMPY
                     SVQDFYTSIDVLAELDNGTQVIIEIQVHHQNFFINHLWAYLCSQVNQNLEKIRQREGD
                     TH"
     gene            30478..33111
                     /gene="polA"
                     /locus_tag="SPG_0038"
     CDS             30478..33111
                     /gene="polA"
                     /locus_tag="SPG_0038"
                     /EC_number="2.7.7.7"
                     /note="identified by match to protein family HMM PF00476;
                     match to protein family HMM PF01367; match to protein
                     family HMM PF02739; match to protein family HMM TIGR00593"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase I"
                     /protein_id="ACF55506.1"
                     /translation="MDKKKLLLIDGSSVAFRAFFALYQQLDRFKNAAGLHTNAIYGFQ
                     LMLSHLLERVEPSHILVAFDAGKTTFRTEMYADYKGGRAKTPDEFREQFPFIRELLDH
                     MGIRHYELAQYEADDIIGTLDKLAEQDGFDITIVSGDKDLIQLTDEHTVVEISKKGVA
                     EFEAFTPDYLMEEMGLTPAQFIDLKALMGDKSDNIPGVTKVGEKTGIKLLLEYGSLEG
                     IYENIDGMKTSKMKENLINDKEQAFLSKTLATIDTKAPIAIGLEDLVYSGPDVENLGK
                     FYDEMGFKQLKQALNVSSADVSESLDFTIVDQISQDMLSEESIFHFELFGENYHTDNL
                     VGFAWSCGDKLYATDKLELLQDPIFKDFLEKTSLRVYDFKKVKVLLQRFGVDLQAPAF
                     DIRLAKYLLSTVEDNEIATIASLYGQTYLVDDETFYGKGVKKAIPEREKFLEHLACKL
                     AVLVETEPILLEKLSENGQLELLYDMEQPLAFVLAKMEIAGIMVKKETLLEMQAENEL
                     VIEKLTQEIYELAGEEFNVNSPKQLGVLLFEKLGLPLEYTKKTKTGYSTAVDVLERLA
                     PIAPIVKKILDYRQIAKIQSTYVIGLQDWILADGKIHTRYVQDLTQTGRLSSVDPNLQ
                     NIPARLEQGRLIRKAFVPEWEDSVLLSSDYSQIELRVLAHISKDEHLIKAFQEGADIH
                     TSTAMRVFGIERPDDVTANDRRNAKAVNFGVVYGISDFGLSNNLGISRKEAKAYIDTY
                     FERFPGIKNYMDEVVREARDKGYVETLFKRRRELPDINSRNFNIRGFAERTAINSPIQ
                     GSAADILKIAMIQLDKALVAGGYQTKMLLQVHDEIVLEVPKSELVEMKKLVKQTMEEA
                     IQLSVPLIADENEGATWYEAK"
     gene            33196..33633
                     /locus_tag="SPG_0039"
     CDS             33196..33633
                     /locus_tag="SPG_0039"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF55838.1"
                     /translation="MSQEFINPSDGVIRQYLATSKTLAVVGLSDREETTSNRVTKEMQ
                     ARGYKIIPVNPKAAGGEILGEKAYASLAEIPFPVDIVNVXRRSEFLPDVARDFLKADA
                     KIFWAQLGLESLEAKEILRDGGCDDIVMNRCIKREHTRLIEEA"
     gene            complement(33816..34826)
                     /locus_tag="SPG_0040"
     CDS             complement(33816..34826)
                     /locus_tag="SPG_0040"
                     /note="identified by match to protein family HMM PF03601"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF56488.1"
                     /translation="MSFLSKNGAGILACLLISIVSWYLGGFXPVIGAPVFAIFIGMLL
                     HPFLSSYKQLDAGLTFSSKKLLQYAVVLLGFGLNISQVFAVGQSSLPVILSTISIALI
                     IAYLFQRFFALDTKLATLVGVXSSICGGSAIAATAPVIDAKEKEVAQAISVIFFFNVL
                     AALIFPTLGTWLHLSNEGFALFAGTAVNDTSSVTAAASAWDSLYQSNTLXSATIVKLT
                     RTLAIIPITLFLSYWQSRQQENKQSLQLKKVFPLFILYFILASLLTTLLTSLGVSSSF
                     FTPLKELSKFLIVMAMSAIGLKTNLVAMVKSSGKSILLGAICWIAIILTTLGMQTLIG
                     IF"
     gene            34975..36144
                     /locus_tag="SPG_0041"
     CDS             34975..36144
                     /locus_tag="SPG_0041"
                     /note="identified by match to protein family HMM PF00155"
                     /codon_start=1
                     /transl_table=11
                     /product="aromatic amino acid aminotransferase"
                     /protein_id="ACF55212.1"
                     /translation="MDLTKRFNKQLDKIQVSLIRQFDQAISEIPGVLRLTLGEPDFTT
                     PDHVKEAAKRAIDQNQSYYTGMSGLLTLRQAASDFVKEKYQLDYAPENEILVTIGATE
                     ALSATLTAILEEGDKVLLPAPAYPGYEPIVNLVGAEIVEIDTTENGFVLTPEMLEKAI
                     LEQGDKLKAVILNYPANPTGITYSREQLEALAAVLRKYEIFVVCDEVYSELTYTGEAH
                     VSLGTMLRDQAIIINGLSKSHAMTGWRLGLIFAPAAFTSQLIKSHQYLVTAANTMAQH
                     AAVEALTAGKNDAEPMKKEYIQRRDYIIEKMTALGFEIIKPDGAFYIFAKIPAGYNQD
                     SFAFLKDFAQKKAVAFIPGAAFGRYGEGYVRLSYAASMETIKEAMKRLEEYMREA"
     gene            36141..36911
                     /gene="recO"
                     /locus_tag="SPG_0042"
     CDS             36141..36911
                     /gene="recO"
                     /locus_tag="SPG_0042"
                     /note="identified by match to protein family HMM PF02565;
                     match to protein family HMM TIGR00613"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein RecO"
                     /protein_id="ACF55812.1"
                     /translation="MIQSITSQGLVLYNRNFREDDKLVKIFTEQVGKCMFFVKHAGQS
                     KLAPVIQPLVLARFLLRINDDGLSYIEDYHEVMTFPKINSDLFVMAYATYVAALADAS
                     LQDNQQDAPLFAFLQKTLELMEAGLDYQVLTNIFEIQILTRFGISLNFNECVFCHRVG
                     QAFDFSFKYGACLCPEHYHEDERRCHLNPNIPYLLNQFQAIDFETLETISLKPGIKQE
                     LRQFMDQLYEEYVGIHLKSKKFIDSLADWGQLLKEEKK"
     gene            36908..37900
                     /locus_tag="SPG_0043"
     CDS             36908..37900
                     /locus_tag="SPG_0043"
                     /note="identified by match to protein family HMM PF02504;
                     match to protein family HMM TIGR00182"
                     /codon_start=1
                     /transl_table=11
                     /product="fatty acid/phospholipid synthesis protein PlsX"
                     /protein_id="ACF56169.1"
                     /translation="MKKIAVDAMGGDYAPQAIVEGVNQALSDFSDIEVQLYGDEAKIK
                     QYLTATERVSIIHTDEKIDSDDEPTRAIRNKKNASMVLAAKAVKDGEADAVLSAGNTG
                     ALLAAGFFIVGRIKNIDRPGLMSTLPTVDGKGFDMLDLGANAENTAQHLHQYAVLGSF
                     YAKNVRGIAQPRVGLLNNGTESSKGDPLRKETYELLAADESLNFIGNVEARDLMNGVA
                     DVVVADGFTGNAVLKSIEGTAMGIMGLLKTAITGGGLRAKLGALLLKDSLRGLKKQLN
                     YSDVGGAVLFGVKAPVVKTHGSSDAKAVYSTIRQIRTMLETDVVAQTAREFSGE"
     gene            37906..38139
                     /locus_tag="SPG_0044"
     CDS             37906..38139
                     /locus_tag="SPG_0044"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl carrier protein"
                     /protein_id="ACF54916.1"
                     /translation="MTEKEIFDRIVTIIQERQGEDFVVTESLSLKDDLDADSVDLMEF
                     ILTLEDEFSIEISDEEIDQLQNVGDVVKIIQGK"
     gene            38182..38475
                     /locus_tag="SPG_0045"
     CDS             38182..38475
                     /locus_tag="SPG_0045"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="ACF55167.1"
                     /translation="MRNIGQAGKILADSGYQGLMKIYPQAQTPRKSSKLKPLTVEDKA
                     CNHALSKERSKVENIFAKVKTFKMFSTTYRNHRKRFGLRMNLXAGIINHELGF"
     gene            38678..38908
                     /locus_tag="SPG_0046"
     CDS             38678..38908
                     /locus_tag="SPG_0046"
                     /note="identified by match to protein family HMM
                     TIGR01847"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved domain protein"
                     /protein_id="ACF56710.1"
                     /translation="MNTKKMSQFEIMDTEMLACVEGGGCNWGDFAKAGVGGGAVRGLQ
                     LGIKTRTWQGAATGAVGGAILGGVAYAATCWW"
     gene            38911..39036
                     /locus_tag="SPG_0047"
     CDS             38911..39036
                     /locus_tag="SPG_0047"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF56105.1"
                     /translation="MDFKSFIIGLVVGIFGPYMDDLIRKKFLKSSEKKTEKSVKK"
     gene            39623..41776
                     /gene="comA"
                     /locus_tag="SPG_0048"
     CDS             39623..41776
                     /gene="comA"
                     /locus_tag="SPG_0048"
                     /EC_number="3.4.22.-"
                     /note="identified by match to protein family HMM PF00005;
                     match to protein family HMM PF00664; match to protein
                     family HMM PF03412; match to protein family HMM TIGR01193"
                     /codon_start=1
                     /transl_table=11
                     /product="transport/processing ATP-binding protein ComA"
                     /protein_id="ACF55423.1"
                     /translation="MKFGKRHYRPQVDQMDCGVASLAMVFGYYGSYYFLAHLRELAKT
                     TMDGTTALGLVKVAEEIGFETRAIKADMTLFDLPDLTFPFVAHVLKEGKLLHYYVVTG
                     QDKDSIHIADPDPGVKLTKLPRDRFAEEWTGVTLFMAPSPDYKPHKEQKNGLFSFIPI
                     LVKQRGLIANIVLATLLVTVINIVGSYYLQSIIDTYVPDQMRSTLGIISIGLVIVYIL
                     QQILSYAQEYLLLVLGQRLSIDVILSYIKHVFHLPMSFFATRRTGEIVSRFTDANSII
                     DALASTILSIFLDVSTVVIISLVLFSQNTNLFFMTLLALPIYTVIIFAFMKPFEKMNR
                     DTMEANAVLSSSIIEDINGIETIKSLTSESQRYQKIDKEFVDYLKKSFTYSRAESQQK
                     ALKKVAHLLLNVGILWMGAVLVMDGKMSLGQLITYNTLLVYFTNPLENIINLQTKLQT
                     AQVANNRLNEVYLVASEFEEKKTVEDLSLMKGDMTFKQVHYKYGYGRDVLSDINLTVP
                     QGSKVAFVGISGSGKTTLAKMMVNFYDPSQGEISLGSVNLNQIDKKALRQYINYLPQQ
                     PYVFNGTILENLLLGAKEGTTQEDILRAVELAEIREDIERMPLNYQTELTSDGAGISG
                     GQRQRIALARALLTDAPVLILDEATSSLDILTEKRIVDNLMALDKTLIFIAHRLTIAE
                     RTEKVVVLDQGKIVEEGKHADLLAQGGFYAHLVNS"
     gene            41789..43138
                     /gene="comB"
                     /locus_tag="SPG_0049"
     CDS             41789..43138
                     /gene="comB"
                     /locus_tag="SPG_0049"
                     /note="identified by match to protein family HMM
                     TIGR01000"
                     /codon_start=1
                     /transl_table=11
                     /product="competence factor transport protein ComB"
                     /protein_id="ACF56713.1"
                     /translation="MKPEFLESAEFYNRRYHNFSSSVIVPMALLLVFLLGFATVAEKE
                     MSLSTRATVEPSRILANIQSTSNNRILVNHLEENKLVKKGDLLVQYQEGAEGVQAESY
                     ASQLDMLKDQKKQLEYLQKSLQEGENHFPEEDKFGYQATFRDYISQAGSLRASTSQQN
                     ETIASQNAAASQTQAEIGNLINQTEAKIRDYQTAKSAMETGASLASQNLAYSLYQSYK
                     SQGEENPQTKVQAVAQVEAQISQLESSLATYRVQYAGSGTQQAYASGLSSQLESLKSQ
                     HLAKVGQELTLLAQKILEAESGKKVQGNLLDKGKITASEDGVLHLNPETSDSSMVAEG
                     ALLAQLYPSLEREGKAKLTAYLSSKDVARIKVGDSVRYTTTHDAGNQLFLDSTITSID
                     ATATKTEKGNFFKIEAETNLTSEQAEKLRYGVEGRLQMITGKKSYLRYYLDQFLNKE"
     gene            43308..44015
                     /gene="purC"
                     /locus_tag="SPG_0050"
     CDS             43308..44015
                     /gene="purC"
                     /locus_tag="SPG_0050"
                     /EC_number="6.3.2.6"
                     /note="identified by match to protein family HMM PF01259;
                     match to protein family HMM TIGR00081"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylaminoimidazole-succinocarboxamide
                     synthase"
                     /protein_id="ACF56499.1"
                     /translation="MSKQLIYSGKAKDIYTTEDENLIISTYKDQATAFNGVKKEQIAG
                     KGVLNNQISSFIFEKLNAAGVATHFVEKLSDTEQLNKKVKIIPLEVVLRNYTAGSFSK
                     RFGVDEGIALETPIVEFYYKNDDLDDPFINDEHVKFLQIAGDQQIAYLKEETRRINEL
                     LKVWFAEIGLKLIDFKLEFGFDKDGKIILADEFSPDNCRLWDADGNHMDKDVFRRGLG
                     ELTDVYEIVWEKLQGLK"
     gene            44072..47797
                     /gene="purL"
                     /locus_tag="SPG_0051"
     CDS             44072..47797
                     /gene="purL"
                     /locus_tag="SPG_0051"
                     /note="identified by match to protein family HMM PF02769;
                     match to protein family HMM TIGR01857"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylformylglycinamide synthetase"
                     /protein_id="ACF56046.1"
                     /translation="MDKRIFVEKKADFQVKSESLVRELQHNVGLSSLKSIRIVQVYDV
                     FDLAEDLFAPAEKHIFSEQGTDHVLDEVSVQADLANYAFFAIESLPGQFDQRAASSQE
                     ALLLLGSSSDVTVNTAQLYLVNKDIDATELEAVKNYLLNPVDSRFKDITTGIAKQEFS
                     ESDKTIPKLTFFESYTAEDFARYKAEQGMAMEVDDLLFIQDYFKSIGRVPTETELKVL
                     DTYWSDHCRHTTFETELKHIDFSASKFQKQLQSTYDKYIAMREELGRSEKPQTLMDMA
                     TIFGRYERANGRLDDMEVSDEINACSVEIEVDVDGVKEPWLLMFKNETHNHPTEIEPF
                     GGAATCIGGAIRDPLSGRSYVYQAMRISGAGDITAPISETRAGKLPQQVISKTAAHGY
                     SSYGNQIGLATTYVREYFHPGFVAKRMELGAVVGAAPKGNVVREKPEAGDVIILLGGK
                     TGRDGVGGATGSSKVQTVESVETAGAEVQKGNAIEERKIQRLFRNGNVTRLIKKSNDF
                     GAGGVCVAIGELADGLEIDLNKVPLKYQGLNGTEIAISESQERMAVVVRPEDVDAFVA
                     ECNKENIDAVVVAIVTEKPNLVMHWNGETIVDLERRFLDTNGVRVVVDAKVVDKDVKL
                     PEERQTSAETLESDTLTVLSDLNHASQKGLQTIFDCSVGRSTVNHPLGGRYQLTPTEA
                     SVQKLPVQHGVTHTASVIAQGFNPYVAEWSPYHGAAYAVIEATARLVAAGANWSKARF
                     SYQEYFERMDKQAERFGQPVAALLGSIEAQIQLGLPSIGGKDSMSGTFEELTVPPTLV
                     AFGVTTADSRKVLSPEFKAVGENIYYIPGQALSAEIDFDLIKKNFAQFEAIQADHKVT
                     SASAVKYGGVVESLALATFGNYIGAEVTLPELETALTAQLGGFVFTSPEEIAGVEKVG
                     QTKADFTLTVNGVKLDGHKLDSAFQGTLEEVYPTEFTQAKELEEVPAVASDVVIKAKE
                     KVEKPVVYIPVFPGTNSEYDSAKAFEKEGAEVNLVPFVTLNEEAIVKSVETMVDNIDK
                     TNILFFAGGFSAADEPDGSAKFIVNILLNEKVRVAIDSFIARGGLIIGICNGFQALVK
                     SGLLPYGNFEVANSTSPTLFYNDANQHVAKMVETRIANTNSPWLAGVQVGDIHAIPVS
                     HGEGKFVVTAEEFAELRDNGQIFSQYVDFNGKPSMDSKYNPNGSVHAIEGITSKNGQI
                     IGKMGHSERYEDGLFQNIPGNKDQHLFASAVKHFTGK"
     gene            47890..49332
                     /gene="purF"
                     /locus_tag="SPG_0052"
     CDS             47890..49332
                     /gene="purF"
                     /locus_tag="SPG_0052"
                     /note="identified by match to protein family HMM PF00156;
                     match to protein family HMM PF00310; match to protein
                     family HMM TIGR01134"
                     /codon_start=1
                     /transl_table=11
                     /product="amidophosphoribosyltransferase"
                     /protein_id="ACF55238.1"
                     /translation="MTYEVKSLNEECGVFGIWGHPDAAKLTYFGLHSLQHRGQEGAGI
                     LSNDQGKLKRHRDMGLLSEVFRNPANLDKLTGTGAIGHVRYATAGEASVDNIQPFLFR
                     FHDMQFGLAHNGNLTNAASLKKELEDRGAIFSATSDSEILAHLIRRSHNPSLMGKIKE
                     ALSLVKGGFAYILLFEDKLIAALDPNGFRPLSIGKMANGAVVVSSETCAFEVIGAEWI
                     RDLKPGEIVIIDDEGIQYDSYTDDTQLAICSMEYIYFARPDSNIHGVNVHTARKRMGA
                     QLAREFKHEADIVVGVPNSSLSAAMGFAEESGLPNEMGLIKNQYTQRTFIQPTQELRE
                     QGVRMKLSAVSGVVKGKRVVMVDDSIVRGTTSRRIVQLLKEAGATEVHVAIGSPALAY
                     PCFYGIDIQTRQELIAANHTVEETRQIIGADSMTYLSIDGLIESIGIETDAPNGGLCV
                     AYFDGDYPTPLYDYEEDYRRSLEEKTSFYK"
     gene            49369..50391
                     /gene="purM"
                     /locus_tag="SPG_0053"
     CDS             49369..50391
                     /gene="purM"
                     /locus_tag="SPG_0053"
                     /EC_number="6.3.3.1"
                     /note="identified by match to protein family HMM PF00586;
                     match to protein family HMM PF02769; match to protein
                     family HMM TIGR00878"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylformylglycinamidine cyclo-ligase"
                     /protein_id="ACF56494.1"
                     /translation="MTNKNAYAQSGVDVEAGYEVVERIKKHVARTERAGVMGALGGFG
                     GMFDLSKTGVKEPVLISGTDGVGTKLMLAIKYDKHDTIGQDCVAMCVNDIIAAGAEPL
                     YFLDYVATXKNEPAKLEQVVAGVAEGCVQAGAALIGGETAEMPGMYGEDDYDLAGFAV
                     GVAEKSQIIDGSKVVEGDVLLGLVSSGIHSNGYSLVRRVFADYTGEEVLPELEGKKLK
                     EVLLEPTRIYVKAVLPLIKEELVNGIAHITGGGFIENVPRMFADDLAAEIDESKVPVL
                     PIFKALEKYGQIKHEEMFEIFNMGVGLMLAVSPENVERVKELLDEAVYEIGRIVKKEN
                     ESVIIK"
     gene            50388..50933
                     /gene="purN"
                     /locus_tag="SPG_0054"
     CDS             50388..50933
                     /gene="purN"
                     /locus_tag="SPG_0054"
                     /EC_number="2.1.2.2"
                     /note="identified by match to protein family HMM PF00551;
                     match to protein family HMM TIGR00639"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylglycinamide formyltransferase"
                     /protein_id="ACF56185.1"
                     /translation="MKKIAVFASGNGSNFQVIAEEFPVEFVFSDHRDAYVLERAKQLG
                     VLSYAFELKEFESKADYEAALVELLEEHQIDLVCLAGYMKIVGPTLLSAYEGRIVNIH
                     PAYLPEFPGAHGIEDAWNAGVGQSGVTIHWVDXGVDTGQVIKQVRVPRLADDTIDRFE
                     ARIHEAEYRLYPEVVKALFTD"
     gene            51017..51526
                     /locus_tag="SPG_0055"
     CDS             51017..51526
                     /locus_tag="SPG_0055"
                     /note="identified by match to protein family HMM PF04892"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved domain protein"
                     /protein_id="ACF54994.1"
                     /translation="MLESKKTTRYVFYVYLMLLTWGILFKFETNPEFIAFFLAPRYIN
                     WIPFXEPLIVDGKIVFAEMLFNLISFIPLGVCFPLIKTNLSSLRIVGTGFLISLLFEC
                     LQYILAIGITDITDLTLNTLGVCVGLLIYQIFIRVFKSQTRKWINILGMLSLGFAYLV
                     LLLLHLIGV"
     gene            51551..53098
                     /gene="purH"
                     /locus_tag="SPG_0056"
     CDS             51551..53098
                     /gene="purH"
                     /locus_tag="SPG_0056"
                     /EC_number="2.1.2.3"
                     /EC_number="3.5.4.10"
                     /note="identified by match to protein family HMM PF01808;
                     match to protein family HMM PF02142; match to protein
                     family HMM TIGR00355"
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional purine biosynthesis protein"
                     /protein_id="ACF55031.1"
                     /translation="MTKRVLISVSDKAGIVEFAQELKKLGWEIISTGGTKVALDNAGV
                     DTIAIDDMTGFPEMMDGRVKTLHPNIHGGLLARRDLDSHLEAAKDNKIELIDLVVVNL
                     YPFKETILKPDVTYADAVENIDIGGPSMLRSAAKNHASVTVVVDPADYAVVLDELSAN
                     GETTYETRQRLAAKVFRHTAAYDALIAEYFTAQVGESKPEKLTLTYDLKQAMRYGENP
                     QQDADFYQKALPTDYSIASAKQLNGKELSFNNIRDADAAIRIIRDFKDRPTVVALKHM
                     NPCGIGQADNIETAWDYAYESDPVSIFGGIVVLNREVDAATAEKMHGVFLEIIIAPSY
                     TDEALAILINKKKNLRILALPFNAQEASEVEAEYTGVVGGLLVQNQDVVKESPADWQV
                     VTKRQPTETEATALEFAWKAIKYVKSNGIIVTNDHMTLGVGPGQTNRVASVRLAIDQA
                     KDRLNGAVLASDAFFPFADNVEEIAKAGIKAIIQPGGSVRDQESIEAADKYGLTMVFT
                     GVRHFRH"
     gene            53220..54482
                     /gene="purD"
                     /locus_tag="SPG_0057"
     CDS             53220..54482
                     /gene="purD"
                     /locus_tag="SPG_0057"
                     /EC_number="6.3.4.13"
                     /note="identified by match to protein family HMM PF01071;
                     match to protein family HMM PF02655; match to protein
                     family HMM PF02843; match to protein family HMM PF02844;
                     match to protein family HMM PF08442; match to protein
                     family HMM TIGR00877"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylamine--glycine ligase"
                     /protein_id="ACF56705.1"
                     /translation="MKLLVVGSGGREHAIAKKLLESKDVEKVFVAPGNDGMTLDGLEL
                     VNISISEHSKLIDFAKTNDVAWTFIGPDDALAAGIVDDFNQAGLKAFGPTRAAAELEW
                     SKDFAKEIMVKYGVSTAAYGTFSDFEEAKAYIEKHGAPIVVKADGLALGKGVVVSETV
                     EQAVEAAHEMLLDNKFGDSGARVVIEEFLEGEEFSLFAFVNGDKFYIMPTAQDHKRAY
                     DGDKGPNTGGMGAYAPVPHLPQSVVDTAVDTIVKPVLEGMIKEGRPYLGVLYAGLILT
                     ADGPKVIEFNARFGDPETQIILPRLTSDFAQNITDILDSKEPNIMWTDKGVTLGVVVA
                     SKGYPLDYERGVELPAKTEGDVITYYAGAKFAENSRALLSNGGRVYMLVTTADTVKEA
                     QASIYQELYQQKIEGLFYRTDIGSKAIK"
     gene            54885..55373
                     /gene="purE"
                     /locus_tag="SPG_0058"
     CDS             54885..55373
                     /gene="purE"
                     /locus_tag="SPG_0058"
                     /EC_number="4.1.1.21"
                     /note="identified by match to protein family HMM PF00731;
                     match to protein family HMM TIGR01162"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylaminoimidazole carboxylase
                     catalytic subunit"
                     /protein_id="ACF56255.1"
                     /translation="MKPVISIIMGSKSDWATMQKTAEVLDRFGVAYEKKVVSAHRTPD
                     LMFKHAEEARSRGIKIIIAGAGGAAHLPGMVAAKTTLPVIGVPVKSRALSGVDSLYSI
                     VQMPGGVPVATMAIGEAGATNAALFALRLLSVEDKSIADALANFAEEQGKIAEESSNE
                     LI"
     gene            55360..56451
                     /gene="purK"
                     /locus_tag="SPG_0059"
     CDS             55360..56451
                     /gene="purK"
                     /locus_tag="SPG_0059"
                     /note="identified by match to protein family HMM PF02222;
                     match to protein family HMM TIGR01161"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylaminoimidazole carboxylase, ATPase
                     subunit"
                     /protein_id="ACF55777.1"
                     /translation="MSSSKTIGIIGGGQLGQMMAISAIYMGHKVIALDPAADCPASRV
                     AEIIVAPYNDVDALRQLADRCDVLTYEFENVDADGLDAVIKDGQLPQGTDLLRISQNR
                     IFEKDFLSNKAQVTVAPYKVVTSSLDLADIDLSKNYVLKTATGGYDGHGQKVIRSEAD
                     LEAAYALADSADCVLEEFVNFDLEISVIVSGNGKEVTFFPVQENIHRNNILSKTIVPA
                     RISESLVDKAKAMAVRIAEQLNLSGTLCVEMFATDDDVIVNEIAPRPHNSGHYSIEAC
                     DFSQFDTHILGVLGAPLPVIKLHAPAVMLNVLGQHVEAAEQYVTENSSAHLHMYGKIE
                     AKHNRKMGHVTLFSDVPDSVDELGEGIDF"
     gene            56461..56688
                     /locus_tag="SPG_0060"
     CDS             56461..56688
                     /locus_tag="SPG_0060"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF55020.1"
                     /translation="MIQIIVNTFIEKDKTGAVVEVLYASADQDKVQAKYEELAAQYPE
                     NYLAIYDVPLDTDLNTLDHYPSVFIEKEEFE"
     gene            56751..58049
                     /gene="purB"
                     /locus_tag="SPG_0061"
     CDS             56751..58049
                     /gene="purB"
                     /locus_tag="SPG_0061"
                     /EC_number="4.3.2.2"
                     /note="identified by match to protein family HMM PF00206;
                     match to protein family HMM TIGR00928"
                     /codon_start=1
                     /transl_table=11
                     /product="adenylosuccinate lyase"
                     /protein_id="ACF56439.1"
                     /translation="MINRYSRPEMANIWSEENKYRAWLEVEILSDEAWAELGEIPKED
                     VALIRKKADFDIDRILEIEQETRHDVVAFTRAVSETLGEERKWVHYGLTSTDVVDTAY
                     GYLYKQANDIIRRDLENFTNIIADKAKEHKFTIMMGRTHGVHAEPTTFGLKLATWYSE
                     MKRNIERFEHAAAGVEAGKISGAVGNFANIPPFVEEYVCDKLGIRAQEISTQVLPRDL
                     HAEYFAVLASIATSIERMATEIRGLQKSEQREVEEFFAKGQKGSSAMPHKRNPIGSEN
                     MTGLARVIRGHMITAYENVALWHERDISHSSAERIITPDTTILIDYMLNRFGNIVKNL
                     TVFPENMIRNMNSTFGLIFSQRAMLTLIEKGMTREQAYDLVQPKTAYSWDNQVDFKPL
                     LEADSEVTSRLTQEEIDEIFNPVYYTKRVDDIFERLGLGD"
     gene            complement(58104..62042)
                     /locus_tag="SPG_0062"
     CDS             complement(58104..62042)
                     /locus_tag="SPG_0062"
                     /EC_number="3.2.1.52"
                     /note="identified by match to protein family HMM PF00728;
                     match to protein family HMM PF00746; match to protein
                     family HMM PF04650; match to protein family HMM PF07501;
                     match to protein family HMM TIGR01167; match to protein
                     family HMM TIGR01168"
                     /codon_start=1
                     /transl_table=11
                     /product="beta-N-acetylhexosaminidase"
                     /protein_id="ACF56737.1"
                     /translation="MKHEKQQRFSIRKYAVGAASVLIGFAFQAQTVAADGVTPTTTEN
                     QPTIHTVSDSPQSSENRTEETPKAVLQPEAPKTVETETPATDKVASLPKTEEKPQEEV
                     SSTPSDKAEVVTPTSAEKETANKKAEEASPKKEEAKEVDSKESNTDKTDKDKPAKKDE
                     AKAEADKPETEAGKERAATVNEKLAKKKIVSIDAGRKYFSPEQLKEIIDKAKHYGYTD
                     LHLLVGNDGLRFMLDDMSITANGKTYASDDVKRAIEKGTNDYYNDPNGNHLTESQMTD
                     LINYAKDKGIGLIPTVNSPGHMDAILNAMKELGIQNPNFSYFGKKSARTVDLDNEQAV
                     AFTKALIDKYAAYFAKKTEIFNIGLDEYANDATDAKGWSVLQADKYYPNEGYPVKGYE
                     KFIAYANDLARIVKSHGLKPMAFNDGIYYNSDTSFGSFDKDIIVSMWTGGWGGYDVAS
                     SKLLAEKGHQILNTNDAWYYVLGRNADGQGWYNLDQGLNGIKNTPITSVPKTEGADIP
                     IIGGMVAAWADTPSARYSPSRLFKLMRHFANANAEYFAADYESAEQALNEVPKDLNRY
                     TAESVTAVKEAEKAIRSLDSNLSRAQQDTIDQAIAKLQETVNNLTLTPEALKEEEAKR
                     EVEKLAKNKVISIDAGRKYFTLNQLKRIVDKASELGYSDVHLLLGNDGLRFLLDDMTI
                     TANGKTYASDDVKKAIIEGTKAYYDDPNGTALTQAEVTELIEYAKSKDIGLIPAINSP
                     GHMDAMLVAMEKLGIKNPQAHFDKVSKTTMDLKNEEAMNFVKALIGKYMDFFAGKTKI
                     FNFGTDEYANDATSAQGWYYLKWYQLYGKFAEYANTLAAMAKERGLQPMAFNDGFYYE
                     DKDDVQFDKDVLISYWSKGWWGYNLASPQYLASKGYKFLNTNGDWYYILGQKPEDGGG
                     FLKKAIENTGKTPFNQLASTKYPEVDLPTVGSMLSIWADRPSAEYKEEEIFELMTAFA
                     DHNKDYFRANYNALREELAKIPTNLEGYSKESLEALDAAKTALNYNLNRNKQAELDTL
                     VANLKAALQGLKPAATHSGSLDENEVAANVETRPELITRTEEIPFEVIKKENPNLPAG
                     QENIITAGVKGERTHYISVLTENGKTTETVLDSQVTKEVINQVVEVGAPVTHKGDESG
                     LAPTTEVKPRLDIQKEEIPFTTVTRENPLLLKGKTQVITKGVNGHRSNFYSVSTSADG
                     KEVKTLVNSVVAQEAVTQIVEVGTMVTHVGDENGQAAIAEEKPKLEIPSQPAPSTAPA
                     EESKALPQDPAPVVTEKKLPETGTHDSAGLVVAGLMSTLAAYGLTKRKED"
     gene            complement(62357..63100)
                     /locus_tag="SPG_0063"
     CDS             complement(62357..63100)
                     /locus_tag="SPG_0063"
                     /note="identified by match to protein family HMM PF00392;
                     match to protein family HMM PF07702"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, GntR family"
                     /protein_id="ACF55491.1"
                     /translation="MEKENRGKNMAIPKYQYIKDELKNKIISGQFSSGDKFYTEAELI
                     SMYDVSSITVVRALNDLAKDGYIVRQQGKGTFVSRARKHKLVEFSDIELFNAKDDKVT
                     VLSIERGNKLVYLEKLGLRGDQFYYKIERIRESNGVVYIYHTSYIPEQYINANYPNLE
                     YYSSIYNRFKLDYHIHMNDEHFEEINEIVFPTPEHAASVLGVDEQFPTVLQTKITKLE
                     STGQVLEYSETYKRSDYYKIKFISCDRDH"
     gene            63421..65208
                     /locus_tag="SPG_0064"
     CDS             63421..65208
                     /locus_tag="SPG_0064"
                     /note="identified by match to protein family HMM PF01301;
                     match to protein family HMM PF02449"
                     /codon_start=1
                     /transl_table=11
                     /product="Beta-galactosidase"
                     /protein_id="ACF55729.1"
                     /translation="MTRFEIRDDFYLDGKSFKILSGAIHYFRVPPEDWYHSLYNLKAL
                     GFNTVETYVAWNLHEPREGEFHFEGDLDLEKFLQIAQDLGLYAIVRPSPFICAEWEFG
                     GLPAWLLTKNMRIRSSDPAYIEAVGRYYDQLLPRLVPRLLDNGGNILMMQVENEYGSY
                     GEDKAYLRAIRQLMEECGVTCPLFTSDGPWRATLKAGTLIEEDLFVTGNFGXKAPYNF
                     SQMQEFFDEHGKKWPLMCMEFWDGWFNRWKEPIITRDPKELADAVREVLEQGSINLYM
                     FHGGTNFGFMNGCSARGTLDLPQVTSYDYDALLDEEGNPTAKYLAVKKMMATHFSEYP
                     QLEPLYKESMELDAIPLVEKVSLFETLDSLSSPVESLYPQKMEELGQSYGYLLYRTET
                     NWDAEEERLRIIDGRDRAQLYVDGQWVKTQYQTEIGEDIFYQGKKKGLSRLDILIENM
                     GRVNYGHKFLADTQRKGIRTGVCKDLHFLLNWKHYPLPLDNPEKIDFSKGWTQGQPAF
                     YAYDFTVEEPKDTYLDLSEFGKGVAFVNGXNLGRFWNVGPTLSLYIPHSYLKEGANRI
                     IIFETEGQYKEEIHLTRKPTLKHIKGENL"
     gene            65205..65681
                     /locus_tag="SPG_0065"
     CDS             65205..65681
                     /locus_tag="SPG_0065"
                     /note="identified by match to protein family HMM PF03830"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system, IIB component"
                     /protein_id="ACF56189.1"
                     /translation="MTIVGCRIDGRLIHGQVANLWAGKLNVSRIMVVDDEVVNNDIEK
                     SGLKLATPPGVKLSILPVEKAAANILAGKYDSQRLFIVARKPDRFLGLVEAGVPLETL
                     NVGNMSQTPETRSITRSINVVDKDVEDFHKLAEKGVKLTAQMVPNDPISDFLSLLK"
     gene            65709..66614
                     /locus_tag="SPG_0066"
     CDS             65709..66614
                     /locus_tag="SPG_0066"
                     /note="identified by match to protein family HMM PF03609"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system, IIC component"
                     /protein_id="ACF56869.1"
                     /translation="MIQWWQILLLTLYSAYQICDELTIVSSAGSPVFAGFITGLIMGD
                     VTTGLLIGGNLQLFVLGVGTFGGASRIDATSGAVLATAFSVSQGIDAPLAITTIAVPV
                     AALLTYFDVLGRMTTTFFAHRVDAAIERFDYKGIERNYLLGAIPWALSRALPVFFALA
                     FGGAFVQSVVDFVEAYKWVADGLTLAGRMLPGLGFAILLRYLPVKRNLHYLAMGFGLT
                     AMLTVLYSYVTGLGGAVAGIVGTLPAEVAEKIGFVNNFKGLSMIGISIVGIFLAVLHF
                     KNSQKVAVAAPSTPSESGEIEDDEF"
     gene            66601..67416
                     /locus_tag="SPG_0067"
     CDS             66601..67416
                     /locus_tag="SPG_0067"
                     /note="identified by match to protein family HMM PF03613"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system, IID component"
                     /protein_id="ACF55218.1"
                     /translation="MTNSNYKLTKEDFNQINKRSLFTFQLGWNYERMQASGYLYMILP
                     QLRKMYGDGTPELKEMMKVHTQFFNTSPFFHTIIAGFDLAMEEKDGVGSKDAVNGIKT
                     GLMGPFAPLGDTIFGSLVPAIMGSVAATMAIAGQPWGIFLWIAVAVAYDIFRWKQLEF
                     AYKEGVNLINNMQSTLTALIDAASVLGVFMMGALVATVINFEISYKLPIGEKMIDFQD
                     ILNQIFPRLLPAIFTAFIFWLLGKKGMNSTKAIGIIIVLALALSALGHFALGM"
     gene            67423..67827
                     /locus_tag="SPG_0068"
     CDS             67423..67827
                     /locus_tag="SPG_0068"
                     /note="identified by match to protein family HMM PF03610"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system, IIA component"
                     /protein_id="ACF56000.1"
                     /translation="MTKSLILVSHGRFCEELRGSTEMIMGPQDNIYTVALLPEDGPEE
                     FTAKFEAVIEGLDDFLVFADLLGGTPCNVVSRLIMEGRDIDLYAGMNLPMVIEFINAS
                     LTGADADYKSRAAESIVKVNDLLAGFDDDEDE"
     gene            68126..69292
                     /locus_tag="SPG_0069"
     CDS             68126..69292
                     /locus_tag="SPG_0069"
                     /note="identified by match to protein family HMM PF01380"
                     /codon_start=1
                     /transl_table=11
                     /product="putative sugar isomerase, AgaS family"
                     /protein_id="ACF54769.1"
                     /translation="MLHYTKEDLLELGAEITTREIYQQPDVWREAFEFYQAKREEIAA
                     FLQEIADKHDYIKVILTGAGTSAYVGDTLLPYFKEVYDERKWNFNAIATTDIVANPAT
                     YLKKDVATVLVSFARSGNSPESLATVDLAKSLVDELYQVTITCAADGKLALQAHGDDR
                     NLLLLQPAVSNDAGFAMTSSFTSMMLTTLLVFDPTEFAVKSERFEVVSSLARKVLDKA
                     EDVKELVDLDFNRVIXLGAGPFFGLAHEAQLKILELTAGQVATMYESPVGFRHGPKSL
                     INDNTVVLVFGTTTDYTRKYDLDLVREVAGDQIARRVVLLSDQAFGLENVKEVALGCG
                     GVLNDIYRVFPYIVYAQLFALLTSLKVENKPDTPSPTGTVNRVVQGVIIHEYQK"
     gene            69408..70445
                     /locus_tag="SPG_0070"
     CDS             69408..70445
                     /locus_tag="SPG_0070"
                     /note="identified by match to protein family HMM PF01263"
                     /codon_start=1
                     /transl_table=11
                     /product="aldose-1-epimerase"
                     /protein_id="ACF55349.1"
                     /translation="MKAYTERVFGNVEGEDVLAYRFETDGGYQLEVMTYGATILRYVA
                     PDKAGNFANVILGFDDFDSYVGNSPKHGASVGPVAGRIAGATFELNGKTYDLEVNNAS
                     NCNHSGSTGWDSSLFEVEEVSDHGLTLYTERTDGTGGFPGNLKIWISYHLEETGAYEI
                     SYKVTTDQDTLVNPTNHSYFNLSGDFTQTIDRHVFQLNTEGIYSIAPDGVPAKTPEAN
                     RDVVKHVYNGTLLKDIFAEEDEQIQLASGLDHPFALPAGHDNAGFLYDQNSGRFLLFK
                     TEAPCFVVYTANFVDESVIIGGQPMLQHNGIALEAQALPDAIHSDLKGQVILKAGQTF
                     TSKTRYELVVK"
     gene            70607..71119
                     /locus_tag="SPG_0071"
     CDS             70607..71119
                     /locus_tag="SPG_0071"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF55947.1"
                     /translation="MALTLAGAVLTNDVFANDRLVATQTTDGKNENVLTSEVLKPSSG
                     NVLVGIKGEFVAPHQQSILDAINAICKEAADEGLVDKYVPIKWSTDLEKAAFARATEA
                     SITMDHTRLSSKDLWSAFPTSNSIMGENLAWNHDGFLKAIEQWRAEKADYVETKIVVQ
                     TTGNLVTMSR"
     gene            71140..71775
                     /gene="cbpI"
                     /locus_tag="SPG_0072"
     CDS             71140..71775
                     /gene="cbpI"
                     /locus_tag="SPG_0072"
                     /note="identified by match to protein family HMM PF01473"
                     /codon_start=1
                     /transl_table=11
                     /product="choline binding protein I"
                     /protein_id="ACF56853.1"
                     /translation="MGMAAFKNPNNQYKAITIAQTLGDDASSEELAGRYGSAVQCTEV
                     TASNLSTVKTKATVVEKPLKDFRASTSDQSGWVESNGKWYFYESGDVKTGWVKTDGKW
                     YYLNDLGVMQTGFVKFSGSWYYLSNSGAMFTGWGTDGSRWFYFDGSGAMKTGWYKENG
                     TWYYLDEAGIMKTGWFKVGPHWYYAYGSGALAVSTTTPDGYRVNGNGEWVN"
     gene            complement(71778..71894)
                     /locus_tag="SPG_0073"
     CDS             complement(71778..71894)
                     /locus_tag="SPG_0073"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF56824.1"
                     /translation="MRRQESNLYKSKEANVRHQPLSYRSFFLLSKMNALPMA"
     gene            72227..77797
                     /gene="zmpC"
                     /locus_tag="SPG_0074"
     CDS             72227..77797
                     /gene="zmpC"
                     /locus_tag="SPG_0074"
                     /note="identified by match to protein family HMM PF05342;
                     match to protein family HMM PF07501; match to protein
                     family HMM PF07580; match to protein family HMM PF07581"
                     /codon_start=1
                     /transl_table=11
                     /product="zinc metalloprotease ZmpC"
                     /protein_id="ACF55048.1"
                     /translation="MSRKSIGEKRHSFSMRKLSVGLVSVTVSSFFLMSQGIQSVSADN
                     MESPIHYKYMTEGKLTDEEKSLLVEALPQLAEESDDTYYLVYRSQQFLPNTGFNPTVG
                     TFLFTAGLSLLVLLVSKRENGKKRLVHFLLLTSMGVQLLPASAFGLTSQILSAYNSQL
                     SIGVGEHLPEPLKIEGYQYIGYIKTKKQDNTELSRTVDGKYSAQRDSQPNSTKTSDVV
                     HSADLEWNQGQGKVSLQGEASGDDGLSEKSSIAADNLSSNDSFASQVEQNPDHKGESV
                     VRPTVPEQGNPVSATTVQSAEEEVLATTNDRPEYKLPLETKGTQEPGHEGEAAVREDL
                     PVYTKPLETKGTQGPGHEGEAAVREEEPAYTEPLATKGTQEPGHEGKATVREETLEYT
                     EPVATKGTQEPEHEGEAAVEEELPALEVTTRNRTEIQNIPYTTEEIQDPTLLKNRRKI
                     ERQGQAGTRTIQYEDYIVNGNVVETKEVSRTEVAPVNEVVKVGTLVKVKPTVEITNLT
                     KVENKKSITVSYNLIDTTSAYVSAKTQVFHGDKLVKEVDIENPAKEQVISGLDYYTPY
                     TVKTHLTYNLGENNEENTETSTQDFQLEYKKIEIKDIDSVELYGKENDRYRRYLSLSE
                     APTDTAKYFVKVKSDRFKEMYLPVKSITENTDGTYKVTVAVDQLVEEGTDGYKDDYTF
                     TVAKSKAEQPGVYTSFKQLVTAMQSNLSGVYTLASDMTADEVSLGDKQTSYLTGAFTG
                     SLIGSDGTKSYAIYDLKKPLFDTLNGATVRDLDIKTVSADSKENVAALAKAANSANIN
                     NVAVEGKISGAKSVAGLVASATNTVIENSSFTGKLIANHQDSNKNDTGGIVGNITGNS
                     SRVNKVRVDALISTNARNNNQTAGGIVGRLENGALISNSVATGEIRNGQGYSRVGGIV
                     GSTWQNGRVNNVVSNVDVGDGYVITGDQYAAADVKNASTSVDNRKADRFATKLSKDQI
                     DAKVADYGITVTLDDTGQDLKRNLREVDYTRLNKAEAERKVAYSNIEKLMPFYNKDLV
                     VHYGNKVATTDKLYTTELLDVVPMKDDEVVTDINNKKNSINKVMLHFKDNTVEYLDVT
                     FKENFINSQVIEYNVTGKEYIFTPEAFVSDYTAITNNVLSDLQNVTLNSEATKKVLGA
                     ANDAALDNLYLDRQFEEVKANIAEHLRKVLAMDKSINTTGDGVVEYVSEKIKNNKEAF
                     MLGLTYMNRWYDINYGKMNTKDLSTYKFDFNGNNETSTLDTIVALGNSGLDNLRASNT
                     VGLYANKLASVKGEDSVFDFVEAYRKLFLPNKTNNEWFKENTKAYIVEMKSDIAEVRE
                     KQESPTADRKYSLGVYDRISAPSWGHKSMLLPLLTLPEESVYISSNMSTLAFGSYERY
                     RDSVDGVILSGDALRTYVRNRVDIAAKRHRDHYDIWYNLLDSASKEKLFRSVIVYDGF
                     NVKDETGRTYWARLTDKNIGSIKEFFGPVGKWYEYNSSAGAYANGSLTHFVLDRLLDA
                     YGTSVYTHEMVHNSDSAIYFEGNGRREGLGAELYALGLLQSVDSVNSHILALNTLYKA
                     EKDDLNRLHTYNPVERFDSDEALQSYMHGSYDVMYTLDAMEAKAILAQNNDVKKKWFR
                     KIENYYVRDTRHNKDTHAGNKVRPLTDEEVANLTSLNSLIDNDIINRRSYDDNREYKR
                     NGYYTISMFSPVYAALSNSKGAPGDIMFRKIAYELLAEKGYHKGFLPYVSNQYGAEAF
                     ASGSKTFSSWHGRDVALVTDDLVFKKVFNGEYSSWADFKKAMFKQRIDKQDNLKPITI
                     QYELGNPNSTKEVTITTAAQMQQLINEAAAKDITNIDRATSHTPASWVHLLKQKIYNA
                     YLRTTDDFRNSIYK"
     gene            77900..78013
                     /locus_tag="SPG_0075"
     CDS             77900..78013
                     /locus_tag="SPG_0075"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF55094.1"
                     /translation="MQIAGIIFNSSTTNGDKVDFNPTENVDLRNNFASLVK"
     gene            78153..79007
                     /locus_tag="SPG_0076"
     CDS             78153..79007
                     /locus_tag="SPG_0076"
                     /note="identified by match to protein family HMM PF00903"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF56523.1"
                     /translation="MTYEYQSHIYLAEAVLNVKDLVSQTVFYQQIIGLEILSQTDTEV
                     VLGLGGKALVHLIQAQEGGEVREHYGLYHLAILLPTRKALADVLKHLTDLQIPLVGGA
                     DHGYSEALYLEDLEGNGIELYRDKPVSTWDIREDGRIIGVTEVLAAQDIYELGERVEP
                     FILAEGTRMGHIHLSVKDSRKSRQFYQTVLGLEDKFSVPSASWIAAGDYHHHLAVNEW
                     GGKGLDPRKQVLPGLAYYVIEVAHKEELLTIAQRAQEVDAPIKWMTSIQLEITDSDGI
                     VTRIRLAR"
     gene            79113..79670
                     /locus_tag="SPG_0077"
     CDS             79113..79670
                     /locus_tag="SPG_0077"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="ACF56351.1"
                     /translation="MTSEYQKMIAGEFYRPSDPELRALAQASRQKQAAFNKEENPLKG
                     AEIIKTWFASTGKNLYINTRLMVDYGVNIHLGENFYSNWNLTMLDICPIRIGDNAMIG
                     PNCQFLTPLHPLDPQERNSGIEYGKPITIGDNFWTGGGVIVLPGVTLGNNVVAGAGAV
                     ITKSFGDNVVLAGNPARVIKEIPVK"
     gene            79887..80651
                     /locus_tag="SPG_0078"
     CDS             79887..80651
                     /locus_tag="SPG_0078"
                     /note="identified by match to protein family HMM PF01048"
                     /codon_start=1
                     /transl_table=11
                     /product="Phosphorylase, Pnp/Udp family protein, putative"
                     /protein_id="ACF55585.1"
                     /translation="MIQKHAIPILEFDDNPQAVIMPNHEGLDLQLPKKCVYAFLGEEI
                     DRYAREVGANCVGEFVSATKTYPVYVVNYKDEEICLVQAPVGSAPAAQFMDWLIGYGV
                     EQIISTGTCGVLADIEENAFLVPVRALRDEGASYHYVAPSRYMEMQPEAIAAIERVLD
                     DRGIPYEEVMTWSTDGFYRETAEKVAYRKEEDCAVVEMECSALAAVAQLRGVLWGELL
                     FTADSLADLDQYDSRDWGSEAFNKALELSLASVHHL"
     gene            81264..82643
                     /locus_tag="SPG_0079"
     CDS             81264..82643
                     /locus_tag="SPG_0079"
                     /note="identified by match to protein family HMM PF02386"
                     /codon_start=1
                     /transl_table=11
                     /product="potassium uptake protein, Trk family protein"
                     /protein_id="ACF55787.1"
                     /translation="MLFKLSKEKIELGLSRLSPARRIFLSFALVILLGSLLLSLPFVQ
                     VESSRATYFDHLFTAVSAVCVTGLSTLPVAHTYNIWGQIICLLLIQIGGLGLMTFIGV
                     FYIQSKQKLSLRSRATIQDSFSYGETRSLRKFVYSIFLTTFLVESLGAILLSFRLIPQ
                     LGWGRGLFSSIFLAISAFCNAGFDNLGSTSLFAFQTDLLVNLVIAGLIITGGLGFMVW
                     FDLAGHVGRKKKGRLHFHTKLVLLLTIGLLLFGTATTLFLEWNNAGTIGNLPVADKVL
                     VSFFQTVTMRTAGFSTIDYTQAHPVTLLIYILQMFLGGAPGGTAGGLKITTFFVLLVF
                     ARSELLGLPHANVARRTIAPRTVQKSFSVFIIFLMSFLIGLILLGITAKGNPPFIHLI
                     FETISALSTVGVTANLTPDLGKLALSVIMPLMFMGRIGPLTLFVSLADYHPEKKDMIH
                     YMKADISIG"
     gene            82657..83322
                     /locus_tag="SPG_0080"
     CDS             82657..83322
                     /locus_tag="SPG_0080"
                     /note="identified by match to protein family HMM PF02254"
                     /codon_start=1
                     /transl_table=11
                     /product="Trk transporter NAD+ binding protein"
                     /protein_id="ACF55184.1"
                     /translation="MSDRTIGILGLGIFGSSVLAALAKQDMNIIAIDDHAERINQFEP
                     VLARGVIGDITDEELLRSAGIDTCDTVVVATGENLESSVLAVMHCKSLGVPTVIAKVK
                     SQTAKKVLEKIGADSVISPEYEMGQSLAQTILFHNSVDVFQLDKNVSIVEMKIPQSWA
                     GQSLSKLDLRGKYNLNILGFREQENSPLDVEFGPDDLLKADTYILAVINNQYLDTLVA
                     LNS"
     gene            83677..83850
                     /locus_tag="SPG_0081"
     CDS             83677..83850
                     /locus_tag="SPG_0081"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase, family 2, truncation"
                     /protein_id="ACF54828.1"
                     /translation="MKLLSIAISSYNAAAYLHYCVESLVIGWDQVGNFSKGQYTMMHS
                     LIYRTDLLRASQF"
     gene            83917..84327
                     /locus_tag="SPG_0082"
     CDS             83917..84327
                     /locus_tag="SPG_0082"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase, family 2"
                     /protein_id="ACF56605.1"
                     /translation="MYYLPVDFYRYLIGREDQSVNEQVMIKCIDQQLKVNRLLVDQLD
                     LSQVSHPKMREYLLNHIEITTVISSTLLNRSGTAEHLAKKRQLWTYIQQKNPEVFQAI
                     RKTMLSRLTKHSVLPDRKLSNVVYQITKSVYGFN"
     gene            84443..86104
                     /locus_tag="SPG_0083"
     CDS             84443..86104
                     /locus_tag="SPG_0083"
                     /note="identified by match to protein family HMM PF00746;
                     match to protein family HMM PF04650; match to protein
                     family HMM TIGR01167; match to protein family HMM
                     TIGR01168"
                     /codon_start=1
                     /transl_table=11
                     /product="cell wall surface anchor family protein"
                     /protein_id="ACF55890.1"
                     /translation="MKFNPNQRYTRWSIRRLSVGVASVVVASGFFVLVGQPSSVRADV
                     VNPTPGQVLPEETSGTKEGDLSEKPGDTVLTQAKPEGVTGNTNSLPTPTERTEVSEET
                     NSSSLDTLFEKDEEAQKNPELTDVLKETVDTADVDGTQASPAETTPEQVKGGVKENTK
                     DSIDVPAAYLEKAEGKGPFTAGVNQVIPYELFAGDGMLTRLLLKASDNAPWSDNGTAK
                     NPALPPLEGLTKGKYFYEVDLNGNTVGKQGQALIDQLRANGTQTYKATVKVYGNKDGK
                     ADLTNLVATKNVDININGLVAKETVQKAVADNVKDSIDVPAAYLEKAKGEGPFTAGVN
                     HVIPYELFAGDGMLTRLLLKASDKAPWSDNGDAKNPALSPLGENVKTKGQYFYQXALD
                     GNVAGKEKQALIDQFRANGTQTYSATVNVYGNKDGKPDLDNIVATKKVTIKINVKETS
                     DTANGSLSPSNSGSGVTPMNHNHATGTTDSMPADTMTSSTNTMAGENMAASANKMSDT
                     MMSEDKAMLPNTGETQTSMASIGFLGLALAGLLGGLGLKNKKEEN"
     gene            86271..86969
                     /locus_tag="SPG_0084"
     CDS             86271..86969
                     /locus_tag="SPG_0084"
                     /note="identified by match to protein family HMM PF00072;
                     match to protein family HMM PF00486"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator TCS08"
                     /protein_id="ACF55468.1"
                     /translation="MGKTILLVDDEVEITDIHQRYLIQAGYQVLVAHDGLEALELFKK
                     KPIDLIITDVMMPRMDGYDLISEVQYLSPEQPFLFITAKTSEQDKIYGLSLGADDFIA
                     KPFSPRELVLRVHNILRRLHRGGETELISLGNLKMNHSSHEVQIGEEMLDLTVKSFEL
                     LWILASNPERVFSKTDLYEKIWKEDYVDDTNTLNVHIHALRQELAKYSSDQTPTIKTV
                     WGLGYKIEKPRGQT"
     gene            86966..88018
                     /locus_tag="SPG_0085"
     CDS             86966..88018
                     /locus_tag="SPG_0085"
                     /note="identified by match to protein family HMM PF00512;
                     match to protein family HMM PF00672; match to protein
                     family HMM PF02518"
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase TCS08"
                     /protein_id="ACF55003.1"
                     /translation="MKLKSYILVGYIISTLLTILVVFWAVQKMLIAKGEIYFLLGMTI
                     VASLVGAGISLFLLLPVFTSLGKLKEHAKRVAAKDFPSNLEVQGPVEFQQLGQTFNEM
                     SHDLQVSFDSLEESEREKGLMIAQLSHDIKTPITSIQATVEGILDGIIKESEQAHYLA
                     TIGRQTERLNKLVEELNFLTLNTARNQVETTSKDSIFLDKLLIECMSEFQFLIEQERR
                     DVHLQVIPESARIEGDYAKLSRILVNLVDNAFKYSAPGTKLEVVAKLEKDQLSISVTD
                     EGQGIAPEDLENIFKRLYRVETSRNMKTGGHGLGLAIARELAHQLGGEITVSSQYGLG
                     STFTLVLNLSGSENKA"
     gene            88213..88824
                     /gene="rpsD"
                     /locus_tag="SPG_0086"
     CDS             88213..88824
                     /gene="rpsD"
                     /locus_tag="SPG_0086"
                     /note="identified by match to protein family HMM PF00163;
                     match to protein family HMM PF01479; match to protein
                     family HMM TIGR01017"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S4"
                     /protein_id="ACF56421.1"
                     /translation="MSRYTGPSWKQARRLGLSLTGTGKELARRNYVPGQHGPNNRSKL
                     SEYGLQLAEKQKLRFTYGVGEKQFRNLFVQATKIKGGILGFNFMLLLERRLDNVVYRL
                     GLATTRRQARQFVNHGHILVDGKRVDIPSYRVTPGQVISVREKSLKVPAILEAVEATL
                     GRPAFVSFDAEKLEGSLTRLPERDEINPEINEALVVEFYNKML"
     gene            89564..89824
                     /locus_tag="SPG_0087"
     CDS             89564..89824
                     /locus_tag="SPG_0087"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF55404.1"
                     /translation="MTGVSNPTTDSARLVLAEAKKAFADDSLTEQGLRDILQTVKDAI
                     ASLESIKESQSATKDGGQTAGKETAGEDESANQTQEISQGIK"
     gene            89778..89999
                     /locus_tag="SPG_0088"
     CDS             89778..89999
                     /locus_tag="SPG_0088"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF55392.1"
                     /translation="MSLQIKLKKLAKELSKLLKDSNLETVDKDVLENSQKELQKAVLF
                     LADEKGSEHTEAEVIDNLKEVIAKLKANA"
     gene            90318..91247
                     /locus_tag="SPG_0089"
     CDS             90318..91247
                     /locus_tag="SPG_0089"
                     /note="identified by match to protein family HMM PF00528"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, permease protein"
                     /protein_id="ACF54816.1"
                     /translation="MKKFSKTLRDNWIFLLMVLPGALWLILFFYIPVFGNVVAFKDYH
                     MTSNGFIXSIINSKWVGLDNFRFLFSSRDAFIITRNTVLYNLGFIFLGLVVSVGIAII
                     LSELRSKRMVKIFQTSMLFPYFLSWVIISFFTDAFLNIDKGVFNHLLESLGLKEVNFY
                     ADLGIWPYLLLFLGIWKGFGYSSVMYYATIMGIDPTYYEAATVDGASKWQRIRNVTIP
                     QLTPLVTVLTILAVGNIFRADFGLFYQIPHNAGQLYNVTNVLDVYVFNGLTQTADIGM
                     AAAAGLYQSVVGLILVILSNLLARRVDPNSALF"
     gene            91261..92184
                     /locus_tag="SPG_0090"
     CDS             91261..92184
                     /locus_tag="SPG_0090"
                     /note="identified by match to protein family HMM PF00528"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, permease protein"
                     /protein_id="ACF56620.1"
                     /translation="MAKKKIKKEKIDNVGIHSFSKKADIFFSIISGLIALSCILPFVF
                     VIIISVTDEKSLLQYGYSFFPSQFGLDGFEFLAQXKDKILQALFISVFVTVVGTLTNV
                     FITTTYAYAISRTTFKYRRFFTIFVLLSMLFNAGLVPGYIMVTRVLQLGDTVWALIVP
                     MLLSPFNIILMRSFFKKTIPXAILESARIDGASEARIFFQICLPLSLPGIATITLLTA
                     LGFWNDWFNALLYIKSDNLYPLQYLLMQIQQNMDYIAKAVGLTGQLGVALPKETGRMA
                     MVVVATLPIAILYPFFQRYFVKGLTIGGVKE"
     gene            92394..93869
                     /locus_tag="SPG_0091"
     CDS             92394..93869
                     /locus_tag="SPG_0091"
                     /note="identified by match to protein family HMM PF01547"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, substrate-binding protein"
                     /protein_id="ACF55658.1"
                     /translation="MKNWKKYAFASASVVALAAGLAACGNLTGNSKKAADSGDKPVIK
                     MYQIGDKPDNLDELLANANKIIEEKVGAKLDIQYLGWGDYGKKMSVITSSGENYDIAF
                     ADNYIVNAQKGAYADLTELYKKEGKDLYKALDPAYIKGNTVNGKIYAVPVAANVASSQ
                     NFAFNGTLLAKYGIDISGVTSYETLEPVLKQIKEKAPDVVPFAIGKVFIPSDNFDYPV
                     ANGLPFVIDLEGDTTKVVNRYEVPRFKEHLKTLHKFYEAGYIPKDVATSDTSFDLQQD
                     TWFVREETVGPADYGNSLLSRVANKDIQIKPITNFIKKNQTTQVANFVISNNSKNKEK
                     SMEILNLLNTNPELLNGLVYGPEGKNWEKIEGKENRVRVLDGYKGNTHMGGWNTGNNW
                     ILYINENVTDQQIENSKKELAEAKESPALGFIFNTDNVKSEISAIANTMQQFDTAINT
                     GTVDPDKAIPELMEKLKSEGAYEKVLNEMQKQYDEFLKNKK"
     gene            94141..95127
                     /locus_tag="SPG_0092"
     CDS             94141..95127
                     /locus_tag="SPG_0092"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF56832.1"
                     /translation="MAKDIRVLLYYLYTPIENAEQFAADHLAFCKSIGLKGRILVADE
                     GINGTVSGDYETTQKYMDYVHSLPGMEELWFKIDEESEQAFKKMFVRYKKEIVHLGLE
                     DNDFDNDINPLETTGAYLSPKEFKEALLDKDTVVLDTRNDYEYDLGHFRGAIRPDIRN
                     FREXPQWVRDNKEKFMDKRVVVYCTGGVRCEKFSGWMVREGYKDVGQLHGGIATYGKD
                     PEVQGELWDGKMYVFDERIAVDVNHVNPTIVGKDWFDGTPCERYVNCGNPFCNRRILT
                     SEENEDKYLRGCSHECRVHPRNRYVSKNELTQAEVIERLAAIGESLDQAATV"
     gene            95249..96109
                     /locus_tag="SPG_0093"
     CDS             95249..96109
                     /locus_tag="SPG_0093"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF56294.1"
                     /translation="MAKTFFIPNKQSILGEQEILNAKSILALLDGLESHSYDVVYLRQ
                     PLNRLEYIECAIVGQSQFLFKVSYADGQKAYRVDLPDLLTETDWRIIKSFLDALLAYT
                     GTDIEGLDGFDFEAYFQASIQAYLADPVARFTICQGIFNPIFFSRENLKSFLEADGLA
                     QFEARVRAVQETDAYFARVSFYQDGEGKVHGVYHLAQGVKTVLPREPFVPAAYIEQLV
                     DKEVQWEIDLVQITGDGSKPEDYEAIARLDYAKFLESLPSAFYHQLDANQLEVQPILG
                     QDFKTLAQEK"
     gene            complement(96181..97245)
                     /locus_tag="SPG_0094"
     CDS             complement(96181..97245)
                     /locus_tag="SPG_0094"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF55625.1"
                     /translation="MKQEWFESNDFVKTTSKNKPEEQAQEVADKAEETIADFDTPIGK
                     NTQVEEEVSQAEVELESQQEEKIETPEVGEARTEIEEKKASNSTEEESDLSKETEKVT
                     IAEESQEALPQQKATTKEPLLISKSLESPYIPDQAPKSRDKWKEQVLDFWSWLVEAIK
                     SPTSKFETSITHSYTAFLLLILFSASSFFFSIYHIKHAYYGHIASINSRFPEQLAPLT
                     LFSIISILVATTLFFFSFLLGSFVVRRFIHQEKDWTLDKVLQQYSQLLAIPIFLTAIA
                     SFFAFFDSLRFTALLCVISIGIILLASLHIITRPSQASETDSFYQLFLSVLVNGVIIL
                     LFFVAEVALIGDYLRILAFL"
     gene            complement(97308..98219)
                     /locus_tag="SPG_0095"
     CDS             complement(97308..98219)
                     /locus_tag="SPG_0095"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF55979.1"
                     /translation="MRKWTKGFLIFGVVTTVIGFILLFVGIQSDGIKSLLSMSKEPVY
                     DSRTEKLTFGKEVENLEITLHQHALTITDSFDDQIHISYHPSLSAHHDLITNQNDRTL
                     SLTDKKLSETPFLSSGIGGILHIASSYSSRFEEVILQLPKGRTLKGINISANRGQTTI
                     INASLENATLNTNSYILRIEGSRIKNSKLTTPNIVNIFDTVLTDSQLESTENHFHAEN
                     IQVHGKVELTAKDYLRIILDQKESQRINWDISSNYGSIFQFTREKPESRGTELSNPYK
                     TEKTDVKDQLIARSDDNIDLISTPSRR"
     gene            complement(98212..98805)
                     /locus_tag="SPG_0096"
     CDS             complement(98212..98805)
                     /locus_tag="SPG_0096"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF56418.1"
                     /translation="MTRTEYLTQLELYLKKLPEADRIEAMDYFRELFDDAGVEGEEEL
                     IASLGTPKAAAHEVLSNLLDKKINEAPAQKNNRQILHIALLALLAAPIGIPLGIAILV
                     TLFAILVAALTVILAFFAVSILGIIGGFLFLVESFTILAQAKSAFILIFGSGLLAIGA
                     SSLVLLGISYVARFFGLLIVRLVQFVLKKGKRGNQHA"
     gene            complement(98792..99118)
                     /locus_tag="SPG_0097"
     CDS             complement(98792..99118)
                     /locus_tag="SPG_0097"
                     /note="identified by match to protein family HMM PF03551"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, PadR family"
                     /protein_id="ACF54989.1"
                     /translation="MYFPTSSALIEFLILAVLEQGDSYGYEISQTIKLIANIKESTLY
                     PILKKLEGNSFLTTYSREFQGRMRKYYSLTNGGIEQLLTLKDEWALYTDTINGIIEGS
                     IRHDKN"
     gene            complement(99257..100423)
                     /locus_tag="SPG_0098"
     CDS             complement(99257..100423)
                     /locus_tag="SPG_0098"
                     /note="identified by match to protein family HMM PF07690"
                     /codon_start=1
                     /transl_table=11
                     /product="transporter, putative"
                     /protein_id="ACF54892.1"
                     /translation="MKKQSLFFVPGIILIGVSLRTPFTVLPIILGNISQGLEVEVSSL
                     GVLTSLPLLMFTLFSPFSTQLAQKIGLEHLFTYSLFFLTIGSLIRLINLPLLYLGTLM
                     VGASVAVINVLLPSLIQANQPKKIGFLTTLYVTSMGIATALASYLAVPITQASSWKGL
                     ILLLTLLCLATFLVWLPNHRYNHRLAPQTKQKSQIKVMRNKQVWAIIIFSGFQSLIFY
                     TVMTWLPTMSIHAGLSSHEAGLXTSILSLISIPFSMTIPSLTTSLSTRNRQLMLTLVS
                     LAGVVGISMLFFPINNFIYWLAIHLLIGTATSALFPYLMVNFSLKTSAPEKTAQLSGL
                     SQTGGYILAAFGPTLFGYSFDLFHSWVPSVAALLLIDILMTVALFTVDRADKIL"
     gene            100574..101638
                     /locus_tag="SPG_0099"
     CDS             100574..101638
                     /locus_tag="SPG_0099"
                     /note="identified by match to protein family HMM PF00535"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase"
                     /protein_id="ACF55525.1"
                     /translation="MTQNVESLLVSIVISAYNEEKYLPGLIEDLKNQTYPKENIEILF
                     INAMSTDGTTAIIQQFIKEDTEFNSIRLYNNPKKNQASGFNLGVKHSVGDLILKIDAH
                     SKVTETFVMNNVAIIQQGEFVCGGPRPTIVEGKGKWAETLHLVEENMFGSSIANYRNS
                     SEDRYVSSIFHGMYKREVFQKVGLVNEQLGRTEDNDIHYRIREYGYKIRYSPSILSYQ
                     YIRPTFKKMLHQKYLNGLWIGLTSHVQFKCLSLFHYVPCLFVLSLVFSLALLPITFVF
                     ITLLLGAYFLLLSLLTLLTLLKHKNGFLIVMPFLLFSIHFAYGFGTIVGLIRGFKWKK
                     EYKRTIIYLDKISQINKNML"
     gene            101680..103530
                     /locus_tag="SPG_0100"
     CDS             101680..103530
                     /locus_tag="SPG_0100"
                     /note="identified by match to protein family HMM PF01073;
                     match to protein family HMM PF01370; match to protein
                     family HMM PF02719; match to protein family HMM PF04321;
                     match to protein family HMM PF07993"
                     /codon_start=1
                     /transl_table=11
                     /product="capsular polysaccharide biosynthesis protein"
                     /protein_id="ACF56866.1"
                     /translation="MNKKLTDYVIDLVEILNKQQKQVFWGIFDIFSMVVSIIVSYILF
                     YGLINPAPVDYIIYTSLAFLFYQLMIGFWGLNASISRYSKITDFMKIFFGVTASSVLS
                     YSICYAFLPLFSIRFIILFILLSTFLILLPRITWQLIYSRRKKGSGDGEHRRTFLIGA
                     GDGGALFMDSYQHPTSELELVGILDKDSKKKGQKLGGIPVLGSYDNLPELAKRHQIER
                     VIVAIPSLDPSEYERILQMCNKLGVKCYKMPKVETVVQGLHQAGTGFQKIDITDLLGR
                     QEIRLDESRLGAELTGKTILVTGAGGSIGSEICRQVSRFNPERIVLLGHGENSIYLVY
                     HELIRKFQGIDYVPVIADIQDYDRLLQVFEQYKPAIVYHAAAHKHVPMMERNPKEAFK
                     NNIRGTYNVARAVDEAKVPKMVMISTDKAVNPPNVMGATKRVAELIVTGFNQRSQSTY
                     CAVRFGNVLGSRGSVIPVFERQIAEGGPVTVTDFRMTRYFMTIPEASRLVIHAGAYAK
                     DGEVFILDMGKPVKIYDLAKKMVLLSGHTESEIPIVEVGIRPGEKLYEELLVSTELVD
                     NQVMDKIFVGKVNVMPLESINQKIGEFRTLSGDELKQAIIAFANQTTHIE"
     gene            complement(103925..104557)
                     /locus_tag="SPG_0101"
     CDS             complement(103925..104557)
                     /locus_tag="SPG_0101"
                     /note="identified by match to protein family HMM PF00702;
                     match to protein family HMM TIGR01549"
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase, haloacid dehalogenase-like family
                     protein"
                     /protein_id="ACF56097.1"
                     /translation="MTSITAIFFDLDGTLVDSSIGIHNAFTYTFKELGVPSPDAKTIR
                     GFMGPPLESSFATCLSKDQISEAVQIYRSYYKAKGIYEAQLFPQIIDLLEELSSSYPL
                     YITTTKDTSTAQDMAKNLEIHHFFDGIYGSSPEAPHKADVIHQALQTHQLAPEQAIII
                     GDTKFDMLGARETGIQKLAITWGFGEQADLLNYQPDYIAHKPLEVLAYFQ"
     gene            complement(104579..105451)
                     /gene="sdhA"
                     /locus_tag="SPG_0102"
     CDS             complement(104579..105451)
                     /gene="sdhA"
                     /locus_tag="SPG_0102"
                     /note="identified by match to protein family HMM PF03313;
                     match to protein family HMM TIGR00718"
                     /codon_start=1
                     /transl_table=11
                     /product="L-serine dehydratase, iron-sulfur-dependent,
                     alpha subunit"
                     /protein_id="ACF56506.1"
                     /translation="MFYSIKELVEQADLDFQGNVAELMITTEFELTGREREEVFLLME
                     RNLEVMKASVQLGLNENKSRSGLTGGDAAKLDHYIENGKTLSDYTILSAARNAIAVNE
                     HNAKMGLVCATPTAGSAGCLPSVLTAAIEKLDLSHEQQLDFLFAAGAFGLVIANNASI
                     SGAEGGCQAEVGSASAMSAAALTLAAGGTPYQASQAIAFVIKNMLGLICDPVAGLVEV
                     PCVKRNAMGASFAFIAADMALAGIESKIPVDEVIDAMYQVGASMPTAFRETAEGGLAT
                     TPTGRRLQKEIFGE"
     gene            complement(105460..106131)
                     /gene="sdhB"
                     /locus_tag="SPG_0103"
     CDS             complement(105460..106131)
                     /gene="sdhB"
                     /locus_tag="SPG_0103"
                     /note="identified by match to protein family HMM PF01842;
                     match to protein family HMM PF03315; match to protein
                     family HMM TIGR00719"
                     /codon_start=1
                     /transl_table=11
                     /product="L-serine dehydratase, iron-sulfur-dependent,
                     beta subunit"
                     /protein_id="ACF55201.1"
                     /translation="MKSLRFQSVFDIIGPVMIGPSSSHTAGAVRIGKIVSSIFDDTPT
                     EVEFQLFNSFAKTYRGHGTDLALVAGILGMDTDDPEIPNSLEIAHKRGIKIVWTIQKD
                     SNAPHPNTTKITVKNAHKTISVTGISIGGGNIQVTELNGFAVSLNMNTPTIIIVHQDI
                     PGMIALVTEALSRYGINIAQMNVTREKAGEKAIMIIEVDSRNCDEAIEEIRKIPHLHN
                     VNFFK"
     gene            106372..106959
                     /locus_tag="SPG_0104"
     CDS             106372..106959
                     /locus_tag="SPG_0104"
                     /note="identified by match to protein family HMM PF01476"
                     /codon_start=1
                     /transl_table=11
                     /product="LysM domain protein"
                     /protein_id="ACF56614.1"
                     /translation="MKSITKKIKATLAGVAALFAVFAPSFVSAQESSTYTVKEGDTLS
                     EIAETHNTTVEKLAENNHIDNIHLIYVDQELVIDGPVAPVATPAPATYAAPAAQDETV
                     SAPVAETPVVSETVVSTVSGSEAEAKEWIAQKESGGSYTATNGRYIGRYQLTDSYLNG
                     DYSAENQERVADAYVAGRYGSWTAAKNFWLNNGWY"
     gene            108094..110202
                     /locus_tag="SPG_0105"
     CDS             108094..110202
                     /locus_tag="SPG_0105"
                     /note="identified by match to protein family HMM
                     TIGR01654"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter membrane-spanning permease"
                     /protein_id="ACF56130.1"
                     /translation="MKKISNFCMLLLLLCTTFFVFNVNYTREVVRIQEMGKTVDSLDL
                     YLKDINEPAASVLRFFEDVSKEYKVSIIKTDSGDEVVKSGVFDKDTFPYQEFGISSLD
                     FTTDGEGVYSNKEISNKLGTIPTFLKAKPIQLMTFQTYIKDTSRSLNGRYTITSTQEM
                     DKDRIVQKWSDFFKIDQATLLEPTYKSAVEVINRDLLLSAIVFVLAILLLVLVTVYQP
                     MMEMKRVGVQKLLGFQDRAVLADVVKGNLYLLLGGALVINLGVFFLLDYKPKDLFPML
                     WLSHFLLLQLYLFISWLTYLLIQKMTISSLLKGFSSFKFGLIFNYVMKIGTTILLTAL
                     LIGVGXSLEQENKELAYQQQWVSQGNYLTLETFKLNDNLWQEELAGSGKSTDYFYRFY
                     QDLVEKTQAGYVQSSSLPVKNFVQSEQIQQYQLTDTVDVYYANRNFLKSKGFKLPDTG
                     IKKVILMPASTKGEEDKNQLLGKLIAFHSMKYEEQQKRTIEEMDVEIAYYEGDWSFFP
                     YSDKRKENLSNPIISLVNDSDMMWDEKASLSTTGLNNPIKIENTVQHQKEITELVEKL
                     SDGNYLKFSSIQAIQQEKVDSYRDAVRNFNLLFALFGLLSMMISYFLLVTTFLLKRRD
                     IITKKFMGWKLVDRYRPLLVLLLLGYSFPLLVLIFFAHAFLPLLLFAGFTCLDILFVL
                     GLASRMEKRSLVELLKGGIL"
     gene            110199..110840
                     /locus_tag="SPG_0106"
     CDS             110199..110840
                     /locus_tag="SPG_0106"
                     /note="identified by match to protein family HMM PF00005;
                     match to protein family HMM TIGR03608"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, ATP-binding protein"
                     /protein_id="ACF55805.1"
                     /translation="MIELKNITKTIGGKVILDNLSLRIDQGALVAIVGKSGSGKSTLL
                     NLLGLIDGDYSGRYEIFGQTNLAVNSAKSQTIIREHISYLFQNFALIDDETVEYNLML
                     ALKYVKLPKKDKLKKVEEILERVGLSATLHQRVSELSGGEQQRIAVARAXLKPSQLIL
                     ADEPTGSLDPENRDLVLKFLLEMNREGKTVIIVTHDAYVAQQCHRVIELGEGK"
     gene            111047..111853
                     /locus_tag="SPG_0107"
     CDS             111047..111853
                     /locus_tag="SPG_0107"
                     /note="identified by match to protein family HMM PF00497"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, substrate-binding protein"
                     /protein_id="ACF55332.1"
                     /translation="MNKMKKVLMTMFGLVMLPLLFACSNNQSAGIEAIKSKGKLVVAL
                     NPDFAPFEYQKVVDGKNQIVGSDIELAKAIATELGVELELSPMSFDNVLASVQSGKAD
                     LAISGVSKTDERSKVFDFSTPYYTAKNKLIVKKSDLATYQSVNDLAQKKVGAQKGSIQ
                     ETMAKDLLQNSSLVSLPKNGNLITDLKSGQVDAVIFEEPVAKGFVENNPDLAIADLNF
                     EKEQDDSYAVAMKKDSKELKEAVDKTIQKLKESGELDKLIEDAFKASIEK"
     gene            111870..112289
                     /gene="argG"
                     /locus_tag="SPG_0108"
     CDS             111870..112289
                     /gene="argG"
                     /locus_tag="SPG_0108"
                     /EC_number="6.3.4.5"
                     /note="identified by match to protein family HMM PF00764"
                     /codon_start=1
                     /transl_table=11
                     /product="argininosuccinate synthase"
                     /protein_id="ACF56754.1"
                     /translation="MSKEXVILAYSGGLDTSVAITWLKKDYDVVAVCMDVGEGKDLDF
                     IHDKALKVGAVESYVIDVKDEFATDYVLVALQSHAYYEQKYPLVSALSRPLISKKLVE
                     IAHQTGATTIAHGCTGKGNDQVEYQIAVAKKANEAKK"
     gene            complement(112577..112897)
                     /locus_tag="SPG_0109"
     CDS             complement(112577..112897)
                     /locus_tag="SPG_0109"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF56315.1"
                     /translation="MQRLEVYKNYQRLYDLRIAILLNLSTLYLYNQDKNMCKQICYTL
                     LEDAKNKKSYDRLAICYVRIGICRDNAKLIQKGFSLLELTEETSMLSHLKKEVETHYQ
                     PKKL"
     gene            113661..114014
                     /locus_tag="SPG_0110"
     CDS             113661..114014
                     /locus_tag="SPG_0110"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF56030.1"
                     /translation="MELVLPNNYVVIDEEEMMYLDGGAYLSKRACQGICAALAMSPGT
                     FIALAGAAVLTKKLINYIKVGGLGGWLIGAAAGVLAGAAGRIAYCIGYGALNRGCDIS
                     GNPYPWDGFISATVR"
     gene            114011..114739
                     /locus_tag="SPG_0111"
     CDS             114011..114739
                     /locus_tag="SPG_0111"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF55675.1"
                     /translation="MSNVDKIRKIHIIVCWIYIFLSFNPIISNTEYFLLIFLAFIYSI
                     VSLPLYSVKNKIVSICLAINSILLMSFPILINKFFPESFLTYTVLISVFITELIIFHL
                     IGKDFDIKLTNEYKKISQFRSKVSQSPWIKYLEISSFILTIFPSILYGTVDNHVLTLI
                     FLIKICADTTIKFLFIRLFDTSTLMKRRIFFLFALDVIAYLFLGYLLVIQKAGYLFSV
                     LLLFSNFSVPFIREKEYELFKNKK"
     gene            114893..115105
                     /locus_tag="SPG_0112"
     CDS             114893..115105
                     /locus_tag="SPG_0112"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF54762.1"
                     /translation="MLIVLISVIVAFLYHKITEYVNNRKIDIVIFLSLLISHFIWNYY
                     FLPIEILIAISGANLLLSFLKKLQIK"
     gene            115479..115604
                     /locus_tag="SPG_0113"
     CDS             115479..115604
                     /locus_tag="SPG_0113"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF55696.1"
                     /translation="MATITNALNIAVTVAEVFSLGGAIAYGLDIVDGKFDGYLWA"
     gene            115987..117045
                     /locus_tag="SPG_0114"
     CDS             115987..117045
                     /locus_tag="SPG_0114"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF55924.1"
                     /translation="MKDDQKYLLAGLYSLLVAIFYFPLIESKGIFVSILMAVLLLYLI
                     YFIATVIHIVIIKFIRKKSFKYLVLYPFTXDGSWRFQPINLLYFPEMVRDVIPINLVQ
                     EYCQGQPYGLLKKMLKRIRLSREISLLLATIIVYFFTHRILPFSVFTFMFSYILIFAQ
                     SYLGGNTAWIGNRRLIIDDEFEKILLSKSYIKEISSARYSEYLICEYKNLTPIILLAI
                     FENLLDSYLLQNQSEVDLDIFYKVLPLLYKEKYTMGFNYFVSLNYLLYKVGFLGIIYD
                     NEALRDLSKQYLNKNISELQDGSFEGGIQDAVASKQIVVINEFIACLNSRCVPSQYDR
                     FFYKDRPYIFSRKSPIKG"
     gene            117359..118333
                     /locus_tag="SPG_0115"
     CDS             117359..118333
                     /locus_tag="SPG_0115"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF56404.1"
                     /translation="MKNKRYFFDTILIILLLISTIFCVSPVFIKLDILGTPSHAILTF
                     VLAIPLFYILSQCLHTLLLLVSSIFCKLRPIYFYFIFVIIIGARKYYRILFHQLMGFS
                     PGVAVFYKESQTTKNLFKFYYFLYFTTLISYYFFFTFVYDKPLLLPLIPFSIIIALVQ
                     KLYRIENQQLFLLKSKVLTILESKRDCEFNLQDYHEIWKLQSKSELPCVALSYISLIK
                     PYLSESVREQIDLLEVKRFKKINHPISLYGMLDVIKLNLYLRHYNEKNKYESMLKKIL
                     EVRPDFVLIEQNIDDSLNSSQPLSLSLAISEIQLLLEVYMGIKHVSTK"
     gene            118807..119181
                     /locus_tag="SPG_0116"
     CDS             118807..119181
                     /locus_tag="SPG_0116"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF55427.1"
                     /translation="MELVLPNNYVVLEQEEMMYLDGGFSIPRWPVATAINIAFNGVLG
                     GGAISLVRNYIRNYGLRRVTSAIAGAAARYVGVRVANRVAGFALSAINGFAAWMSIGD
                     AITTIWANNDVNRRDPNLNALW"
     gene            119389..120291
                     /locus_tag="SPG_0117"
     CDS             119389..120291
                     /locus_tag="SPG_0117"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF55082.1"
                     /translation="MIRKLIIFLLMLPLFVLWLELHVLVNNLLLNLESPLDFVVSMSL
                     TFFVLILSKIILDILYALKDLYKKEALITIFPFIFIGRKKVNVRFSPYFSFHRKSLSP
                     DDLRSRIIWSFILEIAIILVFILKIPFVIIMLTTIFFWNIMDINHLVFNKTEFLFNQN
                     KWEKEDSFESDLTKTLKDKIQKSELSYSDLMSLQLYDAMNQSTFLTDSELFEDILKKI
                     EDSHNTLLCTGLVELLLYEISISNNNNWQEKVDKIRIQLIRINQLDFFYYTSWLRQNF
                     DFCMNREYHKMKSRKLLLSNKKIV"
     gene            120347..120700
                     /locus_tag="SPG_0118"
     CDS             120347..120700
                     /locus_tag="SPG_0118"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF56392.1"
                     /translation="MELVLPNNYVVIDEEEMMYLDGEAYLSKRACQGICAALAMSSGT
                     FIALAGAAVLTKKLINYIKVGGLGGWLIGAAAGVLATAAGKIAYYIGYGVLNRGCDIN
                     GNPYPWDGFISATVR"
     gene            120697..121425
                     /locus_tag="SPG_0119"
     CDS             120697..121425
                     /locus_tag="SPG_0119"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF56055.1"
                     /translation="MSNVDKIRKIHIIVCWMYIFLSFRAIINDTEYFLLIFLAFIYSI
                     VSLPLYSVKNKIVSICLAINSILLMSFPILINKFFPESFLTYTVLISVFITELIIFHL
                     IGKDFDIKLTNEYKKISQFRSKVSQSPWIKYLEISSFILTIFPSILYGTVDNHVLTLI
                     FLIKICADTTIKFLFIRLFDTSTLMKRRIFFLFALDVIAYLFLGYLLVIQKAGYLFSV
                     LLLFSNFSVPFIKEKEYELFKNSK"
     gene            122657..122809
                     /locus_tag="SPG_0120"
     CDS             122657..122809
                     /locus_tag="SPG_0120"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF55183.1"
                     /translation="MNFCLTDLHHLFGLYKITRDYASQTKPAIQAGVFILEDFRNILC
                     TMMYVQ"
     gene            123363..125492
                     /gene="pspA"
                     /locus_tag="SPG_0121"
     CDS             123363..125492
                     /gene="pspA"
                     /locus_tag="SPG_0121"
                     /note="identified by match to protein family HMM PF01473"
                     /codon_start=1
                     /transl_table=11
                     /product="pneumococcal surface protein A"
                     /protein_id="ACF54852.1"
                     /translation="MNKKKMILTSLASVAILGAGFVASQPTVVRAEAAPQVVEKSSLE
                     KKYEEAKAKADTAKKDYETAKKKAAEAQKKYEDDQKRTEEKGALEEETSRKVNDATLE
                     VQNAYVEYGEANKKKGKDREKKLADAQKKIDEAQEKLTKAKNEFQSVRAMVVPEPEQL
                     AETKKKAEEAKAEEAVAKEKSDKAAKEVEVAKKRVEAEEAELDKKVAELQNKVADLEK
                     EIADAEKTVADLEKEVAKLEKDVEDFKNSNGEQAEQYLAAAEKDLVAKKAELAEAKIK
                     AATKKAELEPELEKAEAELENLLSTLDPEGKTQDELDKEAAEAELNKKVEALQNQVAE
                     LEEELSKLEDNLKDAETNNVEDYIKEGLEEAIATKKAELEKTQKELDAALNELGPDGD
                     EEETPAPAPQPEKPAPAPAPKPEQPAPAPKPEKTDDQQAEEDYARRSEEEYNRLPQQQ
                     PPKAEKPAPAPKPEQPVPAPKTGWKQENGMWYFYNTDGSMATGWLQNNGSWYYLNSNG
                     AMATGWLQYNGSWYYLNANGAMATGWAKVNGSWYYLNANGAMATGWLQYNDSWYYLNA
                     NGAMATGWLQYNGSWYYLNANGAMATGWAKVNGSWYYLNANGAMATGWLQYNGSWYYL
                     NANGAMATGWAKVNGSWYYLNANGSMATGWVKDGDTWYYLEASGAMKASQWFKVSDKW
                     YYVNGLGALAVNTTVDGYKVNANGEWV"
     gene            125742..125870
                     /locus_tag="SPG_0122"
     CDS             125742..125870
                     /locus_tag="SPG_0122"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF56160.1"
                     /translation="MLTISFKKQFLSSSLSSPTKRVIMNTAQATFNREAHTTFNRE"
     gene            125893..127014
                     /locus_tag="SPG_0123"
     CDS             125893..127014
                     /locus_tag="SPG_0123"
                     /EC_number="2.1.1.61"
                     /note="identified by match to protein family HMM PF03054;
                     match to protein family HMM TIGR00420"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA
                     (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
                     /protein_id="ACF56520.1"
                     /translation="MSDNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDDT
                     DENGVCTATEDYKDVVAVADQIGIPYYSVNFEKEYWDRVFEYXXAEYRAGRTPNPDVM
                     CNKEIKFKAFLDYAMTLGADYVATGHYARVARDEDGTVHMLRGVDNGKDQTYFLSQLS
                     QEQLQKTMFPLGHLEKPEVRKLAEEAGLSTAKKKDSTGICFIGEKNFKNFLSNYLPAQ
                     PGRMMTVDGRDMGEHAGLMYYTIGQRGGLGIGGQHGGDNAPWFVVGKDLSKNILYVGQ
                     GFYHDSLMSTSLEASQVHFTREMPEEFTLECTAKFRYRQPDSKVTVHVKGDKAEVIFA
                     EPQRAITPGQAVVFYDGEECLGGGLIDNAYRDGQVCQYI"
     gene            127155..127610
                     /locus_tag="SPG_0124"
     CDS             127155..127610
                     /locus_tag="SPG_0124"
                     /note="identified by match to protein family HMM PF00293"
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase, NUDIX family"
                     /protein_id="ACF54834.1"
                     /translation="MTQQDFRTKVDNTVFGVRATALILQNRKLLVTKDKGKYYIIGGA
                     IQVNEKTEDAVVREVKEELGIKAQAGQLAFVVENRFEQDGVSYHNIEFHYLVDLLEDA
                     PLTMQEDEKRQPCEWIDLDKLQNIQLVPAFLKTALPDWEGQLRHIHLEE"
     gene            127620..129533
                     /gene="gidA"
                     /locus_tag="SPG_0125"
     CDS             127620..129533
                     /gene="gidA"
                     /locus_tag="SPG_0125"
                     /note="identified by match to protein family HMM PF01134;
                     match to protein family HMM TIGR00136"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA uridine 5-carboxymethylaminomethyl
                     modification enzyme GidA (glucose-inhibited division
                     protein A)"
                     /protein_id="ACF55229.1"
                     /translation="MTYHFTEEYDIIVIGAGHAGVEASLAASRMGCKVLLATINIEML
                     AFMPCNPSIGGSAKGIVVREVDALGGEMAKTIDKTYIQMKMLNTGKGPAVRALRAQAD
                     KELYSKEMRKTVENQENLTLRQTMIDEILVEDGKVVGVRTATHQEYAAKAVIVTTGTA
                     LRGEIIIGDLKYSSGPNHSLASINLADNLKELGLEIGRFKTGTPPRVKASSINYDVTE
                     IQPGDEAPNHFSYTSRDEDYVKDQVPCWLTYTNGTSHEIIQNNLHRAPMFTGVVKGVG
                     PRYCPSIEDKIVRFADKERHQLFLEPEGRNTEEVYVQGLSTSLPEDVQRDLVHSIKGL
                     ENAEMMRTGYAIEYDMVLPHQLRATLETKKISGLFTAGQTNGTSGYEEAAGQGIIAGI
                     NAALKIQGKPELILKRSDGYIGVMIDDLVTKGTIEPYRLLTSRAEYRLILRHDNADMR
                     LTEMGREIGLVDDERWARFEIKKNQFDNEMKRLDSIKLKPVKETNAKVEEMGFKPLTD
                     AVTAKEFLRRPEVSYQDVVAFIGPAAEDLDDKIIELIETEIKYEGYISKAMDQVAKMK
                     RMEEKRIPANIDWDDIDSIATEARQKFKLINPETIGQASRISGVNPADISILMVYLEG
                     KNRSISKTLQKSK"
     gene            complement(129728..131407)
                     /locus_tag="SPG_0126"
     CDS             complement(129728..131407)
                     /locus_tag="SPG_0126"
                     /note="identified by match to protein family HMM PF00753;
                     match to protein family HMM PF07521; match to protein
                     family HMM TIGR00649"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF56309.1"
                     /translation="MAYTLKPEEVGVFAIGGLGEIGKNTYGIEYQDEIIIVDAGIKFP
                     EDDLLGIDYVIPDYSYIVDNIDRVKAVLITHGHEDHIGGIPFLLKQANVPIYAGPLAL
                     ALIRGKLEEHGLLRNAKLYEINHNTELTFKNLKATFFRTTHSIPEPLGIVIHTPQGKI
                     VCTGDFKFDFTPVGEPADLHRMAALGEEGVLCLLSDSTNAEVPTFTNSEKVVGQSIMK
                     IIQGIEGRIIFASFASNIFRLQQATEAAVKTGRKIAVFGRSMEKAIVNGIDLGYIKAP
                     KGTFIEPNEIKDYPAGEVLILCTGSQGEPMAALSRIANGTHRQVQLQPGDTVIFSSSP
                     IPGNTTSVNKLINIISEAGVEVIHGKVNNIHTSGHGGQQEQKLMLRLIKPKYFMPVHG
                     EYRMQKVHAGLAVDTGVEKDNIFIMSNGDVLALTADSARIAGHFNAQDIYVDGNRIGE
                     IGAAVLKDRRDLSEDGVVLAVATVDFKSQMILSGPDILSRGFVYMRESGDLIRQSQRI
                     LFNAIRIALKNKDASVQSVNGAIVNAIRPFLYENTEREPIIIPMILTPDEE"
     gene            complement(131409..131642)
                     /locus_tag="SPG_0127"
     CDS             complement(131409..131642)
                     /locus_tag="SPG_0127"
                     /note="identified by match to protein family HMM PF07288"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved domain protein"
                     /protein_id="ACF56752.1"
                     /translation="MIYKVFYQETKERSPRRETTRALYLDIDASSELEGRITARQLVE
                     ENRPEYNIEYIELLSDKLLDYEKETGAFEITEF"
     gene            complement(132460..132612)
                     /gene="cibB"
                     /locus_tag="SPG_0128"
     CDS             complement(132460..132612)
                     /gene="cibB"
                     /locus_tag="SPG_0128"
                     /note="identified by match to protein family HMM
                     TIGR01847"
                     /codon_start=1
                     /transl_table=11
                     /product="competence induced bacteriocin B"
                     /protein_id="ACF55072.1"
                     /translation="MMKDLNNYREISNKELQEIKGGFGVGVGIALFMAGYTIGKDLRK
                     KFGKSC"
     gene            complement(132614..132799)
                     /gene="cibA"
                     /locus_tag="SPG_0129"
     CDS             complement(132614..132799)
                     /gene="cibA"
                     /locus_tag="SPG_0129"
                     /note="Guiral PNAS 2005. 102(24):8710-8715"
                     /codon_start=1
                     /transl_table=11
                     /product="competence induced bacteriocin A CibA"
                     /protein_id="ACF55565.1"
                     /translation="MTNFDILDNQFLSLSENELSDIDGGLAPLVIFGVAVSWKAIAGG
                     TALIGSGLAAGYFLGGD"
     gene            132977..133660
                     /locus_tag="SPG_0130"
     CDS             132977..133660
                     /locus_tag="SPG_0130"
                     /note="identified by match to protein family HMM PF00814"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF55380.1"
                     /translation="MKVLAFDTSSKALSLAILEDKQVLAETTINIKKNHSITLMPAID
                     FLMASLDWTPKDLDRIVVAEGPGSYTGLRIAVATAKTLAYTLNIELVGMSSLLALVPH
                     QQEGLFVPLMDARRNNVYAGFYENAKPVMAEAHLSFEEVLEKVKGTSQVTFVGEVAPF
                     VEQIQEYLPRTNFKETLPNAANLALLAWDKEADSLHDFVPNYLKRVEAEENWLKNHTE
                     SGESYIKRL"
     gene            133657..134094
                     /locus_tag="SPG_0131"
     CDS             133657..134094
                     /locus_tag="SPG_0131"
                     /note="identified by match to protein family HMM PF00583;
                     match to protein family HMM TIGR01575"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal-protein-alanine acetyltransferase"
                     /protein_id="ACF55835.1"
                     /translation="MIEIKRIQQRPDLAQAIYAVMVAVYPVSPWTLEQIQADLSQDQT
                     WYVLAYDGAEVIGFLAVQENLFEAEVLQIAVKEAYQGQGIASALFAQLPTDKEIFLEV
                     RQSNHRAQAFYKKEKMAVIADRKAYYHDPVEDAIIMKREIDEG"
     gene            134084..135094
                     /locus_tag="SPG_0132"
     CDS             134084..135094
                     /locus_tag="SPG_0132"
                     /note="identified by match to protein family HMM PF00814;
                     match to protein family HMM TIGR00329"
                     /codon_start=1
                     /transl_table=11
                     /product="glycoprotease family protein"
                     /protein_id="ACF56308.1"
                     /translation="MKDRYILAFETSCDETSVAVLKNDDELLSNVIASQIESHKRFGG
                     VVPEVASRHHVEVITACIEEALAEAGITEEDVTAVAVTYGPGLVGALLVGLSAAKAFA
                     WAHGLPLIPVNHMAGHLMAAQSVEPLEFPLLALLVSGGHTELVYVSEAGDYKIVGETR
                     DDAVGEAYDKVGRVMGLTYPAGREIDELVHQGQDIYDFPRAMIKEDNLEFSFSGLKSA
                     FINLHHNAEQKGESLSTEDLCASFQAAVMDILMAKTKKALEKYPVKTLVVAGGVAANK
                     GLRERLAAEITDVKVIIPPLRLCGDNAGMIAYASVSEWNKENFAGWDLNAKPSLAFDT
                     ME"
     gene            complement(135134..135448)
                     /locus_tag="SPG_0133"
     CDS             complement(135134..135448)
                     /locus_tag="SPG_0133"
                     /codon_start=1
                     /transl_table=11
                     /product="IS1167 transposase"
                     /protein_id="ACF54896.1"
                     /translation="MHLTHREVRDKLLSYSEGLQIHYELYQLLLFHFQEKNANHFYRD
                     KIINALKLPYSNAKLEATNNFIKVIKRKAFGFRNFNNFKKRILMTLNIKKESTNFVLS
                     RL"
     gene            complement(135439..136416)
                     /locus_tag="SPG_0134"
     CDS             complement(135439..136416)
                     /locus_tag="SPG_0134"
                     /note="identified by match to protein family HMM PF01610"
                     /codon_start=1
                     /transl_table=11
                     /product="IS1167 transposase"
                     /protein_id="ACF55474.1"
                     /translation="MTYNEKRLTNSLERGHMEQLKNTTDLLGLEDKNIKILSVLKYQT
                     HLVVQAKLDSPAPPCPHCQGKMIKYDFQKASKIPLLDCQGLPTVLHLKKRRFQCKNCL
                     KVVVSQTSIVKKNCQISNMVRQKIAQLLLEKQSMTEIAHRLAVSTSTVIRKLREFKFE
                     TDWTKLPKVMSWDEYSFKKSKMSFIAQDFESKSILAILDGRTHAVIRNHFQRYQREVR
                     ELVEVITMDMYSPYYRLAKQLFPKAKIVLDRLHIVQHLSRAMNRVRIQIMNQFDRKSL
                     EYRALKRFWNPRFFVSRLGLNQSTGLIYYTRIASSSVRNDSISPRFECT"
     gene            137637..138191
                     /locus_tag="SPG_0135"
     CDS             137637..138191
                     /locus_tag="SPG_0135"
                     /note="contains potential frameshift"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase, group 1 family protein"
                     /protein_id="ACF56649.1"
                     /translation="MQYSCGKININIPDGYGDIKDIVFSAHIIVRYNNGHCGGIDPHI
                     IGLCKKQIRRMSLYPILIIVSRDSKVIDDYKNLDIAYVDCTQCSNNFETALHVKNILK
                     LLKIQLIHCHGYSTNYFLYMLKKLDKNGFGKVKTVITCHGWVEYNLKKKFLTYFDFWT
                     YSMGDAFICVSETMKKKIGEYNKK"
     gene            138169..138843
                     /locus_tag="SPG_0136"
     CDS             138169..138843
                     /locus_tag="SPG_0136"
                     /note="contains potential frameshift; identified by match
                     to protein family HMM PF00534"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase, group 1 family protein"
                     /protein_id="ACF56641.1"
                     /translation="MESIIKNKKIVAINNGINVSNSDLDVVGVQDFKKEFCIPNNKKI
                     ICYVGRLDPEKRPDRFLEFAEKLFLVREDVIFIMAGNGSMWAALKEKICHLKCRNNFR
                     LLGEIYPATIVYQISDLLYIPSDTEGIPMCVLESMSQGTPVLASNVGGLSEIIEHRVD
                     GFLFEKEDVEGVCACANFLLNDSEYLKYIGENSKSKIRKHFSVQKMFVETMRVYDELL
                     EKSSHG"
     gene            138836..139708
                     /locus_tag="SPG_0137"
     CDS             138836..139708
                     /locus_tag="SPG_0137"
                     /EC_number="2.4.1.-"
                     /note="identified by match to protein family HMM PF00535"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase, group 2 family protein"
                     /protein_id="ACF55232.1"
                     /translation="MDRNIDQELVSIIIPTHNRYESLIRAVKSCLHQSYKNIEVIIID
                     DNYSNVNLRNKIIHQFGYTNHRIKLILSNEDLGATNARNIGIKNSRGKYISFLDDDDE
                     YMPDRILKLMACFKKSRMKNLALVYSYGIIIYPNGTREEEKTDFVGNPLFVQMVHNIA
                     GTSFWLCKKEVLELINGFEKIDSHQDGVVLLKLLAQGYQIDIVREFLVNYYAHSKENG
                     ITGVTQKTINADEEYYNYCRKYFNLLSFNERILVTKKYYSLNIKRLLLIGDKCKALKV
                     IKKAREEKIFNEFF"
     gene            139795..141411
                     /locus_tag="SPG_0138"
     CDS             139795..141411
                     /locus_tag="SPG_0138"
                     /note="identified by match to protein family HMM PF00005"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, ATP-binding protein"
                     /protein_id="ACF55743.1"
                     /translation="MYTIIKSNIKKFSLLTIFIVAGQLLLIYAATINALVLNELIAMN
                     LERFLKLSIYQMIVWCGIIFLDWVVKNYQVEVIQEFNLEIRNRVATDISNSTYQEFHS
                     KSSGTYLSWLNNDVQTLNDQAFKQLFLVIKGISGTIFAVVTLNHYHWSLTVATLFSLM
                     IMLLVPKIFASKMREVSLNLTNQNEAFLKSSETILNGFDVLASLNLLYVLPKKIKEAG
                     ILLKMVIQRKTTVETLAGAISFFLNIFFQISLVFLTGYLAIKGIVKIGTIEAIGALTG
                     VIFTALGELGGQLSSIIGTKPIFLKLYSINPIESNKMNDIEPNEVNRDFPLYEAKNIC
                     YKYGDKEILKNLNFCFQRNEKYLILGESGSGKSTLLKLLNGFLRDYSGELRFCGDDIK
                     KTSYLNMVSNVLYVDQKAYLFEGTIRDNILLEENYTDEEILQSLEQVGLSVKDFPNNI
                     LDYYVGDDGRLLSGGQKQKITLARGLIRNKKIVLIDEGTSAIDRRTSLAIERKILDRE
                     DLTVIIVTHAPHPELKQYFTKIYQFPKDFI"
     gene            142065..142847
                     /locus_tag="SPG_0139"
     CDS             142065..142847
                     /locus_tag="SPG_0139"
                     /note="identified by match to protein family HMM PF01609"
                     /codon_start=1
                     /transl_table=11
                     /product="IS1380-Spn1, transposase"
                     /protein_id="ACF55959.1"
                     /translation="MNSLPNHHFQNKSFYQLSFDGGHLTQYGGLIFFQELFSQLKLKE
                     RISKYLVTNDQRRYCRYSDSDILVQFLFQLLTGYGTDYACKELSADAYFPKLLEGGQL
                     ASQPTLSRFLSRTDKETVHSLRCLNLELVEFFLQFHQLNQLIVDIDSTHFTTYGKQEG
                     VAYNAHYRAHGYHPLYAFEGKTGYCFNAQLRPGNRYCSEEADSFITPVLERFNQLLFR
                     MDSGFATPKLYDLIEKTGQCYLIKLKKNLFERCGGLSSLPTG"
     gene            142992..143402
                     /locus_tag="SPG_0140"
     CDS             142992..143402
                     /locus_tag="SPG_0140"
                     /codon_start=1
                     /transl_table=11
                     /product="IS1380-Spn1, transposase"
                     /protein_id="ACF55911.1"
                     /translation="MEQSQDQFQLYRGRGQAENFIKEMKEGFFGDKTDSSTLIKNEVR
                     MMMSCIAYNLYLFLKHLAGGDFQTLTIKRFRHLFLHVVGKCVRTGRKQLLKLSSLYAY
                     SELFSALYSRIRKVNLNLPVPYEPPRRKASLMMH"
     gene            143809..144558
                     /locus_tag="SPG_0141"
     CDS             143809..144558
                     /locus_tag="SPG_0141"
                     /note="identified by match to protein family HMM PF02585"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF56400.1"
                     /translation="MSNNTKYIFLSPHLDDAIFSCGDYISKLTSEGEIVLVITIFSGY
                     PLSQQLQSSAKQFHKLCNLGKYPIEERKKEDRLACERLQCDFRHLSYYECLYRKDRNG
                     NFLYRHIYSELKNEDTLKNDIIKELLMHLDDKCVVYCPLSLGDHVDHVFVNSIGRALE
                     FMRYKVIYYEDFPYVSDSSMVSYMGKTKELKIYQEELDKKHYIDRISSILCYKSQILI
                     IWKSVEKLLNNIKELYLRNGAAYSIIFWIKK"
     gene            144571..145743
                     /locus_tag="SPG_0142"
     CDS             144571..145743
                     /locus_tag="SPG_0142"
                     /EC_number="1.1.1.22"
                     /note="identified by match to protein family HMM PF00984;
                     match to protein family HMM PF03721; match to protein
                     family HMM TIGR03026"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-glucose 6-dehydrogenase, putative"
                     /protein_id="ACF55640.1"
                     /translation="MNIAVIGLGHVGLAYALLFAXKYKVVAYDIDSVKINNLKKGILP
                     SKNEELMKFFCENNLNITFFDTFSEIKNNIDYYIIALPTDYDEKIGSFNTYEIEQTVS
                     KILRVKPNGKIILKSTVPIGFSNKLKRLFDTKNIIFVPEFLREGCSIYDNLYPSRIVV
                     GDETVEGRKIAELFLSISTXSTANIKNVMLVSPTEAEAIKLFSNTFLALRVAFFNELD
                     SFAERRSLNAEVVIKGVCLDPRIGNFYNNPSFGFGGYCLPKDTKQLKKEFIEINAPVI
                     EAIDISNTNRKQFIVKQILERKPKIVGIYKLGMKYNSDNYKESAILSIINELLIVGIK
                     ILVYEPNLNVSIDNVIFEKNFELFTKQSDLIVANRWDRGLEAYKDKVYTRGIWIRD"
     gene            146138..147001
                     /locus_tag="SPG_0143"
     CDS             146138..147001
                     /locus_tag="SPG_0143"
                     /note="identified by match to protein family HMM
                     TIGR01716"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="ACF56594.1"
                     /translation="MIEKMELGEFYKELRLARKLKQTDVACEGLTASQLSKFELGQSM
                     LSADKLILAIQGINVTFDEFGHKLNNYQESPHMRIGRKVVNRFAHQDIAALEQLLEEV
                     DQEQMAQTYRRLNAIVIKDAIHSLNKSYPLAEEDSEFLTTYLYAIESWTWFELYLFCN
                     TMPFLSNQDLIFLSTSLLEKSKEFKELVYXRLYMKQGLLNILSELMERKLFSYIPIFE
                     AELERMLRPYDVFEKVSWQFLKKMSVFLQTKGSNQKEIERFIQSLQVLENPQLTSLFE
                     LRFQQYKELID"
     gene            147292..147525
                     /locus_tag="SPG_0144"
     CDS             147292..147525
                     /locus_tag="SPG_0144"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF54818.1"
                     /translation="MLNLQFAETMELTEAELQDVRGGNLVNSMGGGGRSGISGWGVPG
                     IYPGWGNQGMSPNRGAFDWTIDLADGLFGRRRR"
     gene            147547..148224
                     /locus_tag="SPG_0145"
     CDS             147547..148224
                     /locus_tag="SPG_0145"
                     /note="identified by match to protein family HMM PF02517"
                     /codon_start=1
                     /transl_table=11
                     /product="CAAX amino terminal protease family"
                     /protein_id="ACF55395.1"
                     /translation="MKKMKEVKFHLATGLLILTYYLIFNVTSDLDFMVALSDNMYYVF
                     QVLLVLILGTIATIAFVKSEHWKECGRFQFRWFYLGVFLLSFFLLFVWANLTTYIFPR
                     TQNGSTVVEVATNLTGISYFVTRILYTSIIAPVSEEVVCRGLLMTSLSKVKRYYLDVL
                     VSAAIFGAMHVLQYGWITTDFIKYFGMGLIFCMMFRYTRSIYWAIALHASWNSFLLIV
                     TLLVFGY"
     gene            148236..148901
                     /locus_tag="SPG_0146"
     CDS             148236..148901
                     /locus_tag="SPG_0146"
                     /note="identified by match to protein family HMM PF02517"
                     /codon_start=1
                     /transl_table=11
                     /product="CAAX amino terminal protease family"
                     /protein_id="ACF55849.1"
                     /translation="MKKIISHRYFIIVFLLVIADQKFSVLVLRSDLVTGLSDFAYYLS
                     DMMLNFLVVLFALIAMIWSGKWQKINSRKFKGSYLFYSFLALLAFVVWNFVTFFLFPP
                     TRNEISYQYAAPTFTGATAFLMYFFYPVIAGPIFEEIIHRGLVMTVLEKGKKWGLDVL
                     GSAVLFGVSHISNHGWVLTDFVFYMGGGLIFAVLFRMTKSIYWPIGLHIVYNGIGQLL
                     MLL"
     gene            148973..150199
                     /locus_tag="SPG_0147"
     CDS             148973..150199
                     /locus_tag="SPG_0147"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF56555.1"
                     /translation="MKVFLQNRDFRQLTINQWISTLGDTIFYLAFLNYVADASFAPLA
                     ILLITISETLPQVLQIFLGVLADFQHHRVLKYTVISFAKFLLYSIVSLSLSGQSFSLL
                     LVAFICLINLLSDTLSYFSGAMLTPIFIRIIGQDHLAEAIGFKQSTVSLVKTISNILG
                     GVLLGILSIQFISLLNALTFLIAFLGILFIKTDLLKVEKTINYQEGLSVKSFCQHLLQ
                     SSKLIWNMNKVLLVLFIISTSQAVINVTVPVSTLFLRNQPFLNLQTGQSLALLSTFEL
                     SALIVGSLVSGYLQHTISIKTALYASLVIQLLLLVGFATVRFDWILIFSTLDAFFAGV
                     LSPRLQELVFKQIPXESMGAVQSSISAXTVVLPSLFTISLVTIATSFGTLAVSFVLLL
                     FXLVAFVMLLNIRESI"
     gene            150449..151117
                     /locus_tag="SPG_0148"
     CDS             150449..151117
                     /locus_tag="SPG_0148"
                     /note="identified by match to protein family HMM PF03591"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF55179.1"
                     /translation="MQAVMPTALGYVSIGLACGIIGAPYVTPVEMGLMSLFVYAGSAQ
                     FAMLALIVVQAPVAAIAMTVFLINLRLFLLSLHASTYFRHTSLWYNIGMSSILTDETY
                     GVLMGELAHTDKVNPMWMHGNNLNSYVAWFVGTVVGTALGGLLPNPEIFGLDFALVGM
                     FIGIFASQFQIMQRRIPVRNLLIILAVVAVSFFLLLTVVSQSLAVLFATLLGCSMGVV
                     LDGQ"
     gene            151107..151430
                     /locus_tag="SPG_0149"
     CDS             151107..151430
                     /locus_tag="SPG_0149"
                     /note="identified by match to protein family HMM PF05437"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF55323.1"
                     /translation="MVSKYLLLAVIFSGLVTWILRMIPFILVKYKGLPAIVERFLKFL
                     PVSIIFALILSSVVTGKVGSLPQIKWLDFLAVFPTAWVAFRYRNLVGTVLFGVVLIAI
                     LRLVF"
     gene            151534..152364
                     /locus_tag="SPG_0150"
     CDS             151534..152364
                     /locus_tag="SPG_0150"
                     /note="identified by match to protein family HMM PF00497"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein/
                     substrate-binding protein"
                     /protein_id="ACF56116.1"
                     /translation="MKKIVKYSSLAALGLVAAGLLAACSGGAKKEGEAASKKEIIVAT
                     NGSPRPFIYEENGELTGYEIEVVRAIFKDSDKYDVXFEKTEWSGVFAGLDADRYNMAV
                     NNLSYTKERAEKYLYAAPIAQNPNVLVVKKDDSSIKSLDDIGGKSTEVVQATTSAKQL
                     EAYNAEHTDNPTILNYTKADFQQIMVRLSDGQFDYKIFDKIGVETVIKNQGLDNLKVI
                     ELPSDQQPYVYPLLAQGQDELKSFVDKRIKELYKDGTLEKLSKQFFGDTYLPAEADIK
                     "
     gene            152518..153372
                     /locus_tag="SPG_0151"
     CDS             152518..153372
                     /locus_tag="SPG_0151"
                     /note="identified by match to protein family HMM PF03180"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate binding protein"
                     /protein_id="ACF56792.1"
                     /translation="MKIKKWLGLXALATVAGLALAACGNSEKKADNATTIKIATVNRS
                     GSEEKRWDKIQELVKKDGITLEFTEFTDYSQPNKATADGEVNLNAFQHYNFLNNWNKE
                     NGKDLVAIGDTYISPIRLYSGLNGSANKYTKVEDIPANGEIAVPNDATNESRALYLLQ
                     SAGLIKLDVSGTALATVANIKENPKNLKITELDASQTARSLSSVDAAVVNNTFVTEAK
                     LDYKKALFKEQADENSKQWYNIIVAKKDWETSPKADAIKKVIAAYHTDDVKKVIEETS
                     DGLDQPVW"
     gene            153472..154845
                     /locus_tag="SPG_0152"
     CDS             153472..154845
                     /locus_tag="SPG_0152"
                     /note="identified by match to protein family HMM PF01546;
                     match to protein family HMM PF07687"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase, M20/M25/M40 family"
                     /protein_id="ACF56525.1"
                     /translation="MVFPSEQEQIEKFEKDHVAQHYFEVLRTLISKKSVFAQQVGLKE
                     VANYLGEIFKRVGAEVEIDESYTAPFVMAHFKSSRPDAKTLIFYNHYDTVPADGDQVW
                     TEDPFTLSVRNGFMYGRGVDDDKGHITARLSALRKYMQHHDDLPVNISFIMEGAEESA
                     STDLDKYLEKHADKLRGADLLVWEQGTKNALEQLEISGGNKGIVTFDAKVKSADVDIH
                     SSYGGVVESAPWYLLQALQSLRAADGRILVEGLYEEVQEPNEREMALLETYGQRNPEE
                     VSRIYGLELPLLQEERMAFLKRFFFDPALNIEGIQSGYQGQGVKTILPAEASAKLEVR
                     LVPGLEPHDVLEKIRKQLDKNGFDKVELYYTLGEMSYRSDMSAPAILNVIELAKKXYP
                     QGVSVLPTTAGTGPMHTVFDALEVPMVAFGXGNANSRDHGGDENVRIADYYTHIELVE
                     ELIRSYE"
     gene            154838..155899
                     /locus_tag="SPG_0153"
     CDS             154838..155899
                     /locus_tag="SPG_0153"
                     /note="identified by match to protein family HMM PF00005"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, ATP-binding protein"
                     /protein_id="ACF55758.1"
                     /translation="MSRDIIKLDQIDVTFHQKKRTITAVKDVTIHIQEGDIYGIVGYS
                     GAGKSTLVRVINLLQKPSAGKITIDDDVIFDGKVTLTAEQLRRKRQDIGMIFQHFNLM
                     SQKTAEENVAFALKHSELSKEEKKAKVAKLLDLVGLADRAENYPSQLSGGQKQRVAIA
                     RALANDPKILISDESTSALDPKTTKQILALLQDLNQKLGLTVVLITHEMQIVKDIANR
                     VAVMQDGHLIEEGSVLEIFSDPKQPLTQDFISTATGIDEAMVKIEKQEIVEHLSENSL
                     LVQLKYAGSSTDEPLLNELYKHYQVTANILYGNIEILDGTPVGELVVVLSGEKAALAG
                     AQEAIRQAGVQLKVLKGGQ"
     gene            155901..156593
                     /locus_tag="SPG_0154"
     CDS             155901..156593
                     /locus_tag="SPG_0154"
                     /note="identified by match to protein family HMM PF00528"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, permease component"
                     /protein_id="ACF56465.1"
                     /translation="MESLIQTYLPNVYKMGWAGQAGWGTAIYLTLYMTVLSFIIGGFL
                     GLVAGLFLVLTAPGGVLENKVVFWILDKITSIFRAVPFIILLAILSPLSHLIVKTSIG
                     PNAALVPLSFAVFAFFARQVQVVLAELDGGVIEAAQASGATFWDIVGVYLSEGLPDLI
                     RVTTVTLISLVGETAMAGAVGAGGIGNVAIAYGFNRYNHDVTILATIIIILIIFAIQF
                     LGDFLTKKLSHK"
     gene            complement(156623..157192)
                     /locus_tag="SPG_0155"
     CDS             complement(156623..157192)
                     /locus_tag="SPG_0155"
                     /note="identified by match to protein family HMM
                     TIGR02185"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF54803.1"
                     /translation="MKKSILTTLLFAVLYFLCMGIGVLLGNLFDQTGNMFYAPAFTAL
                     VGGSVYMILVAKVPRFGAITTIGLVIALFFLGTKHGAGSFLPGIICGLLADGVAHLGK
                     YKDKTKNFLSFIIFAFSTTGPILLMWIAPKAYMATLLARGKSQEYIDRIMVAPNPGTV
                     LLFIASIVIGALVGALIGQALSKKFAQKI"
     gene            157327..157941
                     /locus_tag="SPG_0156"
     CDS             157327..157941
                     /locus_tag="SPG_0156"
                     /note="identified by match to protein family HMM PF04854"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF56118.1"
                     /translation="MGRFLDFVFNRFFLGMIATAFFWLLTLAGGIILGLAPASATLMS
                     LYAEHGYSFREYSLKEAWSLYKQNFISSNLIFYSFLGVGLVLTYGLYLLVQLPHQTIV
                     HLIATLLNVLVVALIFLAYTVSLKLQVYFALSYRNSLKLSLIGIFMSLAAVAKVLLGT
                     VLLVAIGYYMPALLFFVGIGMWHFFISDMLEPVYEIIHEKLATK"
     gene            157991..159589
                     /locus_tag="SPG_0157"
     CDS             157991..159589
                     /locus_tag="SPG_0157"
                     /note="identified by match to protein family HMM PF00672;
                     match to protein family HMM PF02518; match to protein
                     family HMM PF06580"
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase TCS07"
                     /protein_id="ACF55766.1"
                     /translation="MIIIIASFAILLSYADWDSREKEAQRVAQRVTARTVSEIEYYHR
                     ESTQIAQALVENQARIEGIYKYFSLSMPDYFYWQLERKASPYISVSLYENVDDLYVRN
                     DFVTGVAIAFQDYKEVYVSTKDKRSGEKIRAEDFKPAGNSFAIPVSDPVSDQDLGVIY
                     ISLDPAVLYHAIDNTRGHTPMAVTVTSPFDTEIFHIGETVDKESENWLVGLTSHGYQV
                     QVAVPKNFVLQGTVTSSALIVGLSLLFIVILYLTLRQTFANYQKQVVDLVESIQVIAQ
                     GEXGRRIDISEKDQELLLIAETTNDMLDRLEKNIHDIYQLELSQKDANMRALQAQINP
                     HFMYNTLEFLRMYAVMQSQDELADIIYEFSSLLRNNISDERETLLKQELEFCRKYSYL
                     CMVRYPKSIAYGFKIDPELENMKIPKFTLQPLVENYFAHGVDHRRTDNVISIKALKQD
                     GFVEILVVDNGRGMSAEKLANIREKLSQRYFEHQASYSDQRQSIGIVNVHERFVLYFG
                     DRYAITIESAEQAGVQYRITIQDE"
     gene            159601..160887
                     /locus_tag="SPG_0158"
     CDS             159601..160887
                     /locus_tag="SPG_0158"
                     /note="identified by match to protein family HMM PF00072;
                     match to protein family HMM PF00165"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator TCS07"
                     /protein_id="ACF55548.1"
                     /translation="MYKVLLVDDEYMVTEGLKRLIPFDKWDMEVVATAGHADEALEYV
                     QENPVDVIISDVNMPDKTGLDMIREMKEILPDAAYILLSGYQEFDYVKRAMNLSVVDY
                     LVKPVDKVELGNLLEKIAGQLGERGKKSQTLSQELDEAGFVSYLGDKENWWIGLSKEK
                     QGSFTIPYYVLGQDWQIFISGQPLDGLVVTPFEAPYQEHFERWKLNAEKTLFYGSVNL
                     QQSESLFAYYEPIYRVIIQGNLNQIVEELNLLEKVVLENTPRVPITKQLFIQFVMDVF
                     HLFEHLKADDLTDIVKTIHAIQSFDELVPYIKETLTSFFGQYRMNENVASVLEVIGRD
                     YQKELSLKDISKALFINPVYLGQLIKRETDSTFAELLNKQRIKAAQQLLLSTSDSIED
                     ICYAVGYSNLGYFYKVFRKLCGKSPKAYRKQVETIL"
     gene            160939..161472
                     /locus_tag="SPG_0159"
     CDS             160939..161472
                     /locus_tag="SPG_0159"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF54949.1"
                     /translation="MKKKPIYLWVLLILSALISVPSLFGIVSPLPSKEALRAAQKQVA
                     GVNAQQLEDQLNYTYRVAEASHSIFNVALIVLSTILVVVAIVFLVRKNLQYANYTYVG
                     YVLLAIIGSIYGYVGLQDAVQLVQDESMRLTVSIGSKAVSIFYIVINVLFLALVFYKM
                     WRQQKALAEEEETEELA"
     gene            161550..162020
                     /locus_tag="SPG_0160"
     CDS             161550..162020
                     /locus_tag="SPG_0160"
                     /note="identified by match to protein family HMM PF07972"
                     /codon_start=1
                     /transl_table=11
                     /product="nrdI protein, putative"
                     /protein_id="ACF55839.1"
                     /translation="MKTISLVYISLSGNTESFVTRLKDYLLSQYKGIEVQKIHIKDLV
                     KEGKNFYEMDHPYVAFLPTYLEGGNGVDNGDVEILTTPVGDFIAYGNNASKCFGVVGS
                     GNRNFNNQYCLTAKQYSQRFGFPVLADFEMRGMLEDIKHVAAIIADLYELEKEN"
     gene            complement(162313..163575)
                     /locus_tag="SPG_0161"
     CDS             complement(162313..163575)
                     /locus_tag="SPG_0161"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF55509.1"
                     /translation="MSQAISLNQSTWASKLKAMGPGILMATAAVGGSHIVSSTQAGGS
                     YGWSLLLLVILANVFKYPFFRFGAEYTADTGKTLVEGYAEKGKLYLWIFFILNVFSAM
                     VNTAGVAILCSAIIASAFPMIGLSITQWSLILVAIIWAMLLFGGYKLLDGMVKWIMSA
                     LTIATVLAVIIAAVKHPEYSSDFVEKTPWQMAALPFIVSLLGWMPAPIEISAINSLWS
                     AEKRKTVNFNTXXALFDFNTGYIGTAILAVFFVALGALIQYPTGQAVEAASAKYISQF
                     VGMYASVLGEWSRYLITFIAFLCIFGTVITVIDGYSRVNQESLRLLISQKEDNRXSLN
                     IWMTITAIIGIVIIKFFAGQVSTMLRFAMIGSFLTTPFFALLNYALVTRENKNLPSWL
                     KHLAIAGLIFLFGFAIFFIYALAIGKAG"
     gene            complement(163885..164343)
                     /locus_tag="SPG_0162"
     CDS             complement(163885..164343)
                     /locus_tag="SPG_0162"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF55276.1"
                     /translation="MKKQVFHDAAAGVLIGLILSILFSLIYAPNTYAPLNPYSLIGQV
                     MDQHQVHGALVLLYCTLIWAAIGMLFNFGNRLFSRDWSMLRATLTHFFLMLAGFVPLA
                     TLAGWFPFHWIFYLQLIIEFAIVYLIIWAILYKREAKKVDHINQLLEHRK"
     gene            complement(164340..164780)
                     /locus_tag="SPG_0163"
     CDS             complement(164340..164780)
                     /locus_tag="SPG_0163"
                     /note="identified by match to protein family HMM PF04397"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF55172.1"
                     /translation="MKVELQISETYEEEKLIVQAPQETEXVQKVIEFAENLDQREKIK
                     GKIDDQVYLVEIGKIQRFYIENRKVLAETASQTYSIDLRLYQVLKLLPSNFIQISQSE
                     IINIDSISHLKLTPNGLVEIFLKNESFTYSSRRYLKTIKEKLEL"
     gene            164896..165075
                     /locus_tag="SPG_0164"
     CDS             164896..165075
                     /locus_tag="SPG_0164"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF56704.1"
                     /translation="MTLSVLSTTSKQCFELSAPSFLVCSLIFIEYTTILLPLARDFVY
                     VEGLGSYVVELFCSF"
     gene            165136..167085
                     /gene="hexB"
                     /locus_tag="SPG_0165"
     CDS             165136..167085
                     /gene="hexB"
                     /locus_tag="SPG_0165"
                     /note="identified by match to protein family HMM PF01119;
                     match to protein family HMM PF02518; match to protein
                     family HMM PF08676; match to protein family HMM TIGR00585"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein HexB"
                     /protein_id="ACF56135.1"
                     /translation="MSHIIELPEMLANQIAAGEVIERPASVVKELVENAIDAGSSQII
                     IEIEEAGLKKIQITDNGHGIAHDEVELALRRHATSKIKNQADLFRIRTLGFRGEALPS
                     IASVSVLTLLTAVDGASHGTKLVARGGEVEEVIPATSPVGTKVCVEDLFFNTPARLKY
                     MKSQQAELSHIIDIVNRLGLAHPEISFSLISDGKEMTRTAGTGQLRQAIAGIYGLVSA
                     KKMIEIENSDLDFEISGFVSLPELTRANRNYISLFINGRYIKNFLLNRAILDGFGSKL
                     MVGRFPLAVIHIHIDPYLADVNVHPTKQEVRISKEKELMALVSEAIANSLKEQTLIPD
                     ALENLAKSTVRNREKVEQTILPLKENTFYYEKTEPSRPSQTEVADYQVELTDEGQDLT
                     LFAKETLDRLTKPAKLHFAERKPANYDQLDHPELDLASIDKAYDKLEREEASSFPELE
                     FFGQMHGTYLFAQGRDGLYIIDQHAAQERVKYEEYRESIGNVDQSQQQLLVPYIFEFP
                     ADDALRLKERMPLLEEVGVFLAEYGENQFILREHPIWMAEEEIESGIYEMCDMLLLTK
                     EVSIKKYRAELAIMMSCKRSIKANHRIDDHSARQLLYQLSQCDNPYNCPHGRPVLVHF
                     TKSDMEKMFRRIQENHTSLRELGKY"
     gene            complement(167410..167877)
                     /locus_tag="SPG_0166"
     CDS             complement(167410..167877)
                     /locus_tag="SPG_0166"
                     /EC_number="2.5.1.9"
                     /note="identified by match to protein family HMM PF00885;
                     match to protein family HMM TIGR00114"
                     /codon_start=1
                     /transl_table=11
                     /product="6,7-dimethyl-8-ribityllumazine synthase"
                     /protein_id="ACF55535.1"
                     /translation="MNTYEGNLVANNIKIGIVVARFNEFITSKLLSGALDNLKRENVN
                     EKDIEVAWVPGAFEIPLIASKMAKSKKYDAIICLGAVIRGNTSHYDYVCSEVSKGIAQ
                     ISLNSEIPVMFGVLTTDTIEQAIERAGTKAGNKGSECAQGAIEMVNLIRTLDA"
     gene            complement(167878..169083)
                     /locus_tag="SPG_0167"
     CDS             complement(167878..169083)
                     /locus_tag="SPG_0167"
                     /EC_number="3.5.4.25"
                     /note="identified by match to protein family HMM PF00925;
                     match to protein family HMM PF00926; match to protein
                     family HMM TIGR00505; match to protein family HMM
                     TIGR00506"
                     /codon_start=1
                     /transl_table=11
                     /product="3,4-dihydroxy-2-butanone 4-phosphate
                     synthase/GTP cyclohydrolase II"
                     /protein_id="ACF54903.1"
                     /translation="MEYRKIQEALEALQKGRLVLVIDDKDRENEGDLICSAQAATTEN
                     VNFMATYAKGLICMPMSESLANQLMLSPMVENNTDNHKTAFTVSIDYKETTTGISAEE
                     RGLTARMCVAEDITPSDFRRPGHMFPLIAKKGGVLERNGHTEATVDLLKLAGLKECGL
                     CCEIMNHDGKMMRTDDLIQFSKKHNIPLITIKELQEYRKVYDQLVERVSTVNMPTRYG
                     NFKAISYIDKLNGEHHLALIMGNIEDEANVLCRVHSECLTGDVLGSLRCDCGQQFDKA
                     MKMIVENGSGVLLYLRQEGRGIGLINKLKAYHLQDQGMDTLDANLALGFEGDLREYHI
                     GAQMLKDLGLQSLHLLTNNPDKVEQLEKYGITISSRISIEIEANPYDSFYLETKKNRM
                     GHILNMEEK"
     gene            complement(169103..169738)
                     /locus_tag="SPG_0168"
     CDS             complement(169103..169738)
                     /locus_tag="SPG_0168"
                     /EC_number="2.5.1.9"
                     /note="identified by match to protein family HMM PF00677;
                     match to protein family HMM TIGR00187"
                     /codon_start=1
                     /transl_table=11
                     /product="riboflavin synthase, alpha subunit"
                     /protein_id="ACF56442.1"
                     /translation="MFTGIIEEIGKVERIQKDSRNCKLSIKASKILTDIHLGDSIAVN
                     GICLTVTHFNHQSFTVDVMNETWSRTALTLLKHGSEVNLERALSVNGRLGGHVVTGHI
                     DGTGKISSIKKDDNAVWYQINTQKEILDLIVEKGSITIDGISLTVAKVSKVNFSVSVI
                     PHTLEQTILKSKQVGSTVNLENDILGKYVQKLMDNSPKSEISKELLYQNGF"
     gene            complement(169723..170823)
                     /locus_tag="SPG_0169"
     CDS             complement(169723..170823)
                     /locus_tag="SPG_0169"
                     /EC_number="3.5.4.26"
                     /EC_number="1.1.1.193"
                     /note="identified by match to protein family HMM PF00383;
                     match to protein family HMM PF01872; match to protein
                     family HMM TIGR00227; match to protein family HMM
                     TIGR00326"
                     /codon_start=1
                     /transl_table=11
                     /product="riboflavin biosynthesis protein"
                     /protein_id="ACF55781.1"
                     /translation="MSDSKYMKLAIKLAQKGAGYVNPNPMVGAVIVKDNHIIGQGYHE
                     FFGGSHAERNALKNCRESPVGATLYVTLEPCCHFGKTPPCIDAIIDSGITRVVIGSLD
                     CNPIVSGKGVKILEENNLQVTVGILENECLNLIKSFRKYITQHVPYVFMKYAMSMDGK
                     IATKTNQSKWITEEEARKHVHQLRHHVSAIMVGVNTVIQDDPLLTCRLEEGKNPIRII
                     CDTHLRTPLTSKIVKTANDIKTYIATSSEDKNKMKLYQNHGCEILSIKKKGNHIDLSS
                     LMQHLGNMQIDSLVLEGGSLMNWSALEQQIVDELKIYIAPKIFGGSAKFPVGGEGISL
                     PNDAIRLKPYAFSQIGNDYLIESEVIYPCSQE"
     gene            171228..171821
                     /gene="ruvA"
                     /locus_tag="SPG_0170"
     CDS             171228..171821
                     /gene="ruvA"
                     /locus_tag="SPG_0170"
                     /EC_number="3.6.1.-"
                     /note="identified by match to protein family HMM PF01330;
                     match to protein family HMM PF07499; match to protein
                     family HMM TIGR00084"
                     /codon_start=1
                     /transl_table=11
                     /product="Holliday junction DNA helicase RuvA"
                     /protein_id="ACF55190.1"
                     /translation="MYAYLKGIITKITAKYIVLETNGIGYILHVANPYAYSGQVNQED
                     QIYVHQVVREDAHLLYGFRSEDEKKLFLSLISVSGIGPVSALAIIAADDNAGLVQAIE
                     TKNITYLTKFPKIGKKTAQQMVLDLEGKVVVAGDDLPAKVAVQASAENQELEEAMEAM
                     LALGYKATELKKIKKFFEGTTDTAENYIKSALKMLVK"
     gene            171831..172394
                     /gene="tag"
                     /locus_tag="SPG_0171"
     CDS             171831..172394
                     /gene="tag"
                     /locus_tag="SPG_0171"
                     /EC_number="3.2.2.20"
                     /note="identified by match to protein family HMM PF03352"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-3-methyladenine glycosylase I"
                     /protein_id="ACF56652.1"
                     /translation="MTKRCSWVKMTNPLYIAYHDEEWGQPLHDDQALFELLCMETYQA
                     GLSWETVLNKRQAFREAFHSYQIHSVAEMTDTELEAMLENPAIIRNRAKIFATRANAQ
                     AFLQLQAEYGSFDAYLWSFVEGKTVVNDVPDYRQAPAKTPLSEKLAKDLKKRGFKFTG
                     PVAVLSFLQAAGLVDDHENDCEWRGLK"
     gene            172391..173068
                     /locus_tag="SPG_0172"
     CDS             172391..173068
                     /locus_tag="SPG_0172"
                     /note="identified by match to protein family HMM PF02517"
                     /codon_start=1
                     /transl_table=11
                     /product="CAAX amino terminal protease family"
                     /protein_id="ACF56084.1"
                     /translation="MMSNKNKGILIFAILYTVLFVFDGVKLLASLMPSAIANYLVYVV
                     LALYGSFLFKDRLIQQWKGIRKTKRKFFFGVLTGWLFLILMTVVFEFVSEMLKQFVGL
                     DGQGLNQSNIQSTFQEQPLLIAVFACVIGPLVEELFFRQVLLHYLQERLSGLLSIILV
                     GLVFALTHMHSLALSEWIGAVGYLGGGLAFSIIYVKEKENIYYPLXVHMLSNSLSLII
                     LAISIVK"
     gene            complement(173205..174236)
                     /locus_tag="SPG_0173"
     CDS             complement(173205..174236)
                     /locus_tag="SPG_0173"
                     /note="identified by match to protein family HMM PF02016"
                     /codon_start=1
                     /transl_table=11
                     /product="MccC family protein"
                     /protein_id="ACF55926.1"
                     /translation="MVSTIGIVSLSSGIIGEDFVKHEVDLGIQRLKDLRLNPIFLPHS
                     LKGLDFIKDHPEARAEDLIHAFSDDSIDMILCAIGGDDTYRLLPYLFENDQLQKVIKQ
                     KIFLGFSDTTMNHLMLHKLGIKTFYGQSFLADICELDKEMLAYSLHYFKELIETGRIS
                     EIRPSDVWYEERTDFSPTALGTPRVSHTNTGFDLLQGSAQFEGKILGGCLESLYDIFD
                     NSRYADSTELCQKYKLFPDLSDWEGKILLLETSEEKPKPEDFKKMLLTLKDTGIFAVI
                     NGLLVGKPMDETFHDDYKEALLDIIDSNIPIVYNLNVCHATPRAIVPFGVHAHVDAQE
                     QVILFDYNK"
     gene            complement(174491..175174)
                     /locus_tag="SPG_0174"
     CDS             complement(174491..175174)
                     /locus_tag="SPG_0174"
                     /note="identified by match to protein family HMM PF06570"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF55393.1"
                     /translation="MSQIDLQKLTKKNQEFVHIATQQFIKDGKTDAEIQTIFEEVIPQ
                     ILEEQSKGTTARSLYGAPTHWAHSFTVKEQYEKEHPKENDDPKLMIMDSALFITSLFA
                     LVSALTTFFAADQAFGYGLITLLLVGLVGGFAFYLMYYFVYQYYGPNMDRSQRPPFWK
                     SVLVILASMFLWLLVFFATSFLPASLNPVLDPLPLAIIGAALLALRFYLKKRLNIRSA
                     SAGPTRYQE"
     gene            complement(175186..176130)
                     /locus_tag="SPG_0175"
     CDS             complement(175186..176130)
                     /locus_tag="SPG_0175"
                     /note="identified by match to protein family HMM PF01544"
                     /codon_start=1
                     /transl_table=11
                     /product="CorA-like Mg2+ transporter protein"
                     /protein_id="ACF54975.1"
                     /translation="MKQVFLXTTTEFKEIDTLEPGTWINLVNPTQNESLEIANTFDID
                     IADLRAPLDAEEMSRITIEDEYTLIIVDVPVTEERNNRTYYVTIPLGIIITEETIITT
                     CLEPLPVLDVFINRRLRNFYTFMRSRFIFQILYRNAELYLTALRSIDRKSEQIESQLH
                     QSTRNEELIELMELEKTIVYFKASLKTNERVIKKLTSSTSNIKKYLEDEDLLEDTLIE
                     TQQAIEMADIYGNVLHSMTETFASIISNNQNNIMKTLALVTIVMSIPTMVFSAYGMNF
                     KDNEIPLNGEPNAFWLIVFIAFAMSVSLTLYLIHKKWF"
     gene            176262..179093
                     /gene="uvrA"
                     /locus_tag="SPG_0176"
     CDS             176262..179093
                     /gene="uvrA"
                     /locus_tag="SPG_0176"
                     /note="identified by match to protein family HMM PF00005;
                     match to protein family HMM TIGR00630"
                     /codon_start=1
                     /transl_table=11
                     /product="excinuclease ABC, A subunit"
                     /protein_id="ACF56502.1"
                     /translation="MQDKIVIHGARAHNLKNIDVEIPRDKLVVVTGLSGSGKSSLAFD
                     TLYAEGQRRYVESLSAYARQFLGNMEKPDVDAIDGLSPAISIDQKTTSKNPRSTVGTT
                     TEINDYLRLLYARVGTPYCINGHGAINASSVEQIVDKVLELPERQRLQILAPVIRKKK
                     GQHKSVIEKVQKDGYVRVRVDGEVYDVTEVPELSKSKQHNIDVVVDRIVIKEGIRSRL
                     FDSIEAALRIAEGYVIIDTMDDSELLFSEHYACPVCGFTVPELEPRLFSFNAPFGSCS
                     ECDGLGIKLEVDTDLVVPDASKTLHEGALAPWNPISSNYYPNMLEQAMKVFGVAMDKP
                     FEDLSEEDKNLILYGSDGKEFHFHYENEFGGVRDIDIPFEGVINNIKRRYHETNSDYT
                     RTQMRLYMNELTCGTCQGYRLNDQALSVRVGGQQGPHIGEISDLSIADHLDLVSQLTL
                     SENEAIIARPILKEIKDRLTFLNNVGLNYLTLSRSAGTLSGGESQRIRLATQIGSNLS
                     GVLYILDEPSIGLHQRDNDRLIASLKKMRDLGNTLIVVEHDEDTMREADYLIDVGPGA
                     GVFGGEIVAAGTPKQVARNSKSITGQYLSGKRVIPVPEERRVGNGRFIEVTGARENNL
                     QNVTARFPLGKFIAVTGVSGSGKSTLINSILKKAIAQKLNRNSDKPGKFKTITGIEHV
                     DRLIDIDQSPIGRTPRSNPATYTGVFDDIRDLFAQTNEAKIRGYKKGRFSFNVKGGRC
                     EACSGDGIIKIEMHFLPDVYVACEVCHGTRYNSETLEVHYKEKNISQVLDMTVNDAVE
                     FFQHIPKIQRKLQTIKDVGLGYVTLGQPATTLSGGEAQRMKLASELHKRSTGKSFYIL
                     DEPTTGLHTEDIARLLKVLARFVDDGNTVLVIEHNLDVIKTADHIIDLGPEGGVGGGT
                     IIVTGTPEEVAANEASYTGHYLKGKLHHE"
     gene            179086..180147
                     /locus_tag="SPG_0177"
     CDS             179086..180147
                     /locus_tag="SPG_0177"
                     /EC_number="3.4.-.-"
                     /note="identified by match to protein family HMM PF00557;
                     match to protein family HMM PF01321"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase, M24 family"
                     /protein_id="ACF56721.1"
                     /translation="MNKRVQAFLAKMQEKELDGIIINNLKNVYYLTGFWGSNGTVFIS
                     RDRQVLVTDSRYIIAAKQETSGFEIVADRDELAVIAGIVKDMNLTRIGFEDEISVSYY
                     HRMQAAFAGLNLLPQTQFVEGLRMIKDEAEIAAIRKACSISDQAFRDALDFIKPGKTE
                     IEIANFLDFRMRELGASGLSFDTILASGINSSKPHAHPMHKPVELGEAITMDFGCLYD
                     HYVSDMTRTIYLGHVSDEQAEIYNTVLKANQALIDQAKAGLGFRDFDKIPRDIIIEAG
                     YGDYFTHGIGHGIGLDIHEEPYFSQTSTETIKTGMALTDEPGIYIEGKYGVRIEDDIL
                     ITETGCELLTLAPKELIVI"
     gene            180279..180677
                     /locus_tag="SPG_0178"
     CDS             180279..180677
                     /locus_tag="SPG_0178"
                     /note="identified by match to protein family HMM PF03960;
                     match to protein family HMM TIGR01617"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF56109.1"
                     /translation="MIKIYTVSSCTSCKKAKTWLNAHQLSYKEQNLGKEGITREELLD
                     ILTKTDNGIASIVSSKNRYAKALGVDIEDLSVNEVLNLIMETPRILKSPILVDEKRLQ
                     VGYKEDDIRAFLPRSVRNVENAEARLRAAL"
     gene            180743..181312
                     /locus_tag="SPG_0179"
     CDS             180743..181312
                     /locus_tag="SPG_0179"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF55773.1"
                     /translation="MKKIVLVSLAFLFVLVGCGQKKETGPATKTEKDTLQSALPVIEN
                     AEKNTVVTKTLVLPKSDDGSQQTQTITYKDKTFLSLAIQQKRPVSDELKTYIDQHGVE
                     ETQKALLEAEEKDKSIIEARKLAGFKLETKLLSATELQTTTSFDFQVLDVKKASQLEH
                     LKNIGLENLLKNEPSKYISDRLANGATEQ"
     gene            181399..181665
                     /locus_tag="SPG_0180"
     CDS             181399..181665
                     /locus_tag="SPG_0180"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF55210.1"
                     /translation="MGFTEETVRFKLDDSNKKEISETLTDVYASLNDKGYNPINQIVG
                     YVLSGDPAYVPRYNNARNQIRKYERDEIVEELVRYYLKGQGVDL"
     gene            181669..182088
                     /locus_tag="SPG_0181"
     CDS             181669..182088
                     /locus_tag="SPG_0181"
                     /note="identified by match to protein family HMM PF03652;
                     match to protein family HMM TIGR00250"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF56457.1"
                     /translation="MRIMGLDVGSKTVGVAISDPLGFTAQGXEIIQINEEQGQFGFDR
                     VKELVDTYKVERFVVGLPKNMNNTSGPRVEASQAYGAKLEEFFGLPVDYQDERLTTVA
                     AERMLIEQADISRNKRKKVIDKLAAQLILQNYLDRKF"
     gene            182104..182409
                     /locus_tag="SPG_0182"
     CDS             182104..182409
                     /locus_tag="SPG_0182"
                     /note="identified by match to protein family HMM PF06949"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF55883.1"
                     /translation="MSHDHNHDHEERELITLVDEQGNETLFEILLTIDGKEEFGKNYV
                     LLVPVNAEEDEDGQVEIQAYSFIENEDGTEGELQPIPEDSEDEWNMIEEVFNSFMEE"
     gene            complement(182542..182718)
                     /locus_tag="SPG_0183"
     CDS             complement(182542..182718)
                     /locus_tag="SPG_0183"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF56416.1"
                     /translation="MFQLFSISKSWGKNVHWTFQLFPISGSWADTVSQTYQLYLISRS
                     WAKTSPELTDCFYF"
     gene            182863..184119
                     /locus_tag="SPG_0184"
     CDS             182863..184119
                     /locus_tag="SPG_0184"
                     /note="identified by match to protein family HMM PF02875;
                     match to protein family HMM PF08245; match to protein
                     family HMM TIGR01499"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrofolate folylpolyglutamate synthetase"
                     /protein_id="ACF56111.1"
                     /translation="MCMFEVEEWLHSRIGLNFRSGLGRMQQAVDLLGNPEQSYPIIHV
                     TGTNGKGSTIAFMRELFMGHGKKVATFTSPHIVSINDRICINGQPIADADFIRLTDQV
                     KEMEKTLLQTPAQLSFFELLTLVAFLYFREQEVDLVLLEVGIGGLLDTTNVVTGELAV
                     ITSIGLDHQETLGDSLEAIAEQKAGIFKAGKKAVIAKLPPEARLVCQKKAESLAVDLY
                     QAGQDFSVLNGDFSSSLLNLSQLNIGLEGAYQQENAALALQTFLLFMGERKEAIDEQA
                     VRKALEQTHWAGRLERIRPQIYLDGAHNLPALTRLVEFIKEKEQEGYRPQILFGSLKR
                     KDYQGMLGYLTENLPQVELKMTGFDYQGSLDETDVTGYHVIPSYREFISSFEERADAQ
                     DLLFVTGSLYFISEVRGYLLDREQIN"
     gene            184116..184661
                     /locus_tag="SPG_0185"
     CDS             184116..184661
                     /locus_tag="SPG_0185"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF55524.1"
                     /translation="MTPLFELVILGELLVRENFSKLVAERKFIMKLKRFTLSLASLAS
                     FSLLVACSQRAQQVQQPVAQQQVQQPAQQNTNTANAGGNQNQAAPVQNQPVAQPTDID
                     GTYTGQDDGDRITLVVTGTTGTWTELESDGDQKVKQVTFDSANQRMIIGDDVKIYTVN
                     GNQIVVDDMDRDPSDQIVLTK"
     gene            184807..186339
                     /gene="cls"
                     /locus_tag="SPG_0186"
     CDS             184807..186339
                     /gene="cls"
                     /locus_tag="SPG_0186"
                     /EC_number="2.7.8.-"
                     /note="identified by match to protein family HMM PF00614"
                     /codon_start=1
                     /transl_table=11
                     /product="cardiolipin synthase"
                     /protein_id="ACF55410.1"
                     /translation="MKYRKFQLLMSKYGFSLSIMLLELCLVFGLFLYLGRMAPILWIT
                     VLILLSIITIISIVNRNTTPENKVTWLLVAFVPVFGPLLYLMFGERRLSKKEIKQLKK
                     LGSMHFQEANSQLLKEKLKESDKAAYGVIKSLLSMDTNADIYDQTASTFFPNGEAMWK
                     KMVEDLKKAEKFIFLEYYIIEEGLMWNRILDILEQKVAQGVEVKMLYDDIGCMATLTG
                     DYAHRLRQLGIEAHKFNKVIPRLTVAYNNRDHRKILIVDGQIAYTGGVNLADEYINHV
                     ERFGYWKDSGIRLDGLAVKALTRLFLTTWYINRGEISDFDQYHLENHSIPSDGLTIPY
                     GSGPKPIFRAQVGKKVYQSLINQATESVYITTPYLIIDYDLTETIKNAAMRGVDVRII
                     TPYIPDKKFIQLVTRGAYPDLLSAGVRIYEYSPGFIHSKQMLVDEDFAVVGTINLDYR
                     SLVHHYENAVLLYKTPSIREIARDFRNIFADSQEVYPHSIKTSWYQKLVKEIAQLFAP
                     IL"
     gene            186417..186560
                     /locus_tag="SPG_0187"
     CDS             186417..186560
                     /locus_tag="SPG_0187"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF54869.1"
                     /translation="MLTKEEVNDMIEFKQTHLHRFREIETFVKLCKKSLKQPSQADNP
                     RTF"
     gene            186597..188135
                     /locus_tag="SPG_0188"
     CDS             186597..188135
                     /locus_tag="SPG_0188"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF56587.1"
                     /translation="MSVYGRVEEVHKENREPLEYQIEQESHHRESSRLPLVKILLWST
                     LVTGITLGVPLLLDLMSAQEVQDFYAGWALHQTGKIYSDYYGSQGLLYYLLTYVSQGG
                     FFFVIFEWLALVAGGFFLFRSADTLTEQGDQAGHLVTIFYMLVTGLAFGGGYATLLAL
                     PFLFAAFSLVAAYLSNPSHDKGFVRIGLALAGGFFFAPLSSLLFIAVVSLGLLVFNLG
                     HRRFAHGFYQFLAVALGFSLVFYPTAYYSAATGSFGDAISGIRYPIDSIRFDFTSKIL
                     ENMFFYGLLSLGLGFVVCIFLGLFQSKPFKLYVISVPASLVVILGLILLFFSQEPLHA
                     SYLMVVFPVFLLLLVTNIKSQQRGRSARRSRRETPVSLWSRFFKGNLYLLVFGFVYLL
                     SVPFLMKFVLYPVPYQERNRLADLVKEETNTEDAIYAWDDTATLYRKSERLSPSAILS
                     PLHYTATEENRNKLLNDLKEKQPKVIVVNDKVEVWSEVETLLKENYQQVKTDYSEFKV
                     YKIK"
     gene            188255..190462
                     /gene="nrdD"
                     /locus_tag="SPG_0189"
     CDS             188255..190462
                     /gene="nrdD"
                     /locus_tag="SPG_0189"
                     /note="identified by match to protein family HMM PF01228;
                     match to protein family HMM PF03477; match to protein
                     family HMM TIGR02487"
                     /codon_start=1
                     /transl_table=11
                     /product="anaerobic ribonucleoside-triphosphate reductase"
                     /protein_id="ACF55993.1"
                     /translation="MIALEEKITILPTLFVEKRDGRRVVFDVDKIDKALYKAADKVMD
                     VTPLVEKRLNDLTERIITEIHSRFPQGIKIYEIQNIVEHELLEAKEYALAEEYITYRT
                     QRDFERSKATDINFSIHKLLNKDQTVVNENANKDSDVFNTQRDLTAGIVGKSIGLQML
                     PKHVANAHQKGDIHYHDLDYSPYTPMTNCCLIDFKGMLENGFKIGNAEVESPKSIQTA
                     TAQISQIIANVASSQYGGCSADRIDEILAPYAEKNYQKHLKDAEEWVLPEKREDYAWK
                     KTQKDIYDAMQSLEYEINTLFTSNGQTPFTSLGFGLGTSRFEREIQKAILNIRIKGLG
                     SEHRTAIFPKLIFTLKRGLNLEEGTPNYDIKQLALECATKRMYPDVLSYDKIVDLTGS
                     FKVPMGCRSFLQGWKDENGVEVNSGRMNLGVVTVNLPRIALESEGDMNKFWEIFNERM
                     NIAEDALVYRVERTKEATPANAPILYQYGAFGHRLGKEESVDQLFKNRRATVSLGYIG
                     LYEVATVFFGNSWESNPDAKEFTLDIIHDMKRRVEEWSDQYGYHFSIYSTPSESLTDR
                     FCRLDIDKFGSIPDITDKEYYTNSFHYDVRKNPTPFEKLDFEKVYPEAGASGGFIHYC
                     EYPVLQQNPKALEAVWDYAYDRVGYLGTNTPIDRCYKCDFEGDFEPTERGFACPNCGN
                     SDPKTVDVVKRTCGYLGNPQARPMVNGRHKEIAARVKHMNGSTIKIAGHQVTN"
     gene            190474..190614
                     /locus_tag="SPG_0190"
     CDS             190474..190614
                     /locus_tag="SPG_0190"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF55632.1"
                     /translation="MGKYQLDDKGRAQVTRYHEKHSKGGAGKKERLLSFREQFLNKNK
                     KK"
     gene            190658..191164
                     /locus_tag="SPG_0191"
     CDS             190658..191164
                     /locus_tag="SPG_0191"
                     /note="identified by match to protein family HMM PF00583"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase, GNAT family"
                     /protein_id="ACF55064.1"
                     /translation="MELRRPRLADKKAVLDMMTEFEKSQSAHDGGFWDTENFVYEEWL
                     ESNQEQEMGINLPEGWVPAIQLVAFSEKGQAVGFLNLRLRLSNFLLEEGGHIGYSIRP
                     SERGKGYAKETLRQGLQVAKEKNIKKALVTCSVNNPASRAVILANGGIFEDAHNGVER
                     YWIEVANE"
     gene            191157..191747
                     /gene="nrdG"
                     /locus_tag="SPG_0192"
     CDS             191157..191747
                     /gene="nrdG"
                     /locus_tag="SPG_0192"
                     /note="identified by match to protein family HMM PF04055;
                     match to protein family HMM TIGR02491"
                     /codon_start=1
                     /transl_table=11
                     /product="anaerobic ribonucleoside-triphosphate reductase
                     activating protein"
                     /protein_id="ACF56875.1"
                     /translation="MNNPKPQEWKSEELSQGRIIDYKAFNFVDGEGVRNSLYVAGCMF
                     HCEGCYNVATWSFNAGIPYTAELEEQIMADLAQPYVQGLTLLGGEPFLNTGILLPLVK
                     RIRKELSDKDIWSWTGYTWEEMMLETPDKLELLSLIDILVDGRYDRTKRNLMLQFRGS
                     SNQRIIDVQKSLKSGQVVIWDKLNDGKESYEQVKRE"
     gene            191744..192361
                     /locus_tag="SPG_0193"
     CDS             191744..192361
                     /locus_tag="SPG_0193"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF56464.1"
                     /translation="MKKKDLVDQLVSEIETGKVRTLGIYGHGASGKSTFAQELYQALD
                     STTVNLLETDPYITSGRHLVVPKDAPNQKVTASLPVAHELESLQRDILALQAGMDVLT
                     IEEPWKASEVLSGAKPILIVEGMSVGFLPKELFEKTICFYTDEETELKRRLARDTTVR
                     NRDASFILASHQMRREQYLRYYKETESKADILVDQSEDKFDVKRT"
     gene            192627..192935
                     /gene="rpsJ"
                     /locus_tag="SPG_0194"
     CDS             192627..192935
                     /gene="rpsJ"
                     /locus_tag="SPG_0194"
                     /note="identified by match to protein family HMM PF00338;
                     match to protein family HMM TIGR01049"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S10"
                     /protein_id="ACF55699.1"
                     /translation="MANKKIRIRLKAYEHRTLDTAAAKIVESATRTGAQVAGPIPLPT
                     ERSLYTIIRATHKYKDSREQFEMRTHKRLIDIVNPTQKTVDALMKLDLPSGVNVEIKL
                     "
     gene            193151..193777
                     /gene="rplC"
                     /locus_tag="SPG_0195"
     CDS             193151..193777
                     /gene="rplC"
                     /locus_tag="SPG_0195"
                     /note="identified by match to protein family HMM PF00297"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L3"
                     /protein_id="ACF55511.1"
                     /translation="MTKGILGKKVGMTQIFTEAGELIPVTVIEATPNVVLQVKTVETD
                     GYNAIQVGFDDKREVLSNKPAKGHVAKANTAPKRFIREFKNVEGLEVGAEITVETFAA
                     GDVVDVTGTSKGKGFQGVIKRHGQSRGPMAHGSRYHRRPGSMGPVAPNRVFKGKNLAG
                     RMGGDRVTIQNLEVVQVVPEKNVILIKGNVPGAKKSLITIKSAVKAGK"
     gene            193802..194425
                     /gene="rplD"
                     /locus_tag="SPG_0196"
     CDS             193802..194425
                     /gene="rplD"
                     /locus_tag="SPG_0196"
                     /note="identified by match to protein family HMM PF00573"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L4"
                     /protein_id="ACF55549.1"
                     /translation="MANVTLFDQTGKEAGQVVLNDAVFGIEPNESVVFDVIISQRASL
                     RQGTHAVKNRSAVSGGGRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYGYKLP
                     QKVRRLALKSVYSEKVAENKFVAVDALSFTAPKTAEFAKVLAALSIDSKVLVILEEGN
                     EFAALSARNLPNVKVATATTASVLDIANSDKLLVTQAAISKIEEVLA"
     gene            194425..194721
                     /gene="rplW"
                     /locus_tag="SPG_0197"
     CDS             194425..194721
                     /gene="rplW"
                     /locus_tag="SPG_0197"
                     /note="identified by match to protein family HMM PF00276"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L23"
                     /protein_id="ACF55860.1"
                     /translation="MNLYDVIKKPVITESSMAQLEAGKYVFEVDTRAHKLLIKQAVEA
                     AFEGVKVANVNTINVKPKAKRVGRYTGFTNKTKKAIITLTADSKAIELFAAEAE"
     gene            194739..195572
                     /gene="rplB"
                     /locus_tag="SPG_0198"
     CDS             194739..195572
                     /gene="rplB"
                     /locus_tag="SPG_0198"
                     /note="identified by match to protein family HMM PF00181;
                     match to protein family HMM PF03947; match to protein
                     family HMM TIGR01171"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L2"
                     /protein_id="ACF55046.1"
                     /translation="MGIRVYKPTTNGRRNMTSLDFAEITTSTPEKSLLVALKSKAGRN
                     NNGRITVRHQGGGHKRFYRLVDFKRNKDNVEAVVKTIEYDPNRSANIALVHYTDGVKA
                     YIIAPKGLEVGQRIVSGPEADIKVGNALPLANIPVGTLIHNIELKPGRGGELVRAAGA
                     SAQVLGSEGKYVLVRLQSGEVRMILGTCRATVGVVGNEQHGLVNLGKAGRSRWKGIRP
                     TVRGSVMNPNDHPHGGGEGKAPVGRKAPSTPWGKPALGLKTRNKKAKSDKLIVRRRNE
                     K"
     gene            195676..195957
                     /gene="rpsS"
                     /locus_tag="SPG_0199"
     CDS             195676..195957
                     /gene="rpsS"
                     /locus_tag="SPG_0199"
                     /note="identified by match to protein family HMM PF00203;
                     match to protein family HMM TIGR01050"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S19"
                     /protein_id="ACF54934.1"
                     /translation="MGRSLKKGPFVDEHLMKKVEAQANDEKKKVIKTWSRRSTIFPSF
                     IGYTIAVYDGRKHVPVYIQEDMVGHKLGEFAPTRTYKGHAADDKKTRRK"
     gene            195969..196313
                     /gene="rplV"
                     /locus_tag="SPG_0200"
     CDS             195969..196313
                     /gene="rplV"
                     /locus_tag="SPG_0200"
                     /note="identified by match to protein family HMM PF00237;
                     match to protein family HMM TIGR01044"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L22"
                     /protein_id="ACF56280.1"
                     /translation="MAEITSAKAMARTVRVSPRKSRLVLDNIRGKSVADAIAILTFTP
                     NKAAEIILKVLNSAVANAENNFGLDKANLVVSEAFANEGPTMKRFRPRAKGSASPINK
                     RTAHITVAVAEK"
     gene            196326..196979
                     /gene="rpsC"
                     /locus_tag="SPG_0201"
     CDS             196326..196979
                     /gene="rpsC"
                     /locus_tag="SPG_0201"
                     /note="identified by match to protein family HMM PF00189;
                     match to protein family HMM PF00417; match to protein
                     family HMM PF07650; match to protein family HMM TIGR01009"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S3"
                     /protein_id="ACF56863.1"
                     /translation="MGQKVHPIGMRVGIIRDWDAKWYAEKEYADYLHEDLAIRKFVQK
                     ELADAAVSTIEIERAVNKVNVSLHTAKPGMVIGKGGANVDALRAKLNKLTGKQVHINI
                     IEIKQPDLDAHLVGEGIARQLEQRVAFRRAQKQAIQRAMRAGAKGIKTQVSGRLNGAD
                     IARAEGYSEGTVPLHTLRADIDYAWEEADTTYGKLGVKVWIYRGEVLPARKNTKGGK"
     gene            196983..197396
                     /gene="rplP"
                     /locus_tag="SPG_0202"
     CDS             196983..197396
                     /gene="rplP"
                     /locus_tag="SPG_0202"
                     /note="identified by match to protein family HMM PF00252;
                     match to protein family HMM TIGR01164"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L16"
                     /protein_id="ACF54810.1"
                     /translation="MLVPKRVKHRREFRGKMRGEAKGGKEVAFGEYGLQATTSHWITN
                     RQIEAARIAMTRYMKRGGKVWIKIFPHKSYTAKAIGVRMGSGKGAPEGWVAPVKRGKV
                     MFEIAGVSEEIAREALRLASHKLPVKCKFVKREAE"
     gene            197406..197612
                     /gene="rpmC"
                     /locus_tag="SPG_0203"
     CDS             197406..197612
                     /gene="rpmC"
                     /locus_tag="SPG_0203"
                     /note="identified by match to protein family HMM PF00831;
                     match to protein family HMM TIGR00012"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal protein L29"
                     /protein_id="ACF54927.1"
                     /translation="MKLNEVKEFVKELRGLSQEELAKRENELKKELFELRFQAATGQL
                     EQTARLKEVKKQIARIKTVQSEAK"
     gene            197637..197897
                     /gene="rpsQ"
                     /locus_tag="SPG_0204"
     CDS             197637..197897
                     /gene="rpsQ"
                     /locus_tag="SPG_0204"
                     /note="identified by match to protein family HMM PF00366"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S17"
                     /protein_id="ACF56731.1"
                     /translation="MERNNRKVLVGRVVSDKMDKTITVVVETKRNHPVYGKRINYSKK
                     YKAHDENNVAKEGDIVRIMETRPLSATKRFRLVEVVEEAVII"
     gene            197923..198291
                     /gene="rplN"
                     /locus_tag="SPG_0205"
     CDS             197923..198291
                     /gene="rplN"
                     /locus_tag="SPG_0205"
                     /note="identified by match to protein family HMM PF00238;
                     match to protein family HMM TIGR01067"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L14"
                     /protein_id="ACF56132.1"
                     /translation="MIQTETRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVASVK
                     QATPGGAVKKGDVVKAVIVRTKSGARRADGSYIKFDENAAVIIREDKTPRGTRIFGPV
                     ARELREGGFMKIVSLAPEVL"
     gene            198369..198674
                     /gene="rplX"
                     /locus_tag="SPG_0206"
     CDS             198369..198674
                     /gene="rplX"
                     /locus_tag="SPG_0206"
                     /note="identified by match to protein family HMM PF00467;
                     match to protein family HMM TIGR01079"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L24"
                     /protein_id="ACF55721.1"
                     /translation="MFVKKGDKVRVIAGKDKGTEAVVLTALPKVNKVIVEGVNIVKKH
                     QRPTNELPQGGIIEKEAAIHVSNVQVLDKNGVAGRVGYKFVDGKKVRYNKKSGEVLD"
     gene            198698..199240
                     /gene="rplE"
                     /locus_tag="SPG_0207"
     CDS             198698..199240
                     /gene="rplE"
                     /locus_tag="SPG_0207"
                     /note="identified by match to protein family HMM PF00281;
                     match to protein family HMM PF00673"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L5"
                     /protein_id="ACF55162.1"
                     /translation="MANRLKEKYLNEVVPALTEQFNYSSVMAVPKVDKIVLNMGVGEA
                     VSNAKSLEKAAEELALISGQKPLITKAKKSIAGFRLREGVAIGAKVTLRGERMYEFLD
                     KLVSVSLPRVRDFHGVPTKSFDGRGNYTLGVKEQLIFPEINFDDVDKTRGLDIVIVTT
                     ANTDEESRALLTGLGMPFAK"
     gene            199258..199527
                     /gene="rpsN"
                     /locus_tag="SPG_0208"
     CDS             199258..199527
                     /gene="rpsN"
                     /locus_tag="SPG_0208"
                     /note="identified by match to protein family HMM PF00253"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S14"
                     /protein_id="ACF55899.1"
                     /translation="MAKKSMVAREAKRQKIVDRYAEKRAALKAAGDYEGLSKLPRNAS
                     PTRLHNRCRVTGRPHSVYRKFGLSRIAFRELAHKGQIPGVTKASW"
     gene            199812..200210
                     /gene="rpsH"
                     /locus_tag="SPG_0209"
     CDS             199812..200210
                     /gene="rpsH"
                     /locus_tag="SPG_0209"
                     /note="identified by match to protein family HMM PF00410"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S8"
                     /protein_id="ACF55305.1"
                     /translation="MVMTDPIADFLTRIRNANQAKHEVLEVPASNIKKGIAEILKREG
                     FVKNVEIIEDDKQGVIRVFLKYGSNGEKVITNLKRVSKPGLRVYKKREDLPKVLNGLG
                     IAILSTSEGLLTDKEARQKNVGGEVIAYVW"
     gene            200402..200938
                     /gene="rplF"
                     /locus_tag="SPG_0210"
     CDS             200402..200938
                     /gene="rplF"
                     /locus_tag="SPG_0210"
                     /note="identified by match to protein family HMM PF00347"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L6"
                     /protein_id="ACF54978.1"
                     /translation="MSRIGNKVIVLPAGVELANNDNVVTVKGPKGELTREFSKDIEIR
                     VEGTEITXHRPNDSKEMKTIHGTTRALLNNMVVGVSEGFKKELEMRGVGYRAQLQGSK
                     LVLAVGKSHPDEVEAPEGITFELPNPTTIVVSGISKEVVGQTAAYVRSLRSPEPYKGK
                     GIRYVGEFVRRKEGKTGK"
     gene            201022..201378
                     /gene="rplR"
                     /locus_tag="SPG_0211"
     CDS             201022..201378
                     /gene="rplR"
                     /locus_tag="SPG_0211"
                     /note="identified by match to protein family HMM PF00861;
                     match to protein family HMM TIGR00060"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L18"
                     /protein_id="ACF56732.1"
                     /translation="MISKPDKNKLRQKRHRRVRGKLSGTADRPRLNVFRSNTGIYAQV
                     IDDVAGVTLASASTLDKEVSKGTKTEQAVAVGKLVAERANAKGISEVVFDRGGYLYHG
                     RVKALADAARENGLKF"
     gene            201396..201890
                     /gene="rpsE"
                     /locus_tag="SPG_0212"
     CDS             201396..201890
                     /gene="rpsE"
                     /locus_tag="SPG_0212"
                     /note="identified by match to protein family HMM PF00333;
                     match to protein family HMM PF03719; match to protein
                     family HMM TIGR01021"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S5"
                     /protein_id="ACF56141.1"
                     /translation="MAFKDNAVELEERVVAVNRVTKVVKGGRRLRFAALVVVGDHNGR
                     VGFGTGKAQEVPEAIRKAVDDAKKNLIEVPMVGTTIPHEVLSEFGGAKVLLKPAVEGS
                     GVAAGGAVRAVVELAGVADITSKSLGSNTPINIVRATVEGLKQLKRAEEIAALRGISV
                     SDLA"
     gene            201904..202086
                     /gene="rpmD"
                     /locus_tag="SPG_0213"
     CDS             201904..202086
                     /gene="rpmD"
                     /locus_tag="SPG_0213"
                     /note="identified by match to protein family HMM PF00327;
                     match to protein family HMM TIGR01308"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal protein L30"
                     /protein_id="ACF55934.1"
                     /translation="MAQIKITLTKSPIGRIPSQRKTVVALGLGKLNSSVIKEDNAAIR
                     GMITAVSHLVTVEEVN"
     gene            202231..202671
                     /gene="rplO"
                     /locus_tag="SPG_0214"
     CDS             202231..202671
                     /gene="rplO"
                     /locus_tag="SPG_0214"
                     /note="identified by match to protein family HMM PF00256;
                     match to protein family HMM PF01305; match to protein
                     family HMM TIGR01071"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L15"
                     /protein_id="ACF55556.1"
                     /translation="MKLHELKPAEGSRKVRNRVGRGTSSGNGKTSGRGQKGQKARSGG
                     GVRLGFEGGQTPLFRRLPKRGFTNINAKEYAIVNLDQLNVFEDGAEVTPVVLIEAGIV
                     KAEKSGIKILGNGELTKKLTVKAAKFSKSAEEAITAKGGSVEVI"
     gene            202684..203994
                     /gene="secY"
                     /locus_tag="SPG_0215"
     CDS             202684..203994
                     /gene="secY"
                     /locus_tag="SPG_0215"
                     /note="identified by match to protein family HMM PF00344;
                     match to protein family HMM TIGR00967"
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase, SecY subunit"
                     /protein_id="ACF55873.1"
                     /translation="MFFKLLREALKVKQVRSKILFTIFIVLVFRIGTSITVPGVNANS
                     LNALSGLSFLNMLSLVSGNALKNFSIFALGVSPYITASIVVQLLQMDILPKFVEWGKQ
                     GEVGRRKLNQATRYIALVLAFVQSIGITAGFNTLAGAQLIKTALTPQVFLTIGIILTA
                     GSMIVTWLGEQITDKGYGNGVSMIIFAGIVSSIPEMIQGIYVDYFVNVPSSRITSSII
                     FVIILIITVLLIIYFTTYVQQAEYKIPIQYTKVAQGAPSSSYLPLKINPAGVIPVIFA
                     SSITAAPAAILQFLSATGHDWAWVRVAQEMLATTSPTGIAMYALLIILFTFFYTFVQI
                     NPEKAAESLQKSGAYIHGVRPGKGTEEYMSKLLRRLATVGSLFLGVISILPIAAKDVF
                     GLSDVVAFGGTSLLIIISTGIEGIKQLEGYLLKRKYVGFMDRTE"
     gene            204145..204783
                     /gene="adk"
                     /locus_tag="SPG_0216"
     CDS             204145..204783
                     /gene="adk"
                     /locus_tag="SPG_0216"
                     /EC_number="2.7.4.3"
                     /note="identified by match to protein family HMM PF00406;
                     match to protein family HMM TIGR01351"
                     /codon_start=1
                     /transl_table=11
                     /product="adenylate kinase"
                     /protein_id="ACF56718.1"
                     /translation="MNLLIMGLPGAGKGTQAAKIVEQFHVAHISTGDMFRAAMANQTE
                     MGVLAKSYIDKGELVPDEVTNGIVKERLSQDDIKETGFLLDGYPRTIEQAHALDKTLA
                     ELGIELEGVINIEVNPDSLLERLSGRIIHRVTGETFHKVFNPPVDYKEEDYYQREDDK
                     PETVKRRLDVNIAQGEPIIAHYRAKGLVHDIEGNQDINDVFSDIEKVLTNLK"
     gene            204900..205118
                     /gene="infA"
                     /locus_tag="SPG_0217"
     CDS             204900..205118
                     /gene="infA"
                     /locus_tag="SPG_0217"
                     /note="identified by match to protein family HMM PF00575;
                     match to protein family HMM PF01176; match to protein
                     family HMM TIGR00008"
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor IF-1"
                     /protein_id="ACF55073.1"
                     /translation="MAKDDVIEVEGKVVDTMPNAMFTVELENGHQILATVSGKIRKNY
                     IRILAGDRVTVEMSPYDLTRGRITYRFK"
     gene            205338..205643
                     /gene="rpsM"
                     /locus_tag="SPG_0218"
     CDS             205338..205643
                     /gene="rpsM"
                     /locus_tag="SPG_0218"
                     /note="contains potential frameshift; identified by match
                     to protein family HMM PF00416"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S13"
                     /protein_id="ACF55768.1"
                     /translation="MFMVSRLATSKKILAAAGISEDVRVRDLTSDQEDAIRREVDAIK
                     VEGDLRREVNLNIKRLMEIGSYRGIRHRRGLPVRGQNTKNNARTRKGKAVAIAGKKK"
     gene            205661..206044
                     /gene="rpsK"
                     /locus_tag="SPG_0219"
     CDS             205661..206044
                     /gene="rpsK"
                     /locus_tag="SPG_0219"
                     /note="identified by match to protein family HMM PF00411"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S11"
                     /protein_id="ACF56244.1"
                     /translation="MAKPTRKRRVKKNIESGIAHIHATFNNTIVMITDVHGNAIAWSS
                     AGALGFKGSRKSTPFAAQMASEAAAKSAQEHGLKSVEVTVKGPGSGRESAIRALAAAG
                     LEVTAIRDVTPVPHNGARPPKRRRV"
     gene            206087..207022
                     /gene="rpoA"
                     /locus_tag="SPG_0220"
     CDS             206087..207022
                     /gene="rpoA"
                     /locus_tag="SPG_0220"
                     /EC_number="2.7.7.6"
                     /note="identified by match to protein family HMM PF01000;
                     match to protein family HMM PF01193; match to protein
                     family HMM PF03118; match to protein family HMM TIGR02027"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase, alpha subunit"
                     /protein_id="ACF54832.1"
                     /translation="MIEFEKPNITKIDENKDYGKFVIEPLERGYGTTLGNSLRRVLLA
                     SLPGAAVTSINIDGVLHEFDTVPGVREDVMQIILNIKGIAVKSYVEDEKIIELDVEGP
                     AEVTAGDILTDSDIEIVNPDHYLFTIGEGSSLKATMTVNSGRGYVPADENKKDNAPVG
                     TLAVDSIYTPVTKVNYQVEPARVGSNDGFDKLTLEILTNGTIIPEDALGLSARILTEH
                     LDLFTNLTEIAKSTEVMKEADTESDDRILDRTIEELDLSVRSYNCLKRAGINTVHDLT
                     EKSEAEMMKVRNLGRKSLEEVKLKLIDLGLGLKDK"
     gene            207034..207420
                     /gene="rplQ"
                     /locus_tag="SPG_0221"
     CDS             207034..207420
                     /gene="rplQ"
                     /locus_tag="SPG_0221"
                     /note="identified by match to protein family HMM PF01196;
                     match to protein family HMM TIGR00059"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L17"
                     /protein_id="ACF55299.1"
                     /translation="MAYRKLGRTSSQRKAMLRDLTTDLLINESIVTTEARAKEIRKTV
                     EKMITLGKRGDLHARRQAAAFVRNEIASENYDEATDKYTSTTALQKLFSEIAPRYAER
                     NGGYTRILKTEPRRGDAAPMAIIELV"
     gene            207685..207951
                     /locus_tag="SPG_0222"
     CDS             207685..207951
                     /locus_tag="SPG_0222"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF54836.1"
                     /translation="MKAIITVVGKDKSGIVAGVSGKIAELGLNIDDISQTVLDEYFTM
                     MAIVSSDEKQDFTYLRNEFEAFGQTLNVKINIQSAAIFEAMYNI"
     gene            207961..209298
                     /locus_tag="SPG_0223"
     CDS             207961..209298
                     /locus_tag="SPG_0223"
                     /note="identified by match to protein family HMM PF05167"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF55500.1"
                     /translation="MDIRQVTETIAMIEEQNFDIRTITMGISLLDCIDPDINRAAEKI
                     YQKITTKAANLVAVGDEIAAELGIPIVNKRVSVTPISLIGAATDATDYVVLAKALDKA
                     AKEIGVDFIGGFSALVQKGYQKGDEILINSIPRALAETDKVCSSVNIGSTKSGINMTA
                     VADMGRIIKETANLSDMGVAKLVVFANAVEDNPFMAGAFHGVGEADVIINVGVSGPGV
                     VKRALEKVRGQSFDVVAETVKKTAFKITRIGQLVGQMASERLGVEFGIVDLSLAPTPA
                     VGDSVARVLEEMGLETVGTHGTTAALALLNDQVKKGGVMACNQVGGLSGAFIPVSEDE
                     GMIAAVQNGSLNLEKLEAMTAICSVGLDMIAIPEDTPAETIAAMIADEAAIGVINMKT
                     TAVRIIPKGKEGDMIEFGGLLGTAPVMRVNGASSVDFISRGGQIPAPIHSFKN"
     gene            209542..210234
                     /locus_tag="SPG_0224"
     CDS             209542..210234
                     /locus_tag="SPG_0224"
                     /note="identified by match to protein family HMM PF00300"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglycerate mutase family protein"
                     /protein_id="ACF55987.1"
                     /translation="MVKVRLYLVRHGKTMFNTIGRAQGWSDTPLTAEGERGIQELGIG
                     LRESDLQFERAYSSDSGRTIQTMGIILEELGLQGKIPYRMDKRIREWCFGSFDGAYDG
                     DLFMGIIPRIFNVDHVHQLSYAELAEGLVEVDTAGWAEGWEKLSGRIKEGFEMIAKEM
                     EDQGGGNALVVSHGMTIGTIVYLINGMHPHGLDNGSVTILEYEDGQFRVEVVGDRSYR
                     ELGREKMEEGSI"
     gene            complement(210337..210750)
                     /gene="pitA1"
                     /locus_tag="SPG_0225"
     CDS             complement(210337..210750)
                     /gene="pitA1"
                     /locus_tag="SPG_0225"
                     /note="contains potential frameshift; Ulijasz AT, J
                     Bacteriol. 2004 Dec;186(23):8123-36."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter, permease protein"
                     /protein_id="ACF56490.1"
                     /translation="MITGTAFILIMSLSARKLPYTIRSSVASLQQIAPSIEEAAESLG
                     SSRLNIFAKITTPMMLSDIISGAILSWVTLISELSTSILLYNVKTRTMTVAIYTEVLR
                     GNYGVAAALSTILTVLTVGSLLLFMKISKSNSITL"
     gene            complement(210747..211319)
                     /gene="pitA2"
                     /locus_tag="SPG_0226"
     CDS             complement(210747..211319)
                     /gene="pitA2"
                     /locus_tag="SPG_0226"
                     /note="contains potential frameshift; Ulijasz AT, J
                     Bacteriol. 2004 Dec;186(23):8123-36."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter, permease protein"
                     /protein_id="ACF55405.1"
                     /translation="MLIGEGYRTFPVLIYTQFISEVGGNSAFAIMAIIIALAIFLIQK
                     HIANRYSFSMNLLHPIEPKKTTKGKIAAIYATVYGIIFISVLPQIYLIYTSFLKTSGM
                     VSVKGYSPNSYKVAFHRMGSAIFNTIRIPLIALVLVVLFATFISYLAVRKRNLFTNLI
                     DSLSMVPYIVPGTVLGIAFISLVYLEXDFL"
     gene            complement(211346..211714)
                     /gene="pitD"
                     /locus_tag="SPG_0227"
     CDS             complement(211346..211714)
                     /gene="pitD"
                     /locus_tag="SPG_0227"
                     /note="Ulijasz AT, J Bacteriol. 2004 Dec;186(23):8123-36."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter, permease protein"
                     /protein_id="ACF56012.1"
                     /translation="MYDFKGEKFLQILIIIASMSAPFVGAYSWVLLLGRNGVITKFLT
                     NALHLPAIDIYGFKGIVLVFTLQLFPLVFLYVAGTMNSIDNSLLEAAESMGSFGFKRI
                     VTVVLPLLVPTLLAAPCLYL"
     gene            complement(211962..213053)
                     /gene="pitB"
                     /locus_tag="SPG_0228"
     CDS             complement(211962..213053)
                     /gene="pitB"
                     /locus_tag="SPG_0228"
                     /EC_number="3.6.3.30"
                     /note="Ulijasz AT, J Bacteriol. 2004 Dec;186(23):8123-36.;
                     identified by match to protein family HMM PF00005; match
                     to protein family HMM PF08402"
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter, ATP-binding protein"
                     /protein_id="ACF56611.1"
                     /translation="MSEIEIINAKKIYHDVPVIENLNITIPKGSLFTLLGASGCGKTT
                     LLRMIAGFNSIKDGEFYFDDTKINNMEPSKRNIGLVFQNYAIFPHLTVRDNVAFGLMQ
                     KKVPKEELIQQTNKYLELMQIAQYADRKPDKLSGGQQQRVTLACALAVNPSVLLMDEP
                     LSNLEAKLRLDMRQAIREIQHEVGITTVYVTHDQEEAMAISDQIAVMKDGVIQQIGRP
                     KELYHKPANEFVATFIGRTNIIPTNLEKRSDGAYIVFSDGYALRMPVLDQVEEQAIHV
                     SIRPEEFIKDESGDIEGTISDSVYLGLNTEYFIETGFASKIQVSEESTFEEDLQKGNR
                     IRLRINTQKLNIFSADGSQNLIKGVNHGT"
     gene            complement(213066..213434)
                     /locus_tag="SPG_0229"
     CDS             complement(213066..213434)
                     /locus_tag="SPG_0229"
                     /note="contains potential frameshift"
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter, iron-binding protein"
                     /protein_id="ACF55595.1"
                     /translation="MAVGLSYEDPAVKLLNDGANIKVVYPKEGTVFLPASAAIVKKAK
                     NMENAKKFIDFIISQEVQDTLGTTTTNRPVRKNAKTSENMKPIDKIKTLTEDYDYVIK
                     NKSDIVKKYNEVFTDIQSKQ"
     gene            complement(213579..214187)
                     /locus_tag="SPG_0230"
     CDS             complement(213579..214187)
                     /locus_tag="SPG_0230"
                     /note="contains potential frameshift"
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter, iron-binding protein"
                     /protein_id="ACF55041.1"
                     /translation="MKKKWMYYAACSSNESADDSSSDKGDGGSLVVYSPNSEGLIGAT
                     IPAFEEKYGIKIELIQAGTGELFKKLESEKEVPVADVIFGGSYTQYATHGELFENYIS
                     KENDNVIKEYQNTTGFSTPYTLDGSVLIVHPDLTKGMNIEGYSDLLKPELKGKIATAD
                     PANSSSAFAQLTNMLQAQGGYKDDKAWSYVKDLFTLIDGIVK"
     gene            complement(214404..214601)
                     /locus_tag="SPG_0231"
     CDS             complement(214404..214601)
                     /locus_tag="SPG_0231"
                     /note="identified by match to protein family HMM PF00165"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF55687.1"
                     /translation="MTLNEYILQYRLKQAIDKMAESPNSPLSAISDQVGFSDYKYFAK
                     VFKKYLHISPKKLKSLGRIVK"
     gene            complement(214676..215452)
                     /locus_tag="SPG_0232"
     CDS             complement(214676..215452)
                     /locus_tag="SPG_0232"
                     /EC_number="1.97.1.-"
                     /note="identified by match to protein family HMM PF04055;
                     match to protein family HMM TIGR02494"
                     /codon_start=1
                     /transl_table=11
                     /product="glycyl-radical enzyme activating protein family"
                     /protein_id="ACF56299.1"
                     /translation="MEISKGIIFNIQHFSIHDGPGIRTTVFLKGCPLRCPWCSNPESQ
                     RMKPEKMKDAQREKFTLVGEEKTVEEIITEVLKDKEFYEESGGGLTLSGGEIFAQFEF
                     AKAILKSAKEHHIHTAIETTAFVDHEKFIDLIQYVDFIYTDLKHYNSIKHKKVTGVFN
                     QMIIKNIHYAFSQNKTIVLRIPVIPNFNNSLEDAEKFATLFNSLNIDQVQLLPFHQFG
                     ENKYRLLNRKYEMDGVNALHPEDLIDYQKVFLNHHINCYF"
     gene            215574..216320
                     /locus_tag="SPG_0233"
     CDS             215574..216320
                     /locus_tag="SPG_0233"
                     /note="identified by match to protein family HMM PF00455;
                     match to protein family HMM PF08220; match to protein
                     family HMM PF08279"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="ACF56859.1"
                     /translation="MKRLEQIIKLVSEYEKIDVNTLSEKLNVSKVTIRKDLDKLESKG
                     LLHREHGYAVLNSGDDLNVRLSINYEIKRKIVQEAVKLVSDNETIMIESGSTCALLAE
                     EICKQKRNVTIVTNSFFIANFVRAYDSCRIIVLGGEFQKDSQVTVGPLLKEMIQTFHV
                     HQAFVGTDGYDKEMGFTGKDLMRSEVVQYISAASDKVIVLTDSSKFDKRGTVRRFALS
                     QVYEVITDEKLSKQNIATLENAGIMVKVVS"
     gene            216333..217313
                     /locus_tag="SPG_0234"
     CDS             216333..217313
                     /locus_tag="SPG_0234"
                     /note="identified by match to protein family HMM PF04198"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="ACF55298.1"
                     /translation="MNQDRNKLLSKIAYLYYIENLNQSQIAAKLGIYRTSISRMLTEA
                     RNVGIVKIEIENFDTNMFKLENYVKEKYSLESLEIIPNEFDDTPTILSERISQVAAGV
                     LRNLIDDNMKIGFSWGKSLSNLVDLIHSKSVRNVHFYPLAGGPSHIHAKYHVNTLIYE
                     MSRKFHGECTFMNATIVQENKLLADGILQSRYFENLKNSWKDLDIAVVGIGDFSNKGK
                     HQWLDMLTEDDFKELTKVKTVGEICCRFFDSKGKEVYENLQERTIAISLEDLKNIPQS
                     LAVAYGDTKVSSILSVLRANLVNHLITDKNTILKVLEEDGDLTFREILGE"
     gene            217508..217828
                     /locus_tag="SPG_0235"
     CDS             217508..217828
                     /locus_tag="SPG_0235"
                     /note="identified by match to protein family HMM PF02255"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system, IIA component"
                     /protein_id="ACF55820.1"
                     /translation="MEIIVPDQIIMGLILYAGDAKQHIYKALDYIKNGTCERCEEEIQ
                     LADAALLEAHNLQTKFLAQEASGTKTEITALFVHSQDHLMTSMTEINLIKEIISLRKE
                     LHKK"
     gene            217874..218182
                     /locus_tag="SPG_0236"
     CDS             217874..218182
                     /locus_tag="SPG_0236"
                     /note="identified by match to protein family HMM PF02302"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system, IIB component"
                     /protein_id="ACF56592.1"
                     /translation="MVKIGLFCAAGFSTGMLVNNMKIAAQASGVEAEIEAFSQSKLAD
                     YAPNIDVALLGPQVAYTLDKSKEICDKCDVPIAVIPMMDYGMLDGKKVLDLALSLISG
                     "
     gene            218199..219497
                     /locus_tag="SPG_0237"
     CDS             218199..219497
                     /locus_tag="SPG_0237"
                     /note="identified by match to protein family HMM PF02378;
                     match to protein family HMM TIGR00410"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system, IIC component"
                     /protein_id="ACF55914.1"
                     /translation="MSKMDVQKIIAPMMKFVNMRGIIALKDGMLAILPLTVVGSLFLI
                     MGQLPFEGLNKSIASVFGANWTEPFMQVYSGTFAIMGLISCFSIAYSYAKNSGVEALP
                     AGVLSVSAFFILLRSSYIPKQGEAIGDAISKVWFGGQGIIGAIIIGLVVGSIYTFFIK
                     RKIVIKMPEQVPQAIAKQFEAMIPAFVIFLSSMIVYILAKSMTNGGTFIEMIYSAIQV
                     PLQGLTGSLYGAIGIAFFISFLWWFGVHGQSVVNGVVTALLLSNLDANKAMLASGNLS
                     LENGAHIVTQQFLDSFLILSGSGITFGLVVAMLFVAKSKQYQALGKVAAFPAIFNVNE
                     PVVFGFPIVMNPVMFVPFILVPVLAAVIVYGAIATGFMQPFSGVTLPWSTPAILSGFL
                     VGGWQGVVTQLLVLAMSTMVYFPFFKIQDRLAYQNEIKQS"
     gene            219648..222086
                     /locus_tag="SPG_0238"
     CDS             219648..222086
                     /locus_tag="SPG_0238"
                     /EC_number="2.3.1.54"
                     /note="identified by match to protein family HMM PF01228;
                     match to protein family HMM PF02901; match to protein
                     family HMM TIGR01774"
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate formate-lyase"
                     /protein_id="ACF56593.1"
                     /translation="MVNTEVARTTIKTEYFGSLTERMNKYREDVLNKKPYIDAERAVL
                     ATRAYERYKEQPNVLKRAYMLKEILENMTIYIEEESMIAGNQASSNKDAPIFPEYTLE
                     FVLNELDLFEKRDGDVFYITEETKEQLRSIAPFWENNNLRARAGALLPEEVSVYMETG
                     FFGMEGKMNSGDAHLAVNYQKLLQFGLRGFEERARKAKVALDLTDPASIDKYHFYDSI
                     FIVIDAIKVYAKRFVALAKSLAENANPKRKKELLEIADICSRVPYEPATTFAEAIQSV
                     WFIQCILQIESNGHSLSYGRFDQYMYPYMKADLESGKETEDSIVERLTNLWIKTITIN
                     KVRSQSHTFSSAGSPLYQNVTIGGQTRDKKDAVNPLSYLVLKSVAQTHLPQPNLTVRY
                     HAGLDARFMNECIEVMKLGFGMPAFNNDEIIIPSFIAKGVLEDDAYDYSAIGCVETAV
                     PGKWGYRCTGMSYMNFPKVLLITMNDGIDPASGKRFAPSFGHFKDMKNFSELENAWDK
                     TLRYLTRMSVIVENSIDLSLEREVPDILCSALTDDCIGRGKHLKEGGAVYDYISGLQV
                     GIANLSDSLAAIKKLVFEEERISPSQLWHALETDYAGEEGKVIQEMLIHDAPKYGNDD
                     DYADKLVTAAYDIYVDEIAKYPNTRYGRGPIGGIRYSGTSXISANVGQGRGTLATPDG
                     RNAGTPLAEGCSPSHNMDQHGPTSVLKSVSKLPTDEIVGGVLLNQKVNPQTLAKEEDK
                     LKLIALLRTFFNRLHGYHIQYNVVSRETLIDAQKHPEKHRDLIVRVAGYSAFFNVLSK
                     ATQDDIIGRTEHTL"
     gene            222105..222773
                     /locus_tag="SPG_0239"
     CDS             222105..222773
                     /locus_tag="SPG_0239"
                     /EC_number="2.2.1.2"
                     /note="identified by match to protein family HMM PF00923"
                     /codon_start=1
                     /transl_table=11
                     /product="Transaldolase"
                     /protein_id="ACF55986.1"
                     /translation="MEFMLDTLNLDEIKKWSEILPLAGVTSNPTIAKREGSINFXERI
                     KDVRELIGSTPSIHVQVISQDFEGILKDAHEIRRQAGDDIFIKVPVTPAGLRAIKVLK
                     KEGYHITATAIYTVIQGLLAIEVGADYLAPYYNRMENLNIDSNSVIRQLALAVDRQNS
                     PSKILAASFKNVAQVNNALAAGAHAVTAGADVFESAFAMPSIQKAVDDFSDDWFVIQN
                     SRSI"
     gene            222791..223879
                     /locus_tag="SPG_0240"
     CDS             222791..223879
                     /locus_tag="SPG_0240"
                     /EC_number="1.1.1.6"
                     /note="identified by match to protein family HMM PF00465"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol dehydrogenase"
                     /protein_id="ACF55668.1"
                     /translation="MRIFASPSRYIQGENALFENAKSILDLGNYPILLCDQLVYDIVG
                     KRFEDYLHRYGFHIVLALFNGEASDNEINRVVALAEKENCDSIIGLGGGKTIDSAKAI
                     ADLIEKPVIIAPTIASTDAPVSALSVIYTDEGAFDHYLFYSKNPDLVLVDTKVISQAP
                     KRLLASGIADGLATWVEARAVMQANGKTMLGQQQTLAGVAIAKKCEETLFADGLQAMA
                     ACEAKVVTPALENIVEANTLLSGLGFESGGLAAAHAIHNGFTALTGDIHHLTHGEKVA
                     YGTLVQLLLENRPKEELDKYIEFYKKIGMPTTLKEMHLDQVGYDDLIKVGKQATMEGE
                     TIHQMPFKISPSDVAQAIIAVDAYVNSK"
     gene            224334..226835
                     /gene="leuS"
                     /locus_tag="SPG_0241"
     CDS             224334..226835
                     /gene="leuS"
                     /locus_tag="SPG_0241"
                     /EC_number="6.1.1.4"
                     /note="identified by match to protein family HMM PF00133;
                     match to protein family HMM PF08264; match to protein
                     family HMM PF09334; match to protein family HMM TIGR00396"
                     /codon_start=1
                     /transl_table=11
                     /product="leucyl-tRNA synthetase"
                     /protein_id="ACF55084.1"
                     /translation="MSFYNHKEIEPKWQGYWAEHHTFKTGTDASKPKFYALDMFPYPS
                     GAGLHVGHPEGYTATDILSRYKRAQGYNVLHPMGWDAFGLPAEQYAMDTGNDPAEFTA
                     ENIANFKRQINALGFSYDWDREVNTTDPNYYKWTQWIFTKLYEKGLAYEAEVPVNWVE
                     ELGTAIANEEVLPDGTSERGGYPVVRKPMRQWMLKITAYAERLLNDLDELDWPESIKD
                     MQRNWIGKSTGANVTFKVKGTDKEFTVFTTRPDTLFGATFTVLAPEHELVDAITSSEQ
                     AEAVANYKHQASLKSDLARTDLAKEKTGVWTGAYAINPVNGKEIPIWIADYVLASYGT
                     GAVMAVPAHDQRDWEFAKQFDLPIVEVLEGGNVAEAAYTEDGLHVNSDFLDGLNKEEA
                     IAKIVAWLEEKGCGQEKVTYRLRDWLFSRQRYWGEPIPIIHWEDGTSTAVPESELPLV
                     LPVTKDIRPSGTGESPLANLTDWLEVTRADGVKGRRETNTMPQWAGSSWYYLRYIDPH
                     NTEKLADEDLLKQWLPVDIYVGGAEHAVLHLLYARFWHKFLYDLGVVPTKEPFQKLFN
                     QGMILGTSYRDHRGALVTTDKVEKRDGSFFHVETGEELEQAPAKMSKSLKNVVNPDDV
                     VEQYGADTLRVYEMFMGPLDASIAWSEEGLEGSRKFLDRVYRLITSKEILAENNGALD
                     KAYNETVKAVTEQIESLKFNTAIAQLMVFVNAANKEDKLYVDYAKGFIQLIAPFAPHL
                     AEELWQTVAETGESISYVAWPTWDESKLVEDEIEIVVQIKGKVRAKLMVAKDLSREEL
                     QEIALADEKVKAEIDGKEIVKVISVPNKLVNIVVK"
     gene            227029..227724
                     /locus_tag="SPG_0242"
     CDS             227029..227724
                     /locus_tag="SPG_0242"
                     /note="identified by match to protein family HMM PF00583"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase, GNAT family"
                     /protein_id="ACF56867.1"
                     /translation="MPVNEYGQMIGESMEGYTPGELPSIDFLEGRYARIEALSVEKHA
                     EDLLAVYGPDTPQEMWTYLFQEPVADMGELVSLLHQMLARKDRFYYAIIDKATGKALG
                     SFSLMRIDQNNRVIEVGAVTFSPELRGTRIGTEAQYLLARYVFEELNYRRYEWKCDAL
                     NLPSRRAAERLSFIYEGTFRQAVVYKGRTRDTDWLSMIDKDWPQVKDRLETWLRPENF
                     DKNGQQYKSLREL"
     gene            227736..228152
                     /locus_tag="SPG_0243"
     CDS             227736..228152
                     /locus_tag="SPG_0243"
                     /note="identified by match to protein family HMM PF00583"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase, GNAT family"
                     /protein_id="ACF56153.1"
                     /translation="MITIKKQEIVKLEDVLHLYQAVGWTNYTHQTEMLEQALSHSLVI
                     YLALDGDAVVGLIRLVGDGFSSVFVQDLIVLSSYQRQGIGSSLMKQALGNFKEAYQVQ
                     LATEQTEKNVGFNRSMGFEILSTYNWIGMTWMNRKK"
     gene            229193..230191
                     /gene="ruvB"
                     /locus_tag="SPG_0244"
     CDS             229193..230191
                     /gene="ruvB"
                     /locus_tag="SPG_0244"
                     /EC_number="3.6.1.-"
                     /note="identified by match to protein family HMM PF00004;
                     match to protein family HMM PF05491; match to protein
                     family HMM PF05496; match to protein family HMM PF07728;
                     match to protein family HMM TIGR00635"
                     /codon_start=1
                     /transl_table=11
                     /product="Holliday junction DNA helicase RuvB"
                     /protein_id="ACF55795.1"
                     /translation="MSRILDNEMMGDEELVERTLRPQYLREYIGQDKVKDQLQIFIEA
                     AKMRDEALDHVLLFGPPGLGKTTMAFVIANELGVNLKQTSGPVIEKAGDLVAILNELE
                     PGDVLFIDEIHRLPMSVEEVLYSAMEDFYIDIMIGAGEGSRSVHLELPPFTLIGATTR
                     AGMLSNPLRARFGITGHMEYYAHADLTEIVERTADIFEMEITHEAASELALRSRGTPR
                     IANRLLKRVRDFAQIMGNGVIDDIITDKALTMLDVDHEGLDYVDQKILRTMIEMYSGG
                     PVGLGTLSVNIAEERETVEDMYEPYLIQKGFIMRTRSGRVATAKAYEHLGYEYSEK"
     gene            230172..230744
                     /locus_tag="SPG_0245"
     CDS             230172..230744
                     /locus_tag="SPG_0245"
                     /note="identified by match to protein family HMM PF06042"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF55033.1"
                     /translation="MNTVKNKQEILEAFRENPDMMAILTIIRDLGLKDSWLAAGSVRN
                     FIWNLLSDKSPFDFETDVDVIFFDPDISYEETLLLEKKLREDFPQYQWELKNQVYMHQ
                     HSPHTAFYTSSRDAMSKYPERCTAVGLRLNEESDFELYVPYGLEDILNFQVRPTPHFL
                     ENEDRMELYQTRLFKKNWQEKWKNLIFKNT"
     gene            230975..231733
                     /locus_tag="SPG_0246"
     CDS             230975..231733
                     /locus_tag="SPG_0246"
                     /EC_number="2.5.1.31"
                     /note="identified by match to protein family HMM PF01255;
                     match to protein family HMM TIGR00055"
                     /codon_start=1
                     /transl_table=11
                     /product="undecaprenyl pyrophosphate synthetase"
                     /protein_id="ACF55341.1"
                     /translation="MFGFFKKDKAVEVEVPTQVPAHIGIIMDGNGRWAKKRMQPRVFG
                     HKAGMEALQTVTKAANKLGVKVITVYAFSTENWTRPDQEVKFIMNLPVEFYDNYVPEL
                     HANNVKIQMIGETDRLPKQTFEALIKAEELTKNNTGLILNFALNYGGRAEITQALKLI
                     SQDVLDAKINPGDITEELIGNYLFTQHLPKDLRDPDLIIRTSGELRLSNFLPWQGAYS
                     ELYFTDTLWPDFDEAALQEAILAYNRRHRRFGGV"
     gene            231742..232545
                     /gene="cdsA"
                     /locus_tag="SPG_0247"
     CDS             231742..232545
                     /gene="cdsA"
                     /locus_tag="SPG_0247"
                     /EC_number="2.7.7.41"
                     /note="identified by match to protein family HMM PF01148"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatidate cytidylyltransferase"
                     /protein_id="ACF54884.1"
                     /translation="MTQDLQKRTLFAGIALAIFLPILMIGGLLLQIAIGIVAMLAMHE
                     LLKMRGLATMTMEGLLTLFATFALTIPLENYLTFLPVDGNVVAYSVLISIMLGTTVFS
                     KSYTIEDAVFPLAMSFYVGFGFNALLDARVAGLDKALLALCIVWATDSGAYLVGMNYG
                     KRKLAPRVSPNKTLEGALGGILGAILVTIIFMIVDSTVALPYGIYKMSVFAIFFSIAG
                     QFGDLLESSIKRHFGVKDSGKFIPGHGGVLDRFDSMLLVFPIMHLFGLF"
     gene            232567..233826
                     /locus_tag="SPG_0248"
     CDS             232567..233826
                     /locus_tag="SPG_0248"
                     /EC_number="3.4.24.-"
                     /note="identified by match to protein family HMM PF02163;
                     match to protein family HMM TIGR00054"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase, M50 family"
                     /protein_id="ACF56561.1"
                     /translation="MLGILTFILVFGIIVVVHEFGHFYFAKKSGILVREFAIGMGPKI
                     FAHIGKDGTAYTIRILPLGGYVRMAGWGDDTTEIKTGTPVSLTLADDGKVKRINLSGK
                     KLDQTALPMQVTQFDFEDKLFIKGLVLEEEKTFAVDHDATVVEADGTEVRIAPLDVQY
                     QNATIWGKLITNFAGPMNNFILGVVVFWVLIFMQGGVRDVDTNQFHIMPQGALAKVGV
                     PETAQITKIGSHEVSNWESLIQAVETETKDKTAPTLDVTISEKGSDKQVTVTPEDSQG
                     RYLLGVQPGVKSDFLSMFVGGFTTAADSALRILSALKNLIFQPDLNKLGGPVAIFKAS
                     SDAAKNGIENILYFLAMISINIGIFNLIPIPALDGGKIVLNILEAIRRKPLKQEIETY
                     VTLAGVVIMVVLMIAVTWNDIMRLFFR"
     gene            233839..235692
                     /gene="proS"
                     /locus_tag="SPG_0249"
     CDS             233839..235692
                     /gene="proS"
                     /locus_tag="SPG_0249"
                     /note="identified by match to protein family HMM PF00587;
                     match to protein family HMM PF03129; match to protein
                     family HMM PF04073; match to protein family HMM TIGR00409"
                     /codon_start=1
                     /transl_table=11
                     /product="prolyl-tRNA synthetase"
                     /protein_id="ACF56045.1"
                     /translation="MKQSKMPIPTLREMPSDAQVISHALMLRAGYVRQVSAGVYSYLP
                     LANRVIEKAKNIMRQEFEKIGAVEMLAPALLSAELWRESGRYETYGEDLYKLKNREKS
                     DFILGPTHEETFTAIVRDSVKSYKQLPLNLYQIQPKYRDEKRPRNGLLRTREFIMKDA
                     YSFHANYDSLDSVYDEYKAAYERIFTRSGLDFKAIIGDGGAMGGKDSQEFMAITSART
                     DLDRWVVLDKSVASFDEIPAEVQEEIKAELLKWIVSGEDTIAYSSESSYAANLEMATN
                     EYKPSNRVVAEEEVTRVATPDVKSIDEVAAFLNVPEEQTIKTLFYIADGELVAALLVG
                     NDQLNEVKLKNHLGADFFDVASEEEVANVVQAGFGSLGPVGLPENIKIIADRKVQDVR
                     NAVVGANEDGYHLTGVNPGRDFTSEYVDIREVREGEISPDGQGVLNFARGIEIGHIFK
                     LGTRYSASMGADVLDENGRAVPIIMGCYGIGVSRLLSAVMEQHARLFVNKTPKGEYRY
                     AWGINFPKELAPFDVHLITVNVKDEEAQALTEKLEASLMGAGYEVLTDDRNERVGVKF
                     SDSDLIGLPIRITVGKKAADGIVEVKIKATGDTIEVHADNVLETLEILSKK"
     gene            235791..237170
                     /locus_tag="SPG_0250"
     CDS             235791..237170
                     /locus_tag="SPG_0250"
                     /note="identified by match to protein family HMM PF00232"
                     /codon_start=1
                     /transl_table=11
                     /product="Glycosyl hydrolase family 1"
                     /protein_id="ACF55115.1"
                     /translation="MLRFPKDFVWGSSTSGPQTEGRVAGDGKGDNLWDXWFQVEPNRY
                     YNGIGSDKTSTFYENWERDIELLLETGHTAFRTSIQWSRIFPQGCGKVNPQGVDFYRK
                     VFEAIKAKGIRLLVNLYHFDLPFALQEDGDGWENKATVSAYEDYARFCFETYGDLVDQ
                     WITFNEPIVPVEFGYFYDAHYPHKVDAEAAVKVAYHTQLASSRAVKACHELLPDSKIG
                     IVLNLTPAYPRSQHPADVKAARIAALFQAQSFLDPSVLGTYPQELVEILHEHGLLPDA
                     TEEELELIRDNTVDFLGVNYYQPLRVMAPRFAKHPESPLLPEHFYEPYVMPGRKINSH
                     RGWEIYEQGIYDIAQNIKENYGNIEWMLTENGMGVEGEEKFRQDGMIQDDYRIDFVKG
                     HLRELHRAIEDGANCKGYLIWTFIDCWSWLNSYKNRYGLVELDLETQERRLKKSGHWF
                     KELSDNNGF"
     gene            237363..239171
                     /gene="glmS"
                     /locus_tag="SPG_0251"
     CDS             237363..239171
                     /gene="glmS"
                     /locus_tag="SPG_0251"
                     /EC_number="2.6.1.16"
                     /note="identified by match to protein family HMM PF00310;
                     match to protein family HMM PF01380; match to protein
                     family HMM TIGR01135"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine-fructose-6-phosphate transaminase
                     (isomerizing)"
                     /protein_id="ACF56517.1"
                     /translation="MCGIVGVVGNTNATDILIQGLEKLEYRGYDSAGIFVLDGADNHL
                     VKAVGRIAELSAKTAGVEGTTGIGHTRWATHGKPTEDNAHPHRSETERFVLVHNGVIE
                     NYLEIKEEYLAGHHFKGQTDTEIAVHLIGKFAEEEGLSVLEAFKKALHIIRGSYAFAL
                     VDSQDPEVIYVAKNKSPLLIGLGEGYNMVCSDAMAMIRETNQYMEIHDQELVIVKADS
                     VEVQDYDGNRRERTSYTAELDLSDIGKGTYPYYMLKEIDEQPTVMRKLIQAYTDEAGQ
                     VVVDPDIIKAVQDADRIYILAAGTSYHAGFASKKMLEELTDTPVELGISSEWGYGMPL
                     LSKKPLFIFISQSGETADSRQVLVKANEMGIPSLTVTNVPGSTLSREANYTMLLHAGP
                     EIAVASTKAYTAQIAALAFLAKAVGEANGNAKAQVFDLVHELSIVAQSIESTLSEKET
                     IEVKVRELLETTRNAFYIGRGQDYYVAMEASLKLKEISYIQCEGFAAGELKHGTIALI
                     EEGTPVLALLSDPVLANHTRGNIQEVAARGAKVLTIAEENVAKDTDDIVLTTVHPYLS
                     PISMVVPTQLVAYFATLHRGLDVDKPRNLAKSVTVE"
     gene            239290..240339
                     /locus_tag="SPG_0252"
     CDS             239290..240339
                     /locus_tag="SPG_0252"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF56328.1"
                     /translation="MVELGISTFGEITELEGTGQTYSHAERIRQLVAEIELADKVGLD
                     VYGIGEHHRADFAVSAPEIVLAAGAVNTKKIRLTSAVSILSSMDPIRLFQQYATIDAL
                     SNGRSEIMAGRGSFTESFPLFGYDLKDYDSLFDEKLDLLQLVNEKTKLDWQGRLTQTI
                     AGKEVYPRPVQDKLPLWIATGGHVESTVKIAQAGLPIVYAIIGGNPRYFKKLIQAYRE
                     IGSEAGHADKDLKVGAHSWGWIAEDGEQAVKDYFHPTKQVVDAISKDRPHWQELRYEQ
                     YLEQVGPNGAMFVGNPDQVAEKLIRMIEDLGLDRFMLHLPLGSMPHDQVLRAIELFGT
                     QVAPKVRAYFAMKEA"
     gene            complement(240439..244281)
                     /gene="pulA"
                     /locus_tag="SPG_0253"
     CDS             complement(240439..244281)
                     /gene="pulA"
                     /locus_tag="SPG_0253"
                     /note="identified by match to protein family HMM PF00128;
                     match to protein family HMM PF00746; match to protein
                     family HMM PF02922; match to protein family HMM PF03714;
                     match to protein family HMM PF04650; match to protein
                     family HMM TIGR01167; match to protein family HMM
                     TIGR01168; match to protein family HMM TIGR02102"
                     /codon_start=1
                     /transl_table=11
                     /product="alkaline amylopullulanase, putative"
                     /protein_id="ACF55912.1"
                     /translation="MRKTPSHTEKKMVYSIRSLKNGTGSVLIGTSLVLLAMATPTISS
                     DESTPTTNEPNNRNTTTLAQPLTDTAAGSGKNESDISSPGNANASLEKTEEKPAASPA
                     DPAPQTGQDRSSEPTTSTSPVTTETKAEEPIEDNYFRIHVKKLPEENKDAQGLWTWDD
                     VEKPSENWPNGALSFKDAKKDDYGYYLDVKLKGEQAKKISFLINNTAGKNLTGDKSVE
                     KLVPKMNEAWLDQDYKVFSYEPQPAGTVRVNYYRTDGNYDKKSLWYWGDVKNPSSAQW
                     PDGTDFTATGKYGRYIDIPLNEAAREFGFLLLDESKQGDDVKIRKENYKFTDLKNHSQ
                     IFLKDDDESIYTNPYYVHDIRMTGAQHVGTSSIESSFSTLVGAKKEDILKHSNITNHL
                     GNKVTITDVAIDEAGKKVTYSGDFSDTKHPYTVSYNSDQFTTKTSWRLKDETYSYDGK
                     LGADLKEEGKQVDLTLWSPSADKVSVVVYDKNDPDKVVGTVALEKGERGTWKQTLDST
                     NKLGITDFTGYYYQYQIERQGKTVLALDPYAKSLAAWNSDDSKIDDAHKVAKAAFVDP
                     AKLGPQDLTYGKIHNFKTREDAVIYEAHVRDFTSDPAIAKDLTKPFGTFEAFIEKLDY
                     LKDLGVTHIQLLPVLSYYFVNELKNHERLSDYASSNSNYNWGYDPQNYFSLTGMYSSD
                     PKNPEKRIAEFKNLINEIHKRGMGAILDVVYNHTAKVDLFEDLEPNYYHFMDADGTPR
                     TSFGGGRLGTTHHMTKRLLIDSIKYLVDTYKVDGFRFDMMGDHDATSIEEAYKAARAL
                     NPNLIMLGEGWRTYAGDENMPTKAADQDWMKHTDTVAVFSDDIRNNLKSGYPNEGQPA
                     FITGGKRDVNTIFKNLIAQPTNFEADSPGDVIQYIAAHDNLTLFDIIAQSIKKDPSKA
                     ENYAEIHRRLRLGNLMVLTAQGTPFIHSGQEYGRTKQFRDPAYKTPVAEDKVPNKSHL
                     LRDKDGNPFDYPYFIHDSYDSSDAVNKFDWTKATDGKAYPENVKSRDYMKGLIALRQS
                     TDAFRLKSLQDIKDRVHLITVPGQNGVEKEDVVIGYQITAPNGDIYAVFVNADEKARE
                     FNLGTAFAHLRNAEVLADENQAGSVGIANPKGLEWTEKGLKLNALTATVLRVSQNGTS
                     HESTAEEKPDSTPSKPEHQNEASHPEHQDPAPEARPDSTKPDTKVADAENKPSQATAD
                     SQAEQPAQEAQASSVKEAVRNESVENSSKKNIPATPDRQAELPNTGIKNENKLLFAGI
                     SLLALLGLGFLLKNKKEN"
     gene            244698..245111
                     /gene="rpsL"
                     /locus_tag="SPG_0254"
     CDS             244698..245111
                     /gene="rpsL"
                     /locus_tag="SPG_0254"
                     /note="identified by match to protein family HMM PF00164;
                     match to protein family HMM TIGR00981"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S12"
                     /protein_id="ACF55881.1"
                     /translation="MPTINQLVRKPRKSKVEKSKSPALNVGYNSHKKVQTNVSSPQKR
                     GVATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLLRGGRVKD
                     LPGVRYHIVRGALDTAGVNDRKQGRSKYGTKRPKA"
     gene            245131..245601
                     /gene="rpsG"
                     /locus_tag="SPG_0255"
     CDS             245131..245601
                     /gene="rpsG"
                     /locus_tag="SPG_0255"
                     /note="identified by match to protein family HMM PF00177;
                     match to protein family HMM TIGR01029"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S7"
                     /protein_id="ACF56387.1"
                     /translation="MSRKNRAPKRDVLPDPLYNSQLVTRLINRVMLDGKRGTAASIVY
                     GAFEQIKEATGNDALEVFETAMENIMPVLEVRARRVGGSNYQVPVEVRPERRTTLGLR
                     WLVTIARLRGEHTMQDRLAKEILDAANNTGAAVKKREDTHRMAEANRAFAHFRW"
     gene            246026..248107
                     /locus_tag="SPG_0256"
     CDS             246026..248107
                     /locus_tag="SPG_0256"
                     /note="identified by match to protein family HMM PF00009;
                     match to protein family HMM PF00679; match to protein
                     family HMM PF03144; match to protein family HMM PF03764;
                     match to protein family HMM TIGR00231; match to protein
                     family HMM TIGR00484"
                     /codon_start=1
                     /transl_table=11
                     /product="translation elongation factor G"
                     /protein_id="ACF56720.1"
                     /translation="MAREFSLEKTRNIGIMAHVDAGKTTTTERILYYTGKIHKIGETH
                     EGASQMDWMEQEQERGITITSAATTAQWNNHRVNIIDTPGHVDFTIEVQRSLRVLDGA
                     VTVLDSQSGVEPQTETVWRQATEYGVPRIVFANKMDKIGADFLYSVSTLHDRLQANAH
                     PIQLPIGSEDDFRGIIDLIKMKAEIYTNDLGTDILEEDIPAEYLDQAQEYREKLIEAV
                     AETDEELMMKYLEGEEITNEELKAGIRKATINVEFFPVLCGSAFKNKGVQLMLDAVID
                     YLPSPLDIPAIKGINPDTDAEEIRPASDEEPFAALAFKIMTDPFVGRLTFFRVYSGVL
                     QSGSYVLNTSKGKRERIGRILQMHANSRQEIDTVYSGDIAAAVGLKDTTTGDSLTDEK
                     AKIILESINVPEPVIQLMVEPKSKADQDKMGIALQKLAEEDPTFRVETNVETGETVIS
                     GMGELHLDVLVDRMRREFKVEANVGAPQVSYRETFRASTQARGFFKRQSGGKGQFGDV
                     WIEFTPNEEGKGFEFENAIVGGVVPREFIPAVEKGLVESMANGVLAGYPMVDVKAKLY
                     DGSYHDVDSSETAFKIAASLSLKEAAKSAQPAILEPMMLVTITVPEENLGDVMGHVTA
                     RRGRVDGMEAHGNSQIVRAYVPLAEMFGYATVLRSASQGRGTFMMVFDHYEDVPKSVQ
                     EEIIKKNKGED"
     gene            248211..252602
                     /locus_tag="SPG_0257"
     CDS             248211..252602
                     /locus_tag="SPG_0257"
                     /EC_number="2.7.7.7"
                     /note="identified by match to protein family HMM PF00929;
                     match to protein family HMM PF01336; match to protein
                     family HMM PF02811; match to protein family HMM PF07733;
                     match to protein family HMM TIGR00573; match to protein
                     family HMM TIGR01405"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III, alpha subunit, Gram-positive
                     type"
                     /protein_id="ACF55562.1"
                     /translation="MSNSFEILMNQLGMPAEMRQAPALAQANIERVVVHKISKVWEFH
                     FVFSNILPIEIFLELKKGLSEEFSKTGNKAVFEIKARSQEFSNQLLQSYYREAFSEGP
                     CASQGFKSLYQNLQVRAEGNQLFIEGSEAIDKEHFKKNHLPNLAKQLEKFGFPTFNCQ
                     VEKNDVLTQEQEEAFHAENEQIVQAANEEALRAMEQLEQMAPPPAEEKPVFDFQAKKA
                     AAKPKLDKAEITPMIEVTTEENRLVFEGVVFDVEQKVTRTGRVLINFKMTDYTSSFSM
                     QKWVKNEEEAQKFDLIKKNSWLRVRGNVEMNNFTRDLTMNVQDLQEVVHYERKDLMPE
                     GERRVEFHAHTNMSTMDALPEVEEIVATAAKWGHKAVAITDHGNVQSFPHGYKAAKKA
                     GIQLIYGMEANIVEDRVPIVYNEVEMDLSEATYVVFDVETTGLSAIYNDLIQVAASKM
                     YKGNVIAEFDEFINPGHPLSAFTTELTGITDDHVKNAKPLEQVLQEFQEFCKDTVLVA
                     HNATFDVGFMNANYERHDLPKISQPVIDTLEFARNLYPEYKRHGLGPLTKRFGVALEH
                     HHMANYDAEATGRLLFIFIKEVAEKHGVTDLARLNIDLISPDSYKKARIKHATIYVKN
                     QVGLKNIFKLVSLSNTKYFEGVPRIPRTVLDAHREGLILGSACSEGEVFDVVVSQGVD
                     AAVEVAKYYDFIEVMPPAIYAPLIAKEQVKDMEELQTIIKSLIEVGDRLGKPVLATGN
                     VHYIEPEEEIYREIIVRSLGQGAMINRTIGHGEHAQPAPLPKAHFRTTNEMLDEFAFL
                     GEELARKLVIENTNALAEIFESVEVVKGDLYTPFIDKAEETVAELTYKKAFEIYGNPL
                     PDIVDLRIEKELTSILGNGFAVIYLASQMLVQRSNERGYLVGSRGSVGSSFVATMIGI
                     TEVNPLSPHYVCGQCQYSEFITDGSYGSGFDMPHKDCPNCGHKLSKNGQDIPFETFLG
                     FDGDKVPDIDLNFSGEDQPSAHLDVRDIFGEEYAFRAGTVGTVAAKTAYGFVKGYERD
                     YGKFYRDAEVERLAQGAAGVKRTTGQHPGGIVVIPNYMDVYDFTPVQYPADDVTAEWQ
                     TTHFNFHDIDENVLKLDVLGHDDPTMIRKLQDLSGIDPNKIPMDDEGVMALFSGTDVL
                     GVTPEQIGTPTGMLGIPEFGTNFVRGMVDETHPTTFAELLQLSGLSHGTDVWLGNAQD
                     LIKQGIADLSTVIGCRDDIMVYLMHAGLEPKMAFTIMERVRKGLWLKISEEERNGYIE
                     AMKANKVPEWYIESCGKIKYMFPKAHAAAYVMMALRVAYFKVHHPIYYYCAYFSIRAK
                     AFDIKTMGAGLEVIKRRMEEISEKRKNNEASNVEIDLYTTLEIVNEMWERGFKFGKLD
                     LYRSQATEFLIDGDTLIPPFVAMDGLGENVAKQLVRAREEGEFLSKTELRKRGGLSST
                     LVEKMDEMGILGNMPEDNQLSLFDELF"
     gene            252704..252967
                     /locus_tag="SPG_0258"
     CDS             252704..252967
                     /locus_tag="SPG_0258"
                     /note="identified by match to protein family HMM PF04221;
                     match to protein family HMM TIGR02384"
                     /codon_start=1
                     /transl_table=11
                     /product="addiction module antitoxin, RelB/DinJ family"
                     /protein_id="ACF56128.1"
                     /translation="MSKMSISIRLDSEVKEQAQQVFSNLGMDMTTAINIFLRQAIQYQ
                     GLPFDVRLDENRKLLQALTDLDQNRNMSQSFESVSDLMEDLRA"
     gene            252960..253238
                     /locus_tag="SPG_0259"
     CDS             252960..253238
                     /locus_tag="SPG_0259"
                     /note="identified by match to protein family HMM PF05016;
                     match to protein family HMM TIGR02385"
                     /codon_start=1
                     /transl_table=11
                     /product="addiction module toxin, RelE/StbE family"
                     /protein_id="ACF56702.1"
                     /translation="MLKIRYHKQFKKDFKLAMKRGLKAELLEEVLNFLVQEKEHPARY
                     RDHSLTASKHFQGVRECHTQPDWLLVYKVDKSELILNLLRTGSHSDLF"
     gene            253259..253411
                     /locus_tag="SPG_0260"
     CDS             253259..253411
                     /locus_tag="SPG_0260"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF55196.1"
                     /translation="MKLRIFAEDKPAKKVFEYQLELADRTILLSTALLSGAIALAGIF
                     SALKEK"
     gene            253433..254674
                     /locus_tag="SPG_0261"
     CDS             253433..254674
                     /locus_tag="SPG_0261"
                     /EC_number="3.4.11.-"
                     /note="identified by match to protein family HMM PF02073"
                     /codon_start=1
                     /transl_table=11
                     /product="aminopeptidase PepS"
                     /protein_id="ACF55384.1"
                     /translation="MVLPNFKENLGKYAKLLVANGINVQPGHTLALSIDVEQRELAHL
                     IVKEAYALGAHEVIVQWTDDVINREKFLHAPMERLDNVPEYKIAEMNYLLENKASRLG
                     VRSSDPGALNGVDADKLSASAKAMGLAMKPMRIATQSNKVSWTVAAAAGLEWAKKVFP
                     NAASDEEAVDFLWDQIFKTCRVYEADPVKAWEEHAAILKSKADMLNKEQFSALHYTAP
                     GTDLTLGLPKNHVWESAGAVNAQGEEFLPNMPTEEVFTAPDFRRADGYVTSTKPLSYN
                     GNIIEGIKVTFKDGQIVDITAEKGDQVMKDLVFENAGARALGECALVPDPSPISQSGI
                     TFFNTLFDENASNHLAIGAAYATSVVDGAEMSEEELEAAGLNRSDVHVDFMIGSNQMD
                     IDGIREDGTRVPLFRNGNWAN"
     gene            254684..254914
                     /locus_tag="SPG_0262"
     CDS             254684..254914
                     /locus_tag="SPG_0262"
                     /note="identified by match to protein family HMM PF04226"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved domain protein"
                     /protein_id="ACF55504.1"
                     /translation="MLGSMFVGLLVGFLAGAMTNRGERMGCFGKMFLGWIGAFLGHLL
                     FGTWGPVLSGTAIIPAILGAMIVLAIFWRRGS"
     gene            255227..255949
                     /locus_tag="SPG_0263"
     CDS             255227..255949
                     /locus_tag="SPG_0263"
                     /note="identified by match to protein family HMM PF00849;
                     match to protein family HMM PF01479; match to protein
                     family HMM TIGR00093"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal small subunit pseudouridine synthase
                     A"
                     /protein_id="ACF56413.1"
                     /translation="MRLDKFLVACAVGSRTEVKNLLKAGRVTVNGKKEKSAKLQIDEK
                     IDEIRFDGQVLEYEEFVYYMMNKPKGVISATEDPKHRTVLDLLDDLARSKEVFPVGRL
                     DIDTHGLLLLTNNGQLAHVLLSPKRHVDKTYQAQVKGIMTQEDVETFIKGIPLKDFTC
                     QPARLEILSTDAEKNQSQIRVTIAEGKFHQIKRMVGYCGKEVVDLQRLTMGTLVLDEN
                     LERGEWRRLTKEELEILRANII"
     gene            256166..257500
                     /locus_tag="SPG_0264"
     CDS             256166..257500
                     /locus_tag="SPG_0264"
                     /EC_number="3.4.22.40"
                     /note="identified by match to protein family HMM PF03051"
                     /codon_start=1
                     /transl_table=11
                     /product="aminopeptidase C"
                     /protein_id="ACF56245.1"
                     /translation="MNAIQESFTDKLFANYEANVKYQAIENAASHNGIFAALECRQSH
                     VDNTPVFSLDLTKDKVTNQKASGRCWMFAALNTFRHKLISQYKLENFELSQAHTFFWD
                     KYEKSNWFLEQVIATSDQELTSRKVSFLLQTPQQDGGQWDMVVSLFEKYGVVPKSVYP
                     ESVSSSSSRELNAILNKLLRQDAQILRDLLVSGADQATVQAKKEDLLQEIFNFLAMSL
                     GLPPRKFDFAYRDKDNNYKSEKGITPQEFYKKYVNLPLEDYVSVINAPTADKPYGKSY
                     TVEMLGNVVGSRAVRYINVPMERLKELAIAQMQAGETVWFGSDVGQLSNRKAGILATD
                     VYDFESSMDIKLTQDKAGRLDYSESLMTHAMVLTGVDLDENGKSTKWKVENSWGDKVG
                     TDGYFVASDAWMDEYTYQIVVRKELLTAEEQAAYGAEPIVLAPWDPMGALAE"
     gene            complement(257556..258467)
                     /locus_tag="SPG_0265"
     CDS             complement(257556..258467)
                     /locus_tag="SPG_0265"
                     /note="identified by match to protein family HMM PF03613;
                     match to protein family HMM TIGR00828"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system, IID component"
                     /protein_id="ACF55647.1"
                     /translation="MTEKLQLTKSDRKKVWWRSTFLQGSWNFERMQNLGWAYTLIPAI
                     KKLYTKKEDQIAALERHLEFFNTHPYVAAPVMGVTLALEEERANGVEIDDAAIQGVKI
                     GMMGPLAGIGDPVFWFTVRPILGSLGASLALTGNILGPLLFFVAWNLIRMSFLWYVQE
                     IGYKAGSEITKDMSGGILQDITKGASILGMFILAVLVQRWVNIKFAFDVSKVQLDEKA
                     YIHWDKLPEGSKGIQEAFAQVGQGLSQTPEKVTTFQQNLDMLIPGLSGLLLTLLCMYL
                     LKKKVSPITIILALFAVGIVAHVLHIM"
     gene            complement(258491..259294)
                     /locus_tag="SPG_0266"
     CDS             complement(258491..259294)
                     /locus_tag="SPG_0266"
                     /note="identified by match to protein family HMM PF03609"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system, IIC component"
                     /protein_id="ACF55677.1"
                     /translation="MSIISMVLVVVVAFFAGLEGILDQFQFHQPLVACTLIGLVTGHL
                     EAGIILGGSLQMIALGWSNIGAAIAPDAALASVAAAIIMVLGGDFTKTGIGVAQAVAI
                     PLAVAGLFLTMIVRTISVGLVHTADAAAKKGDFGAVERAHFIALLFQGLRIALPAALL
                     LMVPTETVQSILSAMPDWLKDGMAIGGGMVVAVGYAMVINMMATREVWPFFALGFVLA
                     AVSDITLIGFGAIGVAIALIYLHLSKTGGNGGGGAATSNDPIGDILEDY"
     gene            complement(259322..260311)
                     /locus_tag="SPG_0267"
     CDS             complement(259322..260311)
                     /locus_tag="SPG_0267"
                     /note="identified by match to protein family HMM PF03610;
                     match to protein family HMM PF03830"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system, IIAB components"
                     /protein_id="ACF55066.1"
                     /translation="MSIGIIIASHGEFAAGIHQSGSMIFGEQEKVQVVTFMPNEGPDD
                     LYAKFNNAVAAFDAEDEVLVLADLWSGSPFNQASRVMGENPERKFAIITGLNLPMLIQ
                     AYTERLMDAAAGVEKVAANIIKEAKDGIKALPEELNPVEEVASAAAAPVAQTAIPEGT
                     VIGDGKLKINLARLDTRLLHGQVATAWTPDSKANRIIVASDNVAKDDLRKELIKQAAP
                     GNVKANVVPIQKLIEISKDPRFGETHALILFETPQDALRAIEGGVPIKTLNVGSMAHS
                     TGKTLVNTVLSMDKEDVATFEKMRDLGVEFDVRKVPNDSKKDLFDLINKANVK"
     gene            complement(260545..261564)
                     /gene="adhP"
                     /locus_tag="SPG_0268"
     CDS             complement(260545..261564)
                     /gene="adhP"
                     /locus_tag="SPG_0268"
                     /note="identified by match to protein family HMM PF00107;
                     match to protein family HMM PF08240"
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase, zinc-containing"
                     /protein_id="ACF56099.1"
                     /translation="MKAVVVNPESTGVAIEEKVLRPLETGEALVEVEYCGVCHTDLHV
                     AHGDFGQVPGRVLGHEGIGIVKEIAPDVKSLKVGDRVSVAWFFEGCGTCEYCTTGRET
                     LCRTVKNAGYSVDGGMAEQCIVTADYAVKVPDGLDPAQASSITCAGVTTYKAIKEAKV
                     EPGQWVVLYGAGGLGNLAVQYAKKVFNAHVIAVDINNDKLALAKEVGADIVINGLEVE
                     DVAGLIKEKTDGGAHSAVVTAVSKVAFNQAVDSVRAGGRVVAVGLPSEMMELSIVKTV
                     LDGIQVIGSLVGTRKDLEEAFQFGAEGLVAPVVQKRPVEDAVAIFDEMEKGQIQGRMV
                     LDFTH"
     gene            complement(261673..261819)
                     /locus_tag="SPG_0269"
     CDS             complement(261673..261819)
                     /locus_tag="SPG_0269"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF55426.1"
                     /translation="MKLTWFEEIFEEYDQLASWSLCSFHSLINQLIDCSTFCLQNLGK
                     GFLL"
     gene            complement(261903..262286)
                     /locus_tag="SPG_0270"
     CDS             complement(261903..262286)
                     /locus_tag="SPG_0270"
                     /note="contains potential frameshift; identified by match
                     to protein family HMM PF08282"
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="ACF56446.1"
                     /translation="MVTKDPNCILLQTRASDKYALAKDMNAFYQHQLSINTWGGPLNI
                     LECTPKGVNKAFALDYLLKIMNRDKKDLIAFGDEHNDTEMLAFAGKGYAMKNANPELL
                     PYADEQISLTNDQDGVAKTLQDLFL"
     gene            complement(262381..262716)
                     /locus_tag="SPG_0271"
     CDS             complement(262381..262716)
                     /locus_tag="SPG_0271"
                     /note="contains potential frameshift"
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="ACF55929.1"
                     /translation="MTKKIIAVDLDGTLLNSDSQISDFTKKTIKKVAEKGHQVIITTG
                     RPYRMSKDFYRELGLDTPMINFNGSLTHLPDQVWDFEKCLTVDKKYLLDMVQRSXDIQ
                     ADFIXGKYR"
     gene            262906..264324
                     /locus_tag="SPG_0272"
     CDS             262906..264324
                     /locus_tag="SPG_0272"
                     /note="identified by match to protein family HMM PF00860"
                     /codon_start=1
                     /transl_table=11
                     /product="putative permease"
                     /protein_id="ACF55465.1"
                     /translation="MDKLFKLKENGTDVRTEVLAGLTTFFAMSYILFVNPQILSQTGM
                     PAQGVFLXTIIGAVAGTLMMAFYANLPYAQAPGMGLNAFFTFTVVFGLGYSWQEALAM
                     VFICGIISLIITLTNVRKMIIESIPNALRSAISAGIGVFLAYVGIKNAGLLKFTIDPG
                     NYTVVGEGADKAQATIAANSSAVPGLVSFNNPAVLVALAGLAITIFFVIKGIKGGIIL
                     SILTTTVLAIAVGLVDLSSIDFANNHVGAAFEDLKTIFGAALGSEGLGALVSDTARLP
                     ETLMAILAFSLTDIFDTIGTLIGTGEKVGIVATNGENHQSAKLDKALYSDLIGTTVGA
                     IAGTSNVTTYVESAAGIGAGGRTGLTALVVAICFAISSFFSPLLAIVPTAATAPILII
                     VGIMMLGSLKNIHWDDMSEAVPAFFTSIFMGFSYSITQGIAVGFLTYTLTKLVKGQVK
                     NVHAMIWILDALFILNYISMAL"
     gene            264377..265084
                     /locus_tag="SPG_0273"
     CDS             264377..265084
                     /locus_tag="SPG_0273"
                     /note="identified by match to protein family HMM PF02517"
                     /codon_start=1
                     /transl_table=11
                     /product="CAAX amino terminal protease family"
                     /protein_id="ACF55505.1"
                     /translation="MKEKNMWKELLNRAGWILVFLLAVLLYQVPLVVTSILTLKEVAL
                     LQSGLIVAGLSIVVLVLFIIGARKTQLASFNFSFFRTKDLARLGLSYLVIICSNILGS
                     ILLQLSNETTTANQSQINDMVQNSSLISSFFLLALLAPICEEILCRGIVPKKIFRGKE
                     NLGFVVGTIVFALLHQPSNLPSLLIYGGMSTVLSWTAYKTQRLEMSILLHMIVNGIAF
                     CLLALVVIMSRTLGISV"
     gene            265179..266153
                     /gene="sulA"
                     /locus_tag="SPG_0274"
     CDS             265179..266153
                     /gene="sulA"
                     /locus_tag="SPG_0274"
                     /EC_number="2.5.1.15"
                     /note="identified by match to protein family HMM PF00809;
                     match to protein family HMM TIGR01496"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydropteroate synthase"
                     /protein_id="ACF56622.1"
                     /translation="MMKILEGVTDMSSKANHAKTVICGIINVTPDSFSDGGKFFALEQ
                     ALQQARKLIAEGASMLDIGGESTRPGSSYVEIEEEIQRVVPVIKAIRKESDVLISIDT
                     WKSQVAEAALAAGADLVNDITGLMGDEKMAHVVAEARAQVVIMFNPVMARPQHPSSLI
                     FPHFGFGQAFTEEELADFETLPIEELMEAFFERALARAAEAGIAPENILLDPGIGFGL
                     TKKENLLLLRDLDKLHQKGYPIFLGVSRKRFVINILEENGFEVNPETELGFRNRDTAS
                     AHVTSIAARQGVEVVRVHDVASHRMAVEIASAIRLADEAENLDLKQYK"
     gene            266155..267477
                     /gene="sulB"
                     /locus_tag="SPG_0275"
     CDS             266155..267477
                     /gene="sulB"
                     /locus_tag="SPG_0275"
                     /note="identified by match to protein family HMM PF02875;
                     match to protein family HMM PF08245; match to protein
                     family HMM TIGR01499"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrofolate synthetase"
                     /protein_id="ACF55106.1"
                     /translation="MKEIENNQWIANYRTDQPHFGLERMVELLALRGNPHLKLKVLHI
                     GGTNGKGSTIAFLKKMLEKLGLRVGVFSSPYLIHYTDQISINGESISEARLEALMADY
                     QSLLEGEAVANLQGTTEFEIITALAYDYFASEQVDVAIMEVGMGGLLDSTNVCQPILT
                     GITTIGLDHVALLGDTLEAIAEQKAGIIKQGMPLVTGRIAPEALTVIDRIAEEKDAPR
                     LAYGTDYQVRHQESVVTGEVFDYTSAVRQGRFQTSLLGLYQIENAGMAIALLDTFCQE
                     DGRELASNDFLGQALEETSWPGRLEIVSRDPLMILDGAHNPHAIKALLVTLQERFADH
                     HKEILFTCIKTKALEDMLDLLGAMPDTELTLTHFADSRATDESVLKEAAKSRNLSYQD
                     WHDFLEQNLTDKKEEKQTVRIVTGSLYFLSQVRAYLMERKNENGYTKD"
     gene            267458..268012
                     /gene="sulC"
                     /locus_tag="SPG_0276"
     CDS             267458..268012
                     /gene="sulC"
                     /locus_tag="SPG_0276"
                     /EC_number="3.5.4.16"
                     /note="identified by match to protein family HMM PF01227;
                     match to protein family HMM TIGR00063"
                     /codon_start=1
                     /transl_table=11
                     /product="GTP cyclohydrolase I"
                     /protein_id="ACF55748.1"
                     /translation="MDTQKIEAAVKMIIEAVGEDANREGLQETPARVARMYQEIFSGL
                     GQTAEEHLSKSFEIIDDNMVVEKDIFFHTMCEHHFLPFYGRAHIAYIPDGRVAGLSKL
                     ARTVEVYSKKPQIQERLNIEVADALMDYLGAKGAFVVIEAEHMCMSMRGVRKPGTATL
                     TTVARGLFETDKDLRDQAYRLMGL"
     gene            268055..268867
                     /gene="sulD"
                     /locus_tag="SPG_0277"
     CDS             268055..268867
                     /gene="sulD"
                     /locus_tag="SPG_0277"
                     /EC_number="4.1.2.25"
                     /EC_number="2.7.6.3"
                     /note="identified by match to protein family HMM PF01288;
                     match to protein family HMM PF02152; match to protein
                     family HMM TIGR00525; match to protein family HMM
                     TIGR00526; match to protein family HMM TIGR01498"
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional folate synthesis protein"
                     /protein_id="ACF56325.1"
                     /translation="MDQLQIKDLEMFAYHGLFPSEKELGQKFVVSAILSYDMTKAATD
                     LDLTASVHYGELCQQWTTWFQETSEDLIETVAYKLVERTFESYPLVQEMKLELKKPWA
                     PVHLSLDTCSVTIHRRKQRAFIALGSNMGDKQANLKQAIDKLRARGIHILKESSVLAT
                     EPWGGVEQDSFANQVVEVETWLPAQDLLETLLAIESELGRVREVHWGPRLIDLDLLFV
                     EDQILYTDDLILPHPYIAERLFVLESLQEIAPHFIHPILKQPIRNLYDALKK"
     gene            complement(268912..269229)
                     /locus_tag="SPG_0278"
     CDS             complement(268912..269229)
                     /locus_tag="SPG_0278"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF55231.1"
                     /translation="MAFTNTHMRSASFGIVTSLPDDIIDSFWYIIDHFLKNVFELEEE
                     LEFQLLNNQGKITFHFSSQHLPTAIDFDFNHPFDPRYPPRVLVLDMDGRETILLPEEN
                     DLF"
     gene            269750..270031
                     /gene="rplM"
                     /locus_tag="SPG_0279"
     CDS             269750..270031
                     /gene="rplM"
                     /locus_tag="SPG_0279"
                     /note="contains potential frameshift; identified by match
                     to protein family HMM PF00572; match to protein family HMM
                     TIGR01066"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L13"
                     /protein_id="ACF55763.1"
                     /translation="MIVINAEKVKLTGKKATDKIYYTHSNHPGGLKQISAGELRSKNA
                     VRLIEKSVKGMLPHNTLGRAQGMKLKVFVGAEHTHAAQQPEVLDISGLI"
     gene            270050..270442
                     /gene="rpsI"
                     /locus_tag="SPG_0280"
     CDS             270050..270442
                     /gene="rpsI"
                     /locus_tag="SPG_0280"
                     /note="identified by match to protein family HMM PF00380"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S9"
                     /protein_id="ACF55455.1"
                     /translation="MSQAQYAGTGRRKNAVARVRLVPGTGKITVNKKDVEEYIPHADL
                     RLVINQPFAVTSTVGSYDVFVNVVGGGYAGQSGAIRHGIARALLQVDPDFRDSLKRAG
                     LLTRDSRKVERKKPGLKKARKASQFSKR"
     gene            complement(270703..271125)
                     /locus_tag="SPG_0281"
     CDS             complement(270703..271125)
                     /locus_tag="SPG_0281"
                     /note="identified by match to protein family HMM PF00589"
                     /codon_start=1
                     /transl_table=11
                     /product="integrase/recombinase, phage integrase family"
                     /protein_id="ACF55861.1"
                     /translation="MRFIVETFPIFSISNDLLQLLTSWKKQQKYELAKFGIISNPEQF
                     IFTYIDTKGNINKPLHSDYLNNKMKTIRKRHPELTHATPHKLRHTGATLAKQAGMSLE
                     TISEALIHSDTGTTQIYVNTSNVVPMAVGEFALQSLKQ"
     gene            271272..271448
                     /locus_tag="SPG_0282"
     CDS             271272..271448
                     /locus_tag="SPG_0282"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF54957.1"
                     /translation="MSLDIDKEKMTIMGIAFENRSVFKSVWYALSTNMIEGWRPTVSD
                     VEKLRDEALALGMT"
     gene            271849..274062
                     /locus_tag="SPG_0283"
     CDS             271849..274062
                     /locus_tag="SPG_0283"
                     /note="identified by match to protein family HMM PF01055"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl hydrolase, family 31"
                     /protein_id="ACF55749.1"
                     /translation="MKIFKGEFYRISVLTDKLVRLEYSKTGSFEDRTTQLIYNRDFGQ
                     VSLDYIETSNVLDIMTDYFHLHFNKGEFNAENLFIELKGNFAVYGSRWYFGESIETLK
                     GTARTLDKADGAIPLEDGIISRNGIALLDDSQGFIWDEQSGYIERENQIDLYFFAYGH
                     DYRGAIRDFYHLTGSTPLLPRYALGNWWSRYWPYTSDEYLDLIDRFETEKIPLSIGVL
                     DMDWHITDIPARFGSGWTGYSWNKNLIPNPEQLLQQLHDRKLKLSLNVHPADGIRAYE
                     EAYPQVAKRLGLNVELEEPAIFDFFNPSFREAYFKDVHYELEKQGVDFWWIDWQQGTQ
                     GILDPLWLLNHYHYQDSCKNAEGGLILSRYAGPGSHRYPVGFSGDTIISWNSLRFQPY
                     FTATASNIGYSWWSHDIGGHMLGDYDEELQTRWLQFGVFSPITRLHSSRSPFNSKEPW
                     FFSETTSKIMKKYLRLRHQMIPYLYTMNVKTHEEGAPLISPMYYFYPENDESYNVPNQ
                     YFFGTELMVAPIVEKMDLAFQSAKVDVWFPEGEWYDFFSEKKYTGGVKLSVYRDISTI
                     PVFAKSGAIIPLVGSEIDMGVDLPEVVDWYVFPGKQHSFEMLEDQNGQRYKTRLSIDW
                     EMGMVELTLQGDSSIVPSNRRHRIHFKGTNVSIIELPNKNDTARFECKDNKTISLNDE
                     VFRLLKTASLPYELKDRLLNQFINAKNSHDLMNILHHQDKELRGRLLEMIFTSQN"
     gene            complement(274284..274760)
                     /locus_tag="SPG_0284"
     CDS             complement(274284..274760)
                     /locus_tag="SPG_0284"
                     /EC_number="1.11.1.9"
                     /note="identified by match to protein family HMM PF00255"
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione peroxidase"
                     /protein_id="ACF55430.1"
                     /translation="MTSLYDFSVLNQNNQATPLDSYRGKVLLIVNTATGCGLTPQYQG
                     LQELYERYQDQGFEILDFPCNQFMGQAPGSAEEINAFCSLHFQTTFPRFAKIKVNGKE
                     ADPLYVWLKDQKSGPLGKRVEWNFAKFLIGRDGQVFERFSSKTDPKQIEEAIQTLL"
     gene            274983..278186
                     /gene="hyl"
                     /locus_tag="SPG_0285"
     CDS             274983..278186
                     /gene="hyl"
                     /locus_tag="SPG_0285"
                     /note="identified by match to protein family HMM PF00746;
                     match to protein family HMM PF02018; match to protein
                     family HMM PF02278; match to protein family HMM PF02884;
                     match to protein family HMM PF08124; match to protein
                     family HMM TIGR01167"
                     /codon_start=1
                     /transl_table=11
                     /product="hyaluronate lyase Hyl"
                     /protein_id="ACF54992.1"
                     /translation="MQTKTKKLIVSLSSLVLSGFLLNHYMTVGAEETTTNTIQQSQKE
                     VQYQQRDTKNLVENGDFGQTEDGSSPWTGSKAQGWSAWVDQKNSSADASTRVIEAKDG
                     AITISSPEKLRAAVHRMVPIEAKKKYKLRFKIKTDHKVGIAKVRIIEESGKDKRLWNS
                     ATTSGTKDWQTIEADYSPTLDVDKIKLELFYETGTGTVSFKDIELVEVADQLSEDSQT
                     DKQLEEKIDLPIGKKHVFSLADYTYKVENPDVASVKNGILEPLKEGTTNVIVSKDGKE
                     VKKIPLKILASVKDAYTARLDDWNGIIAGNQYYDSKNEQMAKLNQELEGKVADSLSSI
                     SSQADRTYLWEKFSNYKMSANLTATYRKLEEMAKQVTNPSSRYYQDETVVRTVRDSME
                     WLHKHVYNSEKSIVGNWWDYEIGTPRAINNTLSLMKEYFSDEEIKKYTDVIEKFVPDP
                     EHFRKTTDNPFKALGGNLVDMGRVKVIAGLLRKDDQEISSTIRSIEQVFKLVDQGEGF
                     YQDGSYIDHTNVAYTGAYGNVLIDGLSQLLPVIQKTKSPIDKDKMQTMYHWIDKSFAP
                     LLVNGELMDMSRGRSISRANSEGHVAAVEVLRGIHRIADMSEGETKQRLQSLVKTIVQ
                     SDSYYDVFKNLKTYKDISLMQSLLSDAGVASVPRPSYLSAFNKMDKTAMYNAEKGFGF
                     GLSLFSSRTLNYEHMNKENKRGWYTSDGMFYLYNGDLSHYSDGYWPTVNPYKMPGTTE
                     TDAKRADSDTGKVLPSAFVGTSKLDDANVTATMDFTNWNQTLTAHKSWFMLKDKIAFL
                     GSNIQNTSTDTAATTIDQRKLESSNPYKVYVNDKEASLTEQEKDYPETQSVFLESFDS
                     KKNIGYFFFKKSSISMSKALQKGAWKDINEGQSDKEVENEFLTISQAHKQNGDSYGYM
                     LIPNVDRATFNQMIKELESSLIENSETLQSVYDAKQGVWGIVKYDDSVSTISNQFQVL
                     KRGVYTIRKEGDEYKIAYYNPETQESAPDQEVFKKLEQAAQPQVQNSKEKEKSEEEKN
                     HSDQKNLPQTGEGQSILASLGFLLLGAFYLFRRGKNN"
     gene            278802..278927
                     /locus_tag="SPG_0286"
     CDS             278802..278927
                     /locus_tag="SPG_0286"
                     /codon_start=1
                     /transl_table=11
                     /product="IS200S transposase"
                     /protein_id="ACF55939.1"
                     /translation="MMFDKHANLKYKFGNRNFWAEGYYVSPVGLNEATIKKYSQD"
     gene            complement(279303..279932)
                     /gene="eda"
                     /locus_tag="SPG_0287"
     CDS             complement(279303..279932)
                     /gene="eda"
                     /locus_tag="SPG_0287"
                     /EC_number="4.1.2.14"
                     /EC_number="4.1.3.16"
                     /note="identified by match to protein family HMM PF01081;
                     match to protein family HMM TIGR01182"
                     /codon_start=1
                     /transl_table=11
                     /product="2-dehydro-3-deoxyphosphogluconate
                     aldolase/4-hydroxy-2-oxoglutarate aldolase"
                     /protein_id="ACF55443.1"
                     /translation="MTKSDTIIELKKQKIVAVIRGNTKEEGLQASIACIKGGIKAIEI
                     AYTNQYAGQIIKELVDLYQDDQSVCIGAGTVLDAVTARDAILAGANYVVSPSFHAETA
                     KMCNLYSTPYIPGCITLTEITTALEAGSEIIKLFPGSTLSPAYISAVKAPIPQVSVMV
                     TGGVGLNNIPQWFAAGADAVGIGGELNKLASQGNFDRISEIAQQYITLR"
     gene            complement(279942..280943)
                     /locus_tag="SPG_0288"
     CDS             complement(279942..280943)
                     /locus_tag="SPG_0288"
                     /EC_number="2.7.1.45"
                     /note="carbohydrate kinase, PfkB family; identified by
                     match to protein family HMM PF00294"
                     /codon_start=1
                     /transl_table=11
                     /product="2-dehydro-3-deoxygluconatekinase"
                     /protein_id="ACF55000.1"
                     /translation="MTKILLFGEPLIRISPLDATSIGDHVASSTYFGGSEINIACNLQ
                     ALGISTKVFTALPANEIGDRFLTFLKQHQIDTSSICRLGDRIGLYYLENGFGCRQSEV
                     FYDRKHTSISQIRPNMLDMDSLFQGISHFHFSGITIAIGQEVRAILLLLLEEAKRRGI
                     VVSMDLNLRTKMISVLEAKYEFSKFARFTDYCFGIDPLMIDDQNLEMFPRDSASLEEV
                     ENRMRLLKEAYGFKAIFHTLRSSDEQDKNVYQAYALEERFEESVQLKTAVYQRIGSGD
                     AFISGALYQLLHHSSLKTTIDFAVASATLKCTLPGDHLSTSSTSIENLLANAQDIIR"
     gene            complement(280974..281615)
                     /locus_tag="SPG_0289"
     CDS             complement(280974..281615)
                     /locus_tag="SPG_0289"
                     /note="identified by match to protein family HMM PF02502"
                     /codon_start=1
                     /transl_table=11
                     /product="ribose 5-phosphate isomerase, putative"
                     /protein_id="ACF56554.1"
                     /translation="MKIALINENSQASKNHIIYDSLKEATDKKGYQLFNYGMRGEEGE
                     SQLTYVQNGLMAAILLNTKAVDFVVTGCGTGVGAMLALNSFPGVVCGLAVDPTDAYLY
                     SQINGGNALSIPYAKGFGWGAELTLKLMFERLFAEEMGGGYPRERVIPEQRNARILNE
                     VKQITHNDLMTILKTIDQDFLKDTISGKYFQEYFFENCQDDEVAAYLKEVLAK"
     gene            complement(281634..282449)
                     /locus_tag="SPG_0290"
     CDS             complement(281634..282449)
                     /locus_tag="SPG_0290"
                     /note="identified by match to protein family HMM PF00106"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase, short chain
                     dehydrogenase/reductase family"
                     /protein_id="ACF55612.1"
                     /translation="MTNTSFSIEQFSLKGKIALITGASYGIGFAIAKSYAEAGATIVF
                     NDINQDLVNKGIEAYREVGIEAHGYVCDVTDEDGIQAMVKQIKQEVGVIDILVNNAGI
                     IRRVPMCEMSAADFRKVIDIDLNAPFIVSKAVIPSMIKKGHGKIINICSMMSELGRET
                     VSAYAAAKGGLKMLTRNIASEYGGANIQCNGIGPGYIATPQTAPLRELQEDGSRHPFD
                     QFIIAKTPAARWGNPEDLMGPAVFLASDASNFVNGHILYVDGGILAYIGKQPE"
     gene            282720..283148
                     /locus_tag="SPG_0291"
     CDS             282720..283148
                     /locus_tag="SPG_0291"
                     /note="identified by match to protein family HMM PF03610"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system, IIA component"
                     /protein_id="ACF55120.1"
                     /translation="MKIVLVGHGHFATGIYSSLQLIAGNQENVEAIDFVEGMSADELK
                     QKILLAISNEEEVLILSDLLGGTPFKVSSTIMGENPAKTMNVLSGLNLAMLMEAVFAR
                     MAHSFDEVVNKSVVAAQGGVVNGKELFSTDAEEEDFESGI"
     gene            283160..284350
                     /locus_tag="SPG_0292"
     CDS             283160..284350
                     /locus_tag="SPG_0292"
                     /EC_number="3.2.1.-"
                     /note="identified by match to protein family HMM PF07470"
                     /codon_start=1
                     /transl_table=11
                     /product="unsaturated glucuronyl hydrolase"
                     /protein_id="ACF56786.1"
                     /translation="MIKKVTIEKIKSPERFLEVPLLTKEEVGQAIDKVIRQLELNLDY
                     FKEDFPTPATFDNVYPIMDNTEWTNGFWTGELWLAYEYSQQDAFKNIAHKNVLSFLDR
                     VNKRVELAHHDLGFLYTPSCMAEYKINGDGEAREAALKAADKLIERYQEKGGFIQAWG
                     DLGKKEHYRLIIDCLLNIQLLFFAYQETGDQKYYDIAESHFYASANNVIRDDASSFHT
                     FYFDPETGQPFKGVTRQGYSDDSCWARGQSWGVYGIPLTYRHLKDESCFDLFKGVTNY
                     FLNRLPKDHVSYWDLIFNDGSDQSRDSSATAIAVCGIHEMLKHLPEVDADKDIYKHAM
                     HAMLRSLIEYYANDQFTPGGTSLLHGVYSWHSGKGVDEGNIWGDYYYLEALIRFYKDW
                     NLYW"
     gene            284361..284852
                     /locus_tag="SPG_0293"
     CDS             284361..284852
                     /locus_tag="SPG_0293"
                     /EC_number="2.7.1.69"
                     /note="identified by match to protein family HMM PF03830"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system, IIB component"
                     /protein_id="ACF55980.1"
                     /translation="MTMPNIIMTRIDERLIHGQGQLWVKYLGCNTVIVANDEVSTDKM
                     QQTLMKTVVPDSVAMRFFPLQKVIDIIHKANPAQTIFIVVKDVKDALTLVEGGVPIKE
                     INIGNIHNAPGKEQVTRSIFLGEEDKAALKELSQTHQVTFNTKTTPTGNDGAVQVNIM
                     DYI"
     gene            284867..285646
                     /locus_tag="SPG_0294"
     CDS             284867..285646
                     /locus_tag="SPG_0294"
                     /note="identified by match to protein family HMM PF03609"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system, IIC component"
                     /protein_id="ACF55385.1"
                     /translation="MSINVFQAILIGLWTAFCFSGMLLGIYTNRCIVLSFGVGIILGD
                     LPTALVMGAIGELAYMGFGVGAGGTVPPNPIGPGIFGTLMAITSAGKVSPEAALALST
                     PIAVAIQFLQTFAYTVRAGAPETAMKHLKNHNLKKFKFTLNATIWLFAFIGFTLGCLG
                     ALSMDTLLKLVDYIPPVLLTGLTVAGKMLPAIGFAMILSVMAKKELIPFVLLGYVCAA
                     YLNIPTIGIAIVGTIFALIEFYNKPKTADHVVEEEAHDDWI"
     gene            285633..286451
                     /locus_tag="SPG_0295"
     CDS             285633..286451
                     /locus_tag="SPG_0295"
                     /note="identified by match to protein family HMM PF03613"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system, IID component"
                     /protein_id="ACF54789.1"
                     /translation="MTGSNKLTKRDYLKTSLRAFFCQNGFNYSNYQGLGYANVMYPAL
                     KKHYGEDQEGFYQALEENCEFYNTNPHFLPFITSLHLVMLENGRPAKETRSIKMALMG
                     PLAGIGDSLSQFCLAPLFSTIAASFAQEGLVVGPILFFLAMNTILTAIKLSTGLYGYK
                     LGTTVIDKLSEQMATISRIANIIGVTVIAGLAATSVKIMVPITFAAGEVKADAKQSIV
                     SIQGMLDKVAPALLPALFTLLVYYLIKEKKWTTYKLVILTVIIGIIGSWLKIIA"
     gene            286451..286744
                     /locus_tag="SPG_0296"
     CDS             286451..286744
                     /locus_tag="SPG_0296"
                     /note="identified by match to protein family HMM PF02699;
                     match to protein family HMM TIGR00739"
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit"
                     /protein_id="ACF56675.1"
                     /translation="MDTTLFYGIVIVLAVSPLLLSSFHSIRQQKLLRKQMEQRQEYLA
                     SLTSGDEVLLLSGIHGKIISIKDDLISLQIAKGVVIYVEKESVMGKTKELLFK"
     gene            286766..288667
                     /locus_tag="SPG_0297"
     CDS             286766..288667
                     /locus_tag="SPG_0297"
                     /note="identified by match to protein family HMM PF07940"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF55971.1"
                     /translation="MKEERRQFFERIDGNQCRDYILSHCSKDYEKVKSSLERLMDNRF
                     MFDSPWDMEPCSKIHQIQPMVWDQVFEDDPEWAYMLNRQEYLLQFMIGYVVEGDKDYI
                     QKCKFFLFDWIEQVREFSPQSLMTRTLDTGIRSFTWLKLLLLLLKFDLLEEKELEKIL
                     VSLEKQIDFMKSHYRAKYTLSNWGILQTIPMLAIYYFFSDKMDLEEAYHFASEELKQQ
                     IETQILGDGSQFEQSILYHVEVYKALLDLCLLLPDLQDSYRELLEKMATYIQMMTGLD
                     GRTLAFGDSDSTETTEILSLSAVVLNKEDLLNGLDVKVDLLSLLFLGREKVKRLQEFE
                     KRAWQPKSMIFEDSGHVCIKDEHRYLFFKNGPLGSAHSHSDENSFCLQYQGQPIFIDA
                     GRYSYREIYERYLLKSAWSHSTCIVDGKAPERITGSWEYEYYPHSLFCHHKEREGVHY
                     IEGAYWSAEPDLPYLHKRKILMLVEDVWLLVDDIRCQGQHEALTQFILDKDVTYQDGK
                     INQLRLWSEVDFDLEDTIISPKYNELERSSKLTKRQFFENQMLDYTIIAHESFEIIRH
                     SVYQTDDREVENALAFEVKNDETDKLILLLSEDIRVGEKLCLVDGTKMRGKCLVYDKI
                     NERMIRLQC"
     gene            288727..289728
                     /gene="regR"
                     /locus_tag="SPG_0298"
     CDS             288727..289728
                     /gene="regR"
                     /locus_tag="SPG_0298"
                     /note="Chapuy-Regaud,S.; (2003)Inf.& Imm. 71: 2615-2625;
                     identified by match to protein family HMM PF00356; match
                     to protein family HMM PF00532"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar binding transcriptional regulator RegR"
                     /protein_id="ACF55754.1"
                     /translation="MEKKLTIKDIAEMAQTSKTTVSFYLNGKYEKMSQETREKIEKVI
                     HETNYKPSIVARSLNSKRTKLIGVLIGDITNSFSNQIVKGIEDIASQNGYQVMIGNSN
                     YSQESEDRYIESMLLLGVDGFIIQPTSNFRKYSRIIDEKKKKMVFFDSQLYEHRTSWV
                     KTNNYDAVYDMTQSCIEKGYEHFLLITADTSRLSTRIERASGFVDALTDANMRHASLT
                     IEDKHTNLEQIKEFLQKEIDPDEKTLVFIPNCWALPLVFTVIKELNYNLPQVGLIGFD
                     NTEWTCFSSPSVSTLVQPSFEEGQQATKILIDQIEGRNQEERQQVLDCSVNWKESTF"
     gene            complement(289838..290173)
                     /locus_tag="SPG_0299"
     CDS             complement(289838..290173)
                     /locus_tag="SPG_0299"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF55043.1"
                     /translation="MKSLARLLIIHVFISIFLFFALISGAVSHTVLLLLLLFLPALNK
                     GLEKIQSKRIPVLNAALFFLLISFPQLLTNPVQWKFSIFLVVTIISSLAYFYNFYQVV
                     KEVDQKQLI"
     gene            complement(290184..290426)
                     /locus_tag="SPG_0300"
     CDS             complement(290184..290426)
                     /locus_tag="SPG_0300"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF55884.1"
                     /translation="MKKEKKQLRYPGLKAGSIYGTVIFFIIPLIDTLTSENPNFISSL
                     LNTKHIFKTILGAFFFGVMIHIVDSLRIARAKKDQD"
     gene            complement(290437..290979)
                     /locus_tag="SPG_0301"
     CDS             complement(290437..290979)
                     /locus_tag="SPG_0301"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF56271.1"
                     /translation="MKKETFTEKLIKRTYGISDPLDEYKRREADSIGNQVFIVLFYLM
                     IFGNIIPLLLAYKYPQEVALIYPPLILVIALIASGYVTYQMKKTGITVIEPDMLNEKE
                     SKQLHYPGLKAGLFFGLWMFFITPLLSILIDEGQDYFHSLLTIRNGVSSILGSIFFGA
                     SIQFLISRRIAKTKKNQDED"
     gene            complement(290995..291189)
                     /locus_tag="SPG_0302"
     CDS             complement(290995..291189)
                     /locus_tag="SPG_0302"
                     /note="identified by match to protein family HMM PF01381"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, putative"
                     /protein_id="ACF54928.1"
                     /translation="MNRVKEFRKELGISQLELAKDIGVSRQTINMIENDKYNPTLELC
                     LNLARSLQTDLNSLFWEEDF"
     gene            291355..292305
                     /gene="mraW"
                     /locus_tag="SPG_0303"
     CDS             291355..292305
                     /gene="mraW"
                     /locus_tag="SPG_0303"
                     /EC_number="2.1.1.-"
                     /note="identified by match to protein family HMM PF01795;
                     match to protein family HMM TIGR00006"
                     /codon_start=1
                     /transl_table=11
                     /product="S-adenosyl-methyltransferase MraW"
                     /protein_id="ACF56670.1"
                     /translation="MTKEFHHVTVLLHETIDMLDVKPDGIYVDATLGGAGHSEYLLSK
                     LSEKGHLYAFDQDQNAIDNAQKRLAPYIEKGMVTFIKDNFRHLQARLREAGVQEIDGI
                     CYDLGVSSPQLDQRERGFSYKKDAPLDMRMNQDASLTAYEVVNHYDYHDLVRIFFKYG
                     EDKFSKQIARKIEQAREVKPIETTTELAEIIKLVKPAKELKKKGHPAKQIFQAIRIEV
                     NDELGAADESIQQAMDMLALDGRISVITFHSLEDRLTKQLFKEASTVEVPKGLPFIPD
                     DLKPKMELVSRKPILPSAEELEANNRSHSAKLRVARKIHK"
     gene            292317..292634
                     /locus_tag="SPG_0304"
     CDS             292317..292634
                     /locus_tag="SPG_0304"
                     /note="identified by match to protein family HMM
                     TIGR02209"
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsL"
                     /protein_id="ACF55606.1"
                     /translation="MAEKMEKTGQILQMQLKRFSRVEKAFYFSIAVTTLIVAISIIFM
                     QTKLLQVQNDLTKINAQIEEKKTELDDAKQEVNELLRAERLKEIANSHDLQLNNENIR
                     IAE"
     gene            292638..294890
                     /gene="pbp2X"
                     /locus_tag="SPG_0305"
     CDS             292638..294890
                     /gene="pbp2X"
                     /locus_tag="SPG_0305"
                     /note="identified by match to protein family HMM PF00905;
                     match to protein family HMM PF03717; match to protein
                     family HMM PF03793"
                     /codon_start=1
                     /transl_table=11
                     /product="penicillin-binding protein 2X"
                     /protein_id="ACF56039.1"
                     /translation="MKWTKRVIRYATKNRKSPAENRRRVGKSLSLLSVFVFAIFLVNF
                     AVIIGTGTRFGTDLAKEAKKVHQTTRTVPAKRGTIYDRNGVPIAEDATSYNVYAVIDE
                     NYKSATGKILYVEKTQFNKVAEVFHKYLDMEESYVREQLSQPNLKQVSFGAKGNGITY
                     ANMMSIKKELETAEVKGIDFTTSPNRSYPNGQFASSFIGLAQLHENEDGSKSLLGTSG
                     MESSLNSILAGTDGIITYEKDRLGNIVPGTEQVSQQTVDGKDVYTTISSPLQSFMETQ
                     MDAFQEKVKGKYMTATLVSAKTGEILATTQRPTFDADTKEGITEDFVWRDILYQSNYE
                     PGSTMKVMMLAAAIDNNTFPGGEVFNSSELKIADATIRDWDVNEGLTGGRMMTFSQGF
                     AHSSNVGMTLLEQKMGDATWLDYLNRFKFGVPTRFGLTDEYAGQLPADNIVNIAMSAF
                     GQGISVTQTQMLRAFTAIANDGVMLEPKFISALYDPNDQSVRKSQKEIVGNPVSKEAA
                     SVTRDHMVMVGTDPTYGTMYNHSTGKATVNVPGQNVALKSGTAEIADEKNGGYLTGST
                     NNIFSVVSMHPAENPDFILYVTVQQPEHYSGIQLGEFANPILERASAMKESLNLQTTA
                     KALEQVSQQSPYPMPSVKDISPGDLAEELRRNLVQPIVVGTGTKIKNSSAEEGKNLAP
                     NQQVLILSDKAEEVPDMYGWTKETAETFAKWLNIELEFEGSGSTVQKQDVRANTAIKD
                     IKKITLTLGD"
     gene            294892..295872
                     /locus_tag="SPG_0306"
     CDS             294892..295872
                     /locus_tag="SPG_0306"
                     /EC_number="2.7.8.13"
                     /note="identified by match to protein family HMM PF00953;
                     match to protein family HMM TIGR00445"
                     /codon_start=1
                     /transl_table=11
                     /product="phospho-N-acetylmuramoyl-pentapeptide-
                     transferase"
                     /protein_id="ACF56547.1"
                     /translation="MFISISAGIVTFLLTLVGIPAFIQFYRKAQITGQQMHEDVKQHQ
                     AKAGTPTMGGLVFLIASVLVAFFFALFSNQLSNNVGMILFILVLYGLIGFLDDFLKVF
                     RKINEGLNPKQKLALQLLGGVIFYLFYERGGDILSVFGYPVHLGFFYIFFALFWLVGF
                     SNAVNLTDGVDGLASISVVISLSAYGVIAYVQGQMDILLVILAMIGGLLGFFIFNHKP
                     AKVFMGDVGSLALGGMLAAISMALHQEWTLLIIGIVYVFETTSVMMQVSYFKLTGGKR
                     IFRMTPVHHHFELGGLSGKGNPWSEWKVDFFFWGVGLLASLLTLAILYLM"
     gene            296084..296200
                     /locus_tag="SPG_0307"
     CDS             296084..296200
                     /locus_tag="SPG_0307"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF54867.1"
                     /translation="MVDRTDEVSSKHGFEVVDKEKLMWFEEVFEECKKILVS"
     gene            296481..298586
                     /locus_tag="SPG_0308"
     CDS             296481..298586
                     /locus_tag="SPG_0308"
                     /note="identified by match to protein family HMM PF00004;
                     match to protein family HMM PF07724; match to protein
                     family HMM PF07728"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent Clp protease, ATP-binding subunit,
                     putative"
                     /protein_id="ACF55903.1"
                     /translation="MNNNFNNFNNMDDLFNQLMGGMRGYSSENRRYLINGREVTPEEF
                     AHYRATGQLPGNAETDVQMPQQASGMKQDGVLAKLGRNLTAEAREGKLDPVIGRNKEI
                     QETSEILSRRTKNNPVLVGDAGVGKTAVVEGLAQAIVNGDVPAAIKNKEIISIDISGL
                     EAGTQYRGSFEENVQNLVNEVKEAGNIILFFDEIHQILGAGSTGGDSGSKGLADILKP
                     ALSRGELTVIGATTQDEYRNTILKNAALARRFNEVKVNAPSAENTFKILQGIRDLYQQ
                     HHNVILPDEVLKAAVDYSVQYIPQRSLPDKAIDLVDVTAAHLAAQHPVTDVHAVEREI
                     ETEKDKQEKAVEAEDFEAALNYKTRIAELEKKIENHTEDMKVTASVNDVAESVERMTG
                     IPVSQMGASDIERLKDMAHRLQDKVIGQDKAVEAVARAIRRNRAGFDEGNRPIGSFLF
                     VGSTGVGKTELAKQLALDMFGTQDAIIRLDMSEYSDRTAVSKLIGTTAGYVGYDDNSN
                     TLTERVRRNPYSIILLDEIEKADPQVITLLLQVLDDGRLTDGQGNTVNFKNTVIIATS
                     NAGFGYEANLTEDADKPELMDRLKPFFRPEFLNRFNAVIEFSHLTKEDLSKIVDLMLA
                     EVNQTLAKKDIDLVVSQAAKDYITEEGYDEVMGVRPLRRVVEQEIRDKVTDFHLDHLD
                     AKHLEADMEDGVLVIREKV"
     gene            complement(298882..299364)
                     /gene="luxS"
                     /locus_tag="SPG_0309"
     CDS             complement(298882..299364)
                     /gene="luxS"
                     /locus_tag="SPG_0309"
                     /EC_number="4.4.1.21"
                     /note="identified by match to protein family HMM PF02664"
                     /codon_start=1
                     /transl_table=11
                     /product="S-ribosylhomocysteine lyase"
                     /protein_id="ACF56338.1"
                     /translation="MSKEVIVESFELDHTIVKAPYVRLIGEETGPKGDIISNYDIRLV
                     QPNEDSIPTAGLHTIEHLLAKLIRTRIDGMIDCSPFGCRTGFHMIMWGRHTSAKIAAV
                     IKDSLKEIAETTTWEDVPGTTIESCGNYKDHSLFSAKEWAKLILEQGISDDAFERHVI
                     "
     gene            complement(299459..300943)
                     /locus_tag="SPG_0310"
     CDS             complement(299459..300943)
                     /locus_tag="SPG_0310"
                     /note="identified by match to protein family HMM PF08903"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF56783.1"
                     /translation="MKKQAFSSEQYLNLQRDHILERINQFDGKLYLEFGGKMLEDFHA
                     ARVLPGYEPDNKIKLLQELKEQVEVVIAINASNIEHSKARGDLGISYDQEVLRLIDKF
                     NELGIFVGSVVITQYAGQPAADAFRNQLEKNGIDSYLHYPIKGYPTDMDHIISPEGMG
                     KNDYIKTSRNLIVVTAPGPGSGKLATCMSNMYHDQINGIKSGYAKFETFPVWNLPLHH
                     PVNLAYEAATADLDDVNMIDPFHLQTYGETTVNYNRDIEIFPVLKRMLERILGKSPYA
                     SPTDMGVNMVGFAITDDEAAVEASKQEIIRRYYQTVLDFKAEKVGEAAVKKIELLMND
                     LGITPADRKVAVVARQKAEETGGPALALELPNGDIVTGKNSELFGPTAAALINAIKKS
                     ADIAKEVKLIEPEVVKPIQGLKIDHLGSRNPRLHSNEILIALAITATENPDAARAMEE
                     LGNLKGSEAHSTIILTDEDKNVLRKLGINVTFDPYYQYDRLYRK"
     gene            301096..302703
                     /gene="dexB"
                     /locus_tag="SPG_0311"
     CDS             301096..302703
                     /gene="dexB"
                     /locus_tag="SPG_0311"
                     /EC_number="3.2.1.70"
                     /note="identified by match to protein family HMM PF00128"
                     /codon_start=1
                     /transl_table=11
                     /product="glucan 1,6-alpha-glucosidase"
                     /protein_id="ACF55107.1"
                     /translation="MQEKWWHNAVVYQVYPKSFMDSNGDGIGDLPGITSKLDYLAKLG
                     ITAIWLSPVYDSPMDDNGYDIADYQAIAAIFGTMEDMDQLIAEAKKRDIRIIMDLVVN
                     HTSDEHAWFVEACENPNSPERDYYIWRDEPNDLDSIFSGSAWEYDEKSGQYYLHFFSK
                     KQPDLNWENEKLRQKIYEMMNFWIDKGIGGFRMDVIDMIGKIPDEKVVNNGPMLHPYL
                     KEMNQATFGDKDLLTVGETWGATPEIAKLYSDPKGQELSMVFQFEHIGLQYQEGQPKW
                     HYQKELNIAKLKEIFNKWQTELGVEDGWNSLFWNNHDLPRIVSIWGNDQEYREKSAKA
                     FAILLHLMRGTPYIYQGEEIGMTNYPFETLDQVEDIESLNYAREALEKGVPIEEIMDS
                     IRVIGRDNARTPMQWDESKNAGFSTGQPWLAVNPNYEMINVQEALANPDSIFYTYQKL
                     VQIRKENSWLIRADFELLDTADKVFAYIRKDGDRRFLVVANLSNEEQDLTVEGKVKSV
                     LIENTLAQEVFEKQILVPWDAFCVELL"
     gene            302862..303035
                     /locus_tag="SPG_0312"
     CDS             302862..303035
                     /locus_tag="SPG_0312"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF56199.1"
                     /translation="MNIKKRVLSAGLTFASALLLAACGQSGSDTKTYSSTFSGNPTTF
                     NYLLDYYADNTVN"
     gene            303258..303383
                     /locus_tag="SPG_0313"
     CDS             303258..303383
                     /locus_tag="SPG_0313"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF56330.1"
                     /translation="MLVRETSETKLQKSRSSSSLRKSLERLTHHSFVRPATKEIL"
     gene            303775..305220
                     /gene="cpsA"
                     /locus_tag="SPG_0314"
     CDS             303775..305220
                     /gene="cpsA"
                     /locus_tag="SPG_0314"
                     /note="Bentley, S.D.; 2006 PLOS Genetics 2: 0262-0269
                     Guidolin,A.; 1994 Inf.Imm. 62:5384-5396; identified by
                     match to protein family HMM PF02916; match to protein
                     family HMM PF03816; match to protein family HMM TIGR00350"
                     /codon_start=1
                     /transl_table=11
                     /product="integral membrane regulatory protein Wzg"
                     /protein_id="ACF56321.1"
                     /translation="MSRRFKKSRSQKVKRSVNIVLLTIYLLLVCFLLFLIFKYNILAF
                     RYLNLVVTALVLLVALVGLLLIIYKKAEKFTIFLLVFSILVSSVSLFAVQQFVGLTNR
                     LNATSNYSEYSISVAVLADSDIENVTQLTSVTAPTGTDNENIQKLLADIKSSQNTDLT
                     VNQSSSYLAAYKSLIAGETKAIVLNSVFENIIESEYPDYASKIKKIYTKGFTKKVEAP
                     KTSKNQSFNIYVSGIDTYGPISSVSRSDVNILMTVNRDTKKILLTTTPRDAYVPIADG
                     GNNQKDKLTHAGIYGVDSSIHTLENLYGVDINYYVRLNFTSFLKMIDLLGGVDVHNDQ
                     EFSALHGKFHFPVGNVHLDSEQALGFVRERYSLADGDRDRGRNQQKVIVAIIQKLTST
                     EVLKNYSSILQGLQDSLQTNMPIETMIDLVNTQLESGGNYKVNSQDLKGTGRMDLPSY
                     AMPDSNLYVMEIDDSSLAVVKAAIQDVMEGR"
     gene            305222..305953
                     /gene="cpsB"
                     /locus_tag="SPG_0315"
     CDS             305222..305953
                     /gene="cpsB"
                     /locus_tag="SPG_0315"
                     /EC_number="3.1.3.48"
                     /note="Bentley, S.D.; 2006 PLOS Genetics 2: 0262-0269
                     Guidolin,A.; 1994 Inf.Imm. 62:5384-5396; identified by
                     match to protein family HMM PF02811"
                     /codon_start=1
                     /transl_table=11
                     /product="tyrosine-protein phosphatase wzh"
                     /protein_id="ACF56769.1"
                     /translation="MIDIHSHIVFDVDDGPKSREESKALLAESYRQGVRTIVSTSHRR
                     KGMFETPEEKIAENFXQVREIAKEVADDLVIAYGAEIYYTLDALEKLEKKEIPTLNDS
                     RYALIEFSMHTSYRQIHTGLSNILMLGITPVIAHIERYDALENNEKRVRELIDMGCYT
                     QINSYHVSKPKFFGEKYKFMKKRARYFLERDLVHVVASDMHNLDSRPPYMQQAYDIIA
                     KKYGAKKAKELFVDNPRKIIMDQLI"
     gene            305962..306654
                     /gene="cpsC"
                     /locus_tag="SPG_0316"
     CDS             305962..306654
                     /gene="cpsC"
                     /locus_tag="SPG_0316"
                     /note="Bentley, S.D.; 2006 PLOS Genetics 2: 0262-0269
                     Guidolin,A.; 1994 Inf.Imm. 62:5384-5396; identified by
                     match to protein family HMM PF02706; match to protein
                     family HMM TIGR01006"
                     /codon_start=1
                     /transl_table=11
                     /product="capsular polysaccharide biosynthesis protein
                     wzh"
                     /protein_id="ACF54798.1"
                     /translation="MKEQNTLEIDVLQLFRALWKRKLVILLVAIITSSVAFAYSTFVI
                     KPEFTSMTRIYVVNRDQGEKSGLTNQDLQAGSSLVKDYREIILSQDVLEEVVSDLKLD
                     LTPKDLANKIKVTVPVDTRIVSVSVSDRVPEEASRIANSLREVAAQKIISITRVSDVT
                     TLEEARPATSPSSPNIKRSTLIGFLAGVIGTSVIVLILELLDTRVKRPKDIEDTLQMT
                     LLGIXPNLNKLK"
     gene            306664..307347
                     /gene="cpsD"
                     /locus_tag="SPG_0317"
     CDS             306664..307347
                     /gene="cpsD"
                     /locus_tag="SPG_0317"
                     /EC_number="2.7.10.2"
                     /note="Bentley, S.D.; 2006 PLOS Genetics 2: 0262-0269
                     Guidolin,A.; 1994 Inf.Imm. 62:5384-5396; identified by
                     match to protein family HMM TIGR01007"
                     /codon_start=1
                     /transl_table=11
                     /product="tyrosine-protein kinase wze"
                     /protein_id="ACF55553.1"
                     /translation="MPTLEIAQKKLEFVKKAEEYYNALCTNIQLSGDKLKVISVTSVN
                     PGEGKTTTSVNIARSFARAGYKTLLIDGDTRNSVMSGFFKSREKITGLTEFLSGTADL
                     SHGLCDTNIENLFVVQSGTVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTAPIGIVI
                     DAAIITQKCDASILVTATGEVNKRDVQKAKQQLEQTGKLFLGVVFNKLDISVDKYGVY
                     GFYGNYGKK"
     gene            307363..308730
                     /gene="cpsE"
                     /locus_tag="SPG_0318"
     CDS             307363..308730
                     /gene="cpsE"
                     /locus_tag="SPG_0318"
                     /note="identified by match to protein family HMM PF02397;
                     match to protein family HMM TIGR03025"
                     /codon_start=1
                     /transl_table=11
                     /product="undecaprenylphosphate glucosephosphotransferase
                     WchA"
                     /protein_id="ACF56562.1"
                     /translation="MDEKGLKIFLAVLQSIIVILLVYFLSFVRETELERSSMVILYLL
                     HFFVFYFSSYGNNFFKRGYLVEFNSTIRYIFFFAIAISVLNFFIAERFSISRRGMVYF
                     LTLEGISLYLLNFLVKKYWKHVFFNLKNSKKILLLTVTKNMEKVLDKLLESDELSWKL
                     VAVSVLDKSDFQHDKIPVIEKEKIIEFATHEVVDEVFVNLPGESYDIGEIISRFETMG
                     IDVTVNLKAFDKNLGRNKQIHEMVGLNVVTFSTNFYKTSHVIAKRIIDVMGALVGLIL
                     CGLVSIVLVPLIRKDGGSAIFAQTRIGKNGRQFTFYKFRSMCVDAEAKKRELMEQNTM
                     QGGMFKVDDDPRITKIGRFIRKTSLDELPQFYNVLKGDMSLVGTRPPTVDEYVQYTSE
                     QKRRLSFKPGITGLWQVSGRSKITDFDDVVKLDVAYIDNWTIWKDIEILLKTVKVVFM
                     RDGAK"
     gene            308734..309477
                     /gene="cpsF"
                     /locus_tag="SPG_0319"
     CDS             308734..309477
                     /gene="cpsF"
                     /locus_tag="SPG_0319"
                     /note="Bentley, S.D.; 2006 PLOS Genetics 2: 0262-0269
                     Guidolin,A.; 1994 Inf.Imm. 62:5384-5396; identified by
                     match to protein family HMM PF03808; match to protein
                     family HMM TIGR00696"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetyl-D-mannosamine transferase wchO"
                     /protein_id="ACF55683.1"
                     /translation="MRDRIQLLGVTIDLLTMNETIDIVEQYVLEKRPLHLMGVNADKI
                     NQCHTDEKIKKIVNESGIINADGASVVLASKFLGTPVPERVAGIDLMQCLLELSNKKG
                     YSVYFFGAKEEVLQDMLKVFKRDYPNLIVIGHRNGYFSEEDEQAIQEDIREKNPDFVF
                     IGITSPKKEYIIQKFMDSGVNSVFMGVGGSFDVLSGHIQRAPLWMQKSNLEWLFRVAN
                     EPKRLFKRYFVGNISFIGKVLKAKRGVKY"
     gene            309474..310298
                     /gene="cpsG"
                     /locus_tag="SPG_0320"
     CDS             309474..310298
                     /gene="cpsG"
                     /locus_tag="SPG_0320"
                     /note="Bentley, S.D.; 2006 PLOS Genetics 2: 0262-0269
                     Guidolin,A.; 1994 Inf.Imm. 62:5384-5396; identified by
                     match to protein family HMM PF04991"
                     /codon_start=1
                     /transl_table=11
                     /product="putative LicD-family phosphotransferase wchP"
                     /protein_id="ACF56307.1"
                     /translation="MNQTEMIRLIQKVELDAIKEFKKICEENDIDFFLRGGSVLGAVK
                     YDGFIPWDDDMDIAVPREAYDKLPSVFKDRIIAGKYQVLTYQYCDTLHCYFPRLFLLE
                     DERKRLGLPRNTNLGLHLIDIIPLDGAPNHSVLRKIYFGKVYWYRFLASLGTTYVGDH
                     VDMHSTKQKLIIGFFKKLGFAKLFPQNSVYRRLDNLYKKYDWKKQKYAGTINASLFAK
                     EVMPVEIWGEGVEKPFEDTFFKVPTEYDRYLKRLYGENYLYEEPSDDEKKSHLGGH"
     gene            310300..311178
                     /gene="cpsH"
                     /locus_tag="SPG_0321"
     CDS             310300..311178
                     /gene="cpsH"
                     /locus_tag="SPG_0321"
                     /note="Bentley, S.D.; 2006 PLOS Genetics 2: 0262-0269
                     Guidolin,A.; 1994 Inf.Imm. 62:5384-5396; identified by
                     match to protein family HMM PF00535"
                     /codon_start=1
                     /transl_table=11
                     /product="putative rhamnosyl transferase wchQ"
                     /protein_id="ACF56784.1"
                     /translation="MFCYIILHYKVLEETISCVKSIKEGNYNAKQIVIIDNFSNNGTG
                     EKLQELYESDLEIDVLINHENAGFARGNNVAYQFAKEKYNPDFMVIMNNDIEIETENF
                     EKIVTDIYREEKFHLLGPDIFSTTYQLHQNPKRLTHYTYGEVKALNEKFKKGSQVSLA
                     LKIKCWLKASKVLRTAIYQNRRKKGSVDYRKQVENPILHGSFIVYSRDFIEKEEYAFN
                     PNTFFYYETEILDYEAELKGYKRIYTPKIRVLHHQNVATNQVYTNLLEKTLFSNKCNF
                     KSTSYFLKLMKENEDV"
     gene            311179..312516
                     /gene="cpsI"
                     /locus_tag="SPG_0322"
     CDS             311179..312516
                     /gene="cpsI"
                     /locus_tag="SPG_0322"
                     /note="Bentley, S.D.; 2006 PLOS Genetics 2: 0262-0269
                     Guidolin,A.; 1994 Inf.Imm. 62:5384-5396"
                     /codon_start=1
                     /transl_table=11
                     /product="oligosaccharide repeat unit polymerase Wzy"
                     /protein_id="ACF56774.1"
                     /translation="MSYLFLLCLTLFLLTIFYFFAFIQDLIAPPVVMSVMFLISSVFA
                     LVNSKNWNIEYSGIAYILIISGIIIFSLPLMALKSPNFNTEVKIADRLIDIQFWKIAL
                     TIIIDLFILYLYRKEIYNLVLSNGYTGSNIQWFFRNATSYEGELTVRTFIRVLIRVID
                     VSAYIFGYTFINNFLIYRHKRPKDILLLVPLLIFISKTLISGGRQDIIKILIAYVIMM
                     YIQQKRKVGWNRVISHKYIHLGFVGLIAGIPAFYYSLFLAGRSTTRTLFESVSTYLGG
                     SIQHFNQYIENPLDPGEVFGSETLVPILNILGEMGLVNYRSTIHLEFRTLGVTVGNVY
                     TFFRRPLHDFGLVGMYVFVFAVXAFFAIYYLVLRKKQVGFNLDIHTXIYSYVFYWIFL
                     SSIEQYSFTMISLYTLVFIVLVYFMAIFYWCTDFKRGKLIFKISDSSIKLKEE"
     gene            312539..313960
                     /gene="cpsJ"
                     /locus_tag="SPG_0323"
     CDS             312539..313960
                     /gene="cpsJ"
                     /locus_tag="SPG_0323"
                     /note="Bentley, S.D.; 2006 PLOS Genetics 2: 0262-0269
                     Guidolin,A.; 1994 Inf.Imm. 62:5384-5396"
                     /codon_start=1
                     /transl_table=11
                     /product="flippase Wzx"
                     /protein_id="ACF56638.1"
                     /translation="MNTKIKNIITSFSYVISSNLLIVLTSSLVVLIFPKIMGVTEYSY
                     WQLYIFYLTYIGFFHLGWIDGIYLKYGGLEYTNLDRKQFYSQMILFSSFLMLISLVLF
                     TLNLITVRDENARYIYNMAIISMIVTNLRTLYVYILQMTNRLKDSSVILISDRVLYVL
                     LLFMFIVFGWHEYKVMIWADILGRTFSLMLSFWICKDIVFQPLSKFILDFKESLDNIR
                     VGINLMLSNIASSMIIGIVRMGIQWNWNIETFGKVSLTLSISNLLMTFINAIGLVIFP
                     LIKRTKTENLPKIYSNLRNALMLVMFAILLFYYPLKFILDIWLPAYKDALVFMALIFP
                     MSVYEGKMALVINTYLKAMRMEKDILKINALVMLTSMVVTLVTTLLLNNLGLTVVSIV
                     ILLALRSIIAELILSKKLKISVKQDIALELLMTIIFISSSWYLSIWIAVIIYLLAYTL
                     YLYLKHKDIRMYIEYFKNHKKIS"
     gene            314024..315112
                     /gene="cpsK"
                     /locus_tag="SPG_0324"
     CDS             314024..315112
                     /gene="cpsK"
                     /locus_tag="SPG_0324"
                     /EC_number="5.1.3.14"
                     /note="Bentley, S.D.; 2006 PLOS Genetics 2: 0262-0269
                     Guidolin,A.; 1994 Inf.Imm. 62:5384-5396; identified by
                     match to protein family HMM PF02350; match to protein
                     family HMM TIGR00236"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylglucosamine 2-epimerase mnaA"
                     /protein_id="ACF56468.1"
                     /translation="MKKIMLVFGTRPEAIKMCSLVNELRKQEDMKTVVCVTGQHKEMV
                     SPVLDLFGVQPDYDLEIMKANQNLFSITISILEKIKPVLEKEQPDIVLVHGDTTTTYA
                     AALAAFYLGIKVGHVEAGLRTYNLQSPFPEEFNRQSTSIIANYHFAPTELAKENLIKE
                     GRNNIYVTGNTVIDALTTTVQKDYTHPDLDLNDGNRLILLTAHRRENLGEPMRHMFRA
                     VKRVLNEYDDVKVIYPIHKNPLVRETATEIFGDTERIQIIEPLDVLDFHNFMNHSYMI
                     LTDSGGVQEEAPSLGKPVLVMRDTTERPEGVAAGTLKLVGTDEETIYQNFKMLLDDPE
                     EYKKMSQASNPYGNGDASKQIVRILRGI"
     gene            315151..316020
                     /gene="cpsL"
                     /locus_tag="SPG_0325"
     CDS             315151..316020
                     /gene="cpsL"
                     /locus_tag="SPG_0325"
                     /note="Bentley, S.D.; 2006 PLOS Genetics 2: 0262-0269
                     Guidolin,A.; 1994 Inf.Imm. 62:5384-5396; identified by
                     match to protein family HMM PF00483; match to protein
                     family HMM TIGR01207"
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-1-phosphate thymidyl transferase rmlA"
                     /protein_id="ACF55273.1"
                     /translation="MKGIILAGGSGTRLYPLTRAASKQLMPVYDKPMIYYPLSTLMLA
                     GIRDILIISTPQDLHRFQELLQDGSEFGLKLSYAEQPSPDGLAQAFIIGEEFISDDSV
                     ALILGDNIYHGSGLSKMLQKAASKESGATVFGYHVKDPERFGVVEFDQDMKAISIEEK
                     PEQPRSNYAVTGLYFYDNDVVEIAKSIKPSPRGELEITDVNKAYLDRGDLSVELMGRG
                     FAWLDTGTHESLLEASQYIETVQRMQNVQVANLEEIAYRMGYISREDVLALAQPLKKN
                     EYGQYLLRLIGEA"
     gene            316021..316617
                     /gene="cpsM"
                     /locus_tag="SPG_0326"
     CDS             316021..316617
                     /gene="cpsM"
                     /locus_tag="SPG_0326"
                     /note="Bentley, S.D.; 2006 PLOS Genetics 2: 0262-0269
                     Guidolin,A.; 1994 Inf.Imm. 62:5384-5396; identified by
                     match to protein family HMM PF00908"
                     /codon_start=1
                     /transl_table=11
                     /product="dTDP-4-keto-6-deoxyglucose-3,5-epimerase rmlC"
                     /protein_id="ACF55530.1"
                     /translation="MTDNFFGKTLAARKVEAIPGMLEFDIPVHGDNRGWFKENFQKEK
                     MLPLGFPESFFAEGKLQNNVSFSRKNVLRGLHAEPWDKYISVADGGKVLGSWVDLREG
                     ETFGNTYQTVIDASKGIFVPRGVANGFQVLSDTVSYSYLVNDYWALELKPKYAFVNYA
                     DPSLGIEWENIAEAEVSEADKHHPLLKDVKPLKKEDLE"
     gene            316627..317676
                     /gene="cpsN"
                     /locus_tag="SPG_0327"
     CDS             316627..317676
                     /gene="cpsN"
                     /locus_tag="SPG_0327"
                     /EC_number="4.2.1.46"
                     /note="identified by match to protein family HMM PF01073;
                     match to protein family HMM PF01370; match to protein
                     family HMM PF04321; match to protein family HMM PF07993;
                     match to protein family HMM TIGR01181"
                     /codon_start=1
                     /transl_table=11
                     /product="dTDP-glucose 4,6-dehydratase rmlB"
                     /protein_id="ACF56024.1"
                     /translation="MTEYKNIIVTGGAGFIGSNFVHYVYENFPDVHVTVLDKLTYAGN
                     RANIEEILGNRVELVVGDIADAELVDKLAAQADAIVHYAAESHNDNSLNDPSPFIHTN
                     FIGTYTLLEAARKYDIRFHHVSTDEVYGDLPLREDLPGHGEGPGEKFTAETKYNPSSP
                     YSSTKAASDLIVKAWVRSFGVKATISNCSNNYGPYQHIEKFIPRQITNILSGIKPKLY
                     GEGKNVRDWIHTNDHSSGVWTILTKGQIGETYLIGADGEKNNKEVLELILKEMGQAAD
                     AYDHVTDRAGHDLRYAIDASKLRDELGWKPEFTNFEAGLKATIKWYTDNQEWWKAEKE
                     AVEANYAKTQEIITV"
     gene            317742..318593
                     /gene="cpsO"
                     /locus_tag="SPG_0328"
     CDS             317742..318593
                     /gene="cpsO"
                     /locus_tag="SPG_0328"
                     /note="Bentley, S.D.; 2006 PLOS Genetics 2: 0262-0269
                     Guidolin,A.; 1994 Inf.Imm. 62:5384-5396; identified by
                     match to protein family HMM PF01073; match to protein
                     family HMM PF01370; match to protein family HMM PF02719;
                     match to protein family HMM PF04321; match to protein
                     family HMM PF07993; match to protein family HMM TIGR01214"
                     /codon_start=1
                     /transl_table=11
                     /product="dTDP-4-keto-L-rhamnose reductase rmlD"
                     /protein_id="ACF56619.1"
                     /translation="MILITGANGQLGTELRYLLDERNEEYVAVDVAEMDITDAEMVEK
                     VFEEVKPTLVYHCAAYTAVDAAEDEGKELDFAINVTGTKNVAKASEKHGATLVYISTD
                     YVFDGKKPVGQEWEVDDRPDPQTEYGRTKRMGEELVEKHVSNFYIIRTAWVFGNYGKN
                     FVFTMQNLAKTHKTLTVVNDQYGRPTWTRTLAEFMTYLAENRKEFGYYHLSNDATEDT
                     TWYDFAVEILKDTDVEVNPVDSSQFPAKAKRPLNSTMSLAKAKATGFVIPTWQDALQE
                     FYKQEVR"
     gene            318656..319102
                     /locus_tag="SPG_0329"
     CDS             318656..319102
                     /locus_tag="SPG_0329"
                     /note="identified by match to protein family HMM PF03050"
                     /codon_start=1
                     /transl_table=11
                     /product="IS66-Spn1, transposase"
                     /protein_id="ACF55605.1"
                     /translation="MYDYLVVVLVSLAHSFGSVSIIAHTIHQKFNLKVPNYRQEEDWA
                     RMGLPITRKEISNWHIKASQYYLESLYKLLREKLLEQPLLPADETSYRVLESDSHLTY
                     YWTFLSGKAENQAITLYHHGQCRSGLVVQEFLGDYSGYVHCDMLRQ"
     gene            319412..319624
                     /locus_tag="SPG_0330"
     CDS             319412..319624
                     /locus_tag="SPG_0330"
                     /codon_start=1
                     /transl_table=11
                     /product="IS66-Spn1, transposase"
                     /protein_id="ACF56240.1"
                     /translation="MEDFFAWCRRQSVLSGSKLGRAIEYSLKYKETFKTILKDGHLVL
                     SNNLAECAIKSLVMGRSKRVQWTLLA"
     gene            319695..319853
                     /locus_tag="SPG_0331"
     CDS             319695..319853
                     /locus_tag="SPG_0331"
                     /codon_start=1
                     /transl_table=11
                     /product="IS66-Spn1, transposase"
                     /protein_id="ACF56837.1"
                     /translation="MSLLETAKRHQLNSEKYLFYLLECLPNEETLVNKEVLEAYLPWT
                     KVVQEKCK"
     gene            320052..322034
                     /gene="aliA"
                     /locus_tag="SPG_0332"
     CDS             320052..322034
                     /gene="aliA"
                     /locus_tag="SPG_0332"
                     /note="identified by match to protein family HMM PF00496"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein -
                     oligopeptide transport"
                     /protein_id="ACF56247.1"
                     /translation="MKSSKLLALAGVTLLAATTLAACSGSGSSTKGEKTLSYIYETDP
                     DNLNYLTTAKAATANITSNVVDGLLENDRYGNFVPSMAEDWSVSKDGLTYTYTIRKDA
                     KWYTSEGEEYAAVKAQDFVTGLKYAADKKSDALYLVQESIKGLDAYVKGEIKDFSQVG
                     IKALDDQTVQYTLNKPESFWNSKTTMGVLAPVNEEFLNSKGDDFAKATDPSSLLYNGP
                     YLLKSIVTKSSVEFAKNPNYWDKDNVHIDKVKLSFWDGQDTSKPAENFKDGSLTAARL
                     YPTSASFAELEKSMKDNIVYTQQDSITYLVGTNIDRQSYKYTSKTSDEQKASTKKALL
                     NKDFRQAIAFGFDRTAYASQLNGQTGASKILRNLFVPPTFVQADGKNFGDMVKEKLVT
                     YGDEWKDVNLADSQDGLYNPEKAKAEFAKAKSALQAEGVTFPIHLDMPVDQTATTKVQ
                     RVQSMKQSLEATLGADNVIIDIQQLQKDEVNNITYFAENAAGEDWDLSDNVGWGPDFA
                     DPSTYLDIIKPSVGESTKTYLGFDSGEDNVAAKKVGLYDYEKLVTEAGDEATDVAKRY
                     DKYAAAQAWLTDSALIIPTTSRTGRPILSKMVPFTIPFALSGNKGTSEPILYKYLELQ
                     DKAVTVDXYQKAQEKWMKEKEESNKKAQEDLAKHVK"
     gene            322335..327638
                     /locus_tag="SPG_0333"
     CDS             322335..327638
                     /locus_tag="SPG_0333"
                     /note="identified by match to protein family HMM PF00754;
                     match to protein family HMM PF04650; match to protein
                     family HMM TIGR01167; match to protein family HMM
                     TIGR01168"
                     /codon_start=1
                     /transl_table=11
                     /product="cell wall surface anchor family protein"
                     /protein_id="ACF55808.1"
                     /translation="MNKGLFEKRCKYSIRKFSLGVASVMIGAAFFGTSPVLADSVQSG
                     STANLPADLATALATAKENDGRDFEAPKVGGDQGSPEVTDGPKTEEELLALEKEKPAE
                     EKPKEDKPAAAKPETPKTVTPEWQTVEKKEQQGTVTIREEKGVRYNQLSSTAQNDNAG
                     KPALFEKKGLTVDANGNATVDLTFKEDSEKGKSRFGVFLKFKDTNNNVFVGYDKDGWF
                     WEYKTPGNSTWYKGNRVVAPEPGSVNRLSITLKSDGQLNASNNDVNLFDTVTLPGAVN
                     DNLKNEKKILLKAGTYGNDRTVVSVKTDNQEGVKADDTPAQKETGPVVDDSKVTYDTI
                     QSKVLKAVIDQAFPRVKEYSLNGHTLPGQVQQFNQVFINNHRITPEVTYKKINETTAE
                     YLMKLRDDAHLINAEMTVRLQVVDNQLHFDVTKIVNHNQVTPGQKIDDERKLLSSISF
                     LGNALVSVSSDQTGAKFDGATMSNNTHVSGDDHIDVTNPMKDLAKGYMYGFVSTDKLA
                     AGVWSNSQNSYGGGSNDWTRLTAYKETVGNANYVGIHSSEWQWEKAYKGIVFPEYTKE
                     LPSAKVVITEDANADKNVDWQDGAIAYRSIMNNPQGWEKVKDITAYRIAMNFGSQAQN
                     PFLMTLDGIKKINLHTDGLGQGVLLKGYGSEGHDSGHLNYADIGKRIGGVEDFKTLIE
                     KAKKYGAHLGIHVNASETYPESKYFNEKILRKNPDGSYSYGWNWLDQGINIDAAYDLA
                     HGRLARWEDLKKKLGDGLDFIYVDVWGNGQSGDNGAWATHVLAKEINKQGWRFAIEWG
                     HGGEYDSTFHHWAADLTYGGYTNKGINSAITRFIRNHQKDAWVGDYRSYGGAANYPLL
                     GGYSMKDFEGWQGRSDYNGYVTNLFAHDVMTKYFQHFTVSKWENGTPVTMTDNGSTYK
                     WTPEMRVELVDANNNKVVVTRKSNDVNSPQYRKRTVTLNGRVIQDGSAYLTPWNWDAN
                     GKKLSTDKEKMYYFNTQAGATTWTLPSDWAKSKVYLYKLTDQGKTEEQELTVKDGKIT
                     LXLLANQPYVLYRSKQTNPEMSWSEGMHIYDQGFNSGTLKHWTISGDASKAXIVKSQG
                     ANXMLRIQGNKEKVSLTXKLTGLKPNTKYAVYVGVDNRSNAKASITVNTGEKEVTTYT
                     NKSLALNYVKAYAHNTRRDNATVDNTSYFQNMYAFFTTGSDVSNVTLTLSREAGDQAT
                     YFDEIRTFENNSSMYGENHDTGKGTFKQDFENVAQGIFPFVVGGVEGVEDNRTHLSEK
                     HDPYTQRGWNGKKVDDVIDGNWSLKTNGLVSRRNLVYQTIPQNFRFEAGKTYRVTFEY
                     EAGSDNTYAFVVGKGEFQSGRRGTQASNLEMHELPNTWTDSKKAKKATFLVTGAETGD
                     TWVGIYSTGNASNTRGDSGGNANFRGYNDFMMDNLQIEEITLTGKMLTENALKNYLPT
                     VAMTNYTKESMDALKEAVFNLSQADDDISVEEARAEIAKIEALKNALVQKKTALVADD
                     FASLTAPAQAQEGLANAFDGNVSSLWHTSWGGGDVGKPATMVLKEPTEITGLRYVPRG
                     SGSNGNLRDVKLVVTDESGKEHTFTATDWPNNNKPKDIDFGKTIKAKKIVLTGTKTYG
                     DGGDKYQSAAELIFTRPQVAETPLDLSGYEAALVKAQKLTDKDNQEEVASVQASMKYA
                     TDNHLLTERMVEYFADYLNQLKDSATKPDAPTVEKPEFKLRSLASEQGKTPDYKQEIA
                     RPETPEQILPATGESQSDTALFLASVSLALSALFVVKTKKD"
     gene            complement(327805..329964)
                     /locus_tag="SPG_0334"
     CDS             complement(327805..329964)
                     /locus_tag="SPG_0334"
                     /note="identified by match to protein family HMM PF00905;
                     match to protein family HMM PF00912; match to protein
                     family HMM TIGR02074"
                     /codon_start=1
                     /transl_table=11
                     /product="penicillin-binding protein 1A"
                     /protein_id="ACF55591.1"
                     /translation="MNKPTILRLIKYLSISFLSLVIAAIVLGGGVFFYYVSKAPSLSE
                     SKLVATTSSKIYDNKNQLIADLGSERRVNAQANDIPTDLVKAIVSIEDHRFFDHRGID
                     TIRILGAFLRNLQSNSLQGGSTLTQQLIKLTYFSTSTSDQTISRKAQEAWLAIQLEQK
                     ATKQEILTYYINKVYMSNGNYGMQTAAQNYYGKDLRELSLPQLALLAGMPQAPNQYDP
                     YSHPEAALDRRNLVLSEMKGQGYISAEQYEKAINTPITDGLQSLKSVNSYPAYMDNYL
                     KEVIDQVEQETGYNLLTTGMDVYTNVDQEAQKHLWDIYNSDQYVSYPDDDLQVASTVV
                     DVSNGKVIAQLGARHQASNVSFGTNQAVETNRDWGSTMKPITDYAPAIEYGVYDSTAT
                     MVNDIPYNYPGTSTPVYNWDRAYFGNITLQYALQQSRNVPAVETLNKVGLDRAKNFLN
                     GLGIDYPDMHYSNAISSNTTESNKQYGASSEKMAAAFAAFANGGIYHKPMYINKIVFS
                     DGSEKEFSDAGTRAMKETTAYMMTEMMKTVLSYGTGRNAYLAWLPQAGKTGTSNYTDE
                     EIENHIKTSQFVAPDELFAGYTRKYSMAVWTGYSNRLTPLVGNGLTVAAKVYRSMMTY
                     LSEGSNPEDWNIPEGLYRNGEFVFKNGARSTWSSPAPQQPPSTESSSSSSDSSTSQSS
                     STTPSTNNSTTTNPNNNTQQSNTTPDQQNQNPQPAQP"
     gene            complement(329961..330557)
                     /gene="recU"
                     /locus_tag="SPG_0335"
     CDS             complement(329961..330557)
                     /gene="recU"
                     /locus_tag="SPG_0335"
                     /note="identified by match to protein family HMM PF03838;
                     match to protein family HMM TIGR00648"
                     /codon_start=1
                     /transl_table=11
                     /product="recombination protein U"
                     /protein_id="ACF56166.1"
                     /translation="MVNYPHKVSSQKRQTSLSQPKNFANRGMSFEKMINATNDYYLSQ
                     GLAVIHKKPTPIQIVQVDYPQRSRAKIVEAYFRQASTTDYSGVYNGYYIDFEVKETKQ
                     KRAIPMKNFHPHQIQHMEQVLAQQGICFVLLHFSSQQETYLLPAFDLIRFYHQDKGQK
                     SMPLEYIREYGYEIKAGAFPQIPYLNVIKEHLLGGKTR"
     gene            330623..331150
                     /locus_tag="SPG_0336"
     CDS             330623..331150
                     /locus_tag="SPG_0336"
                     /note="identified by match to protein family HMM PF06908"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF56673.1"
                     /translation="MATALVLGYSAFDLGLFSDKDPRLKLIKKAIRKDLEAMAADGVS
                     WLVFTGSLGFEYWVLEVAQEMKTEYGFQLATIFAFETHGENWNEGNQMKLSRFKQVDF
                     VKYAYPRYEHKGQLRDYQQFLLENTTSSYLFYDEENETKLAYFYQKMKNQEDYFIKRL
                     TFDELNELAENFSEN"
     gene            331220..331549
                     /locus_tag="SPG_0337"
     CDS             331220..331549
                     /locus_tag="SPG_0337"
                     /note="identified by match to protein family HMM PF05103"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF55008.1"
                     /translation="MASIIFSAKDIFEQEFGREVRGYNKVEVDEFLDDVIKDYETYAA
                     LVKSLRQEIADLKEELTRKPKPSPVQAEPLEAAITSSMTNFDILKRLNRLEKEVFGKQ
                     ILDNSDF"
     gene            complement(331554..331667)
                     /locus_tag="SPG_0338"
     CDS             complement(331554..331667)
                     /locus_tag="SPG_0338"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF55737.1"
                     /translation="MVSPSTNTTGITACASMDFPHEKQFSSRDYPKIAHLK"
     gene            332035..333192
                     /locus_tag="SPG_0339"
     CDS             332035..333192
                     /locus_tag="SPG_0339"
                     /note="identified by match to protein family HMM PF01170"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF56209.1"
                     /translation="MKKKFNLIATVAAGLEAVVGREVRELGYDCQVENGRVRFQGDVR
                     AIIETNLWLRAADRIKIIVGTFPAKTFEELFQGVFALDWENYLPLGARFPISKAKCVK
                     SKLHNEPSVQAISKKAVVKKLQKHYARPEGVPLMENGPEFKIEVSILKDVATVMIDTT
                     GSSLFKRGYRTEKGGAPIKENMAAAILQLSNWYPDKPLIDPTCGSGTFCIEAVMIARK
                     MAPGLRRSFAFEEWNWISDRLIQEVRTEAAKKVDRELELDIMGCDIDARMVEIAKANA
                     QAAGVAGDITFKQMRVQDLRSDKINGVIISNPPYGERLSDDAGVTKLYAEMGQVFAPL
                     KTWSKFILTSDEAFESKYGSQADKKRKLYNGTLKVDLYQYFGQRVKRQEVK"
     gene            333205..334599
                     /locus_tag="SPG_0340"
     CDS             333205..334599
                     /locus_tag="SPG_0340"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF54841.1"
                     /translation="MSKKRRNRHKKEGQEPQFDFDEAKELTVGQAIRKNEEVEAGVLP
                     EDSILDKYVKQHRDEIEADKFATRQYKKEEFVETQSLDDLIQEMREAVEKSEASSEEV
                     PSSEDILLPLPLDDEEQGLDPLLLDDENPTEMTEEVEEEQNLSRLDQEDSEKKSKKGF
                     ILTVLALVSVIICVSAYYVYRQVARSTKEIETSQSTTANQSDVDDFNTLYDAFYTDSN
                     KTALKNSQFDKLNQLKTLLDKLEGSREHTLAKSKYDSLATQIKAIQDVNAQFEKPAIV
                     DGVLDTNAKAKSDAKFTDIKTGNTELDKVLDKAISLGKSQQTSTSSSSSSQTSSSSSS
                     QASSNTTSEPKPSSSNETRSSRSEVNMGLSSAGVAVQRSASRVAYNQSAIDDSNNSAW
                     DFADGVLEQILATSRSRGYITGDQYILERVNIVNGNGYYNLYKPDGTYLFTLNCKTGY
                     FVGNGAGHADDLDY"
     gene            334675..336099
                     /gene="gnd"
                     /locus_tag="SPG_0341"
     CDS             334675..336099
                     /gene="gnd"
                     /locus_tag="SPG_0341"
                     /EC_number="1.1.1.44"
                     /note="identified by match to protein family HMM PF00393;
                     match to protein family HMM PF03446; match to protein
                     family HMM TIGR00873"
                     /codon_start=1
                     /transl_table=11
                     /product="6-phosphogluconate dehydrogenase,
                     decarboxylating"
                     /protein_id="ACF55311.1"
                     /translation="MTKANFGVVGMAVMGRNLALNIESRGYTVAIYNRSKEKTEDVIA
                     CHPEKNFVPSYDVESFVNSIEKPRRIMLMVQAGPGTDATIQALLPHLDKGDILIDGGN
                     TFYKDTIRRNEELANSGINFIGTGVSGGEKGALEGPSIMPGGQKEAYELVSDVLEEIS
                     AKAPEDGKPCVTYIGPDGAGHYVKMVHNGIEYGDMQLIAESYDLMQHLLGLSAEDMAE
                     IFTEWNKGELDSYLIEITADILSRKDDEGQDGPIVDYILDAAGNKGTGKWTSQSSLDL
                     GVPLSLITESVFARYISTYKEERVHASKVLPKPAAFNFEGDKAELIEKIRQALYFSKI
                     ISYAQGFAQLRVASKENNWNLPFADIASIWRDGCIIRSRFLQKITDAYNRDADLANLL
                     LDEYFLDVTAKYQQAVRDIVALAVQAGVPVPTFSAAITYFDSYRSADLPANLIQAQRD
                     YFGAHTYQRKDKEGTFHYSWYDEK"
     gene            336111..336800
                     /gene="ritR"
                     /locus_tag="SPG_0342"
     CDS             336111..336800
                     /gene="ritR"
                     /locus_tag="SPG_0342"
                     /note="Ulijasz et al., J Bacteriol. 2004 186(23):8123-36.;
                     identified by match to protein family HMM PF00072; match
                     to protein family HMM PF00486"
                     /codon_start=1
                     /transl_table=11
                     /product="RitR response regulator"
                     /protein_id="ACF54888.1"
                     /translation="MGKRILLLEKERNLAHFLSLELQKEQYRVDLVEEGQKALSMALQ
                     TDYDLILLNVNLGDMMAQDFAEKLSRTKPASVIMILDHWEDLQEELEVVQRFAVSYIY
                     KPVFIENLVARISAIFRGRDFIDQHCSLMKVPRTYRNLRIDVEHHTVYRGEEMIALTR
                     REYDLLATLMGSKKVLTREQLLESVWKYESATETNIVDVYIRYLRSKLDVKGQKSYIK
                     TVRGVGYTMQE"
     gene            336898..337917
                     /gene="cbpC"
                     /locus_tag="SPG_0343"
     CDS             336898..337917
                     /gene="cbpC"
                     /locus_tag="SPG_0343"
                     /note="identified by match to protein family HMM PF01473"
                     /codon_start=1
                     /transl_table=11
                     /product="choline-binding protein C"
                     /protein_id="ACF55634.1"
                     /translation="MKLLKKMMQVLLAVFFFGLLATNTVFANTTGGRFVDKDNRKYYV
                     KDDHKAIYWHKIDGKTYYFGDIGEMVVGWQYLEIPGTGYRDDLFDNRPVFEIGLQEKW
                     YYFGQDGALLEQTDKQVLEAKTSENTGKVYGEQYPLSAEKRTYYFDNNYAVKTGWIYE
                     DGNWYYLNKLGNFGDDSYNPLPIGEVAKGWTQDFHVTIDIDRSKPAPWYYLDPTTGIM
                     QTGWQYLGNKWYYLRSSGAMATGWYQEGTTWYYLDQPNGDMKTGWQYLGNKWYYLRSS
                     GAMATGWYQDGSTWYYLNTSNGDMTTGWFQVNGKWYYAYSSGALAVNTTVDGYYVNYN
                     GEWVR"
     gene            complement(338035..339267)
                     /locus_tag="SPG_0344"
     CDS             complement(338035..339267)
                     /locus_tag="SPG_0344"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF55030.1"
                     /translation="MKLFWTNNIYRQLLLNSCFSSFGDSIFYLAIINYVAQYNFAPLA
                     ILLISISEMVPLLSQLFLGILGDFQENRVKHALWIAKIKILLYAILTVFLVLSPFSLV
                     SVIMIVIINLISDTLSYLSAYMMNALYISVIKDDLHDAMGFRQSLMRVVHIVANLAGA
                     FLINVMSIQTISLINTLTFVIAFLGLYVIRHTLYEVEKRIEMSHTALSFKKYFQHLKQ
                     SLAVLLRLKDTVILLFLTTSMIAILDVSPRLIALRFIQQTLAQLSIGQLLAMLSIIIS
                     CGAILGNMTSSNLFKNIRFTHLLVFCEISLLTLITSILCQAYIVIFMTSFISSTIIGI
                     LSPRLQAAVFAHIPSDKIGTVGSALSTVDILAPSLLSLLALSIASGVSVQLALIFLYL
                     ILIALIFCQWLVKFNTHN"
     gene            340966..341145
                     /locus_tag="SPG_0345"
     CDS             340966..341145
                     /locus_tag="SPG_0345"
                     /note="identified by match to protein family HMM PF01473"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved domain protein"
                     /protein_id="ACF56872.1"
                     /translation="MLPHDFPLYLTVWSFFRRSMTTGWFQVNGRWYYAYSSGALAVNT
                     TVDGYSVNYNGEWVQ"
     gene            341267..342145
                     /gene="mvaK1"
                     /locus_tag="SPG_0346"
     CDS             341267..342145
                     /gene="mvaK1"
                     /locus_tag="SPG_0346"
                     /EC_number="2.7.1.36"
                     /note="identified by match to protein family HMM PF00288;
                     match to protein family HMM PF08544; match to protein
                     family HMM TIGR00549"
                     /codon_start=1
                     /transl_table=11
                     /product="mevalonate kinase"
                     /protein_id="ACF56394.1"
                     /translation="MTKKVGVGQAHSKIILIGEHAVVYGYPAISLPLLEVEVTCKVVP
                     AESPWRLYEEDTLSMAVYASLEYLNITEACIRCEIDSAIPEKRGMGSSAAISIAAIRA
                     VFDYYQADLPHDVLEILVNRAEMIAHMNPSGLDAKTCLSDQPIRFIKNVGFTELEMDL
                     SAYLVIADTGVYGHTREAIQVVQNKGKDALPFLHALGELTQQAEVAISQKDAEGLGQI
                     LSQAHLHLKEIGVSSLEADSLVETALSHGALGAKMSGGGLGGCIIALVTNLTHAQELA
                     ERLEEKGAVQTWIESL"
     gene            342127..343080
                     /gene="mvaD"
                     /locus_tag="SPG_0347"
     CDS             342127..343080
                     /gene="mvaD"
                     /locus_tag="SPG_0347"
                     /EC_number="4.1.1.33"
                     /note="identified by match to protein family HMM PF00288;
                     match to protein family HMM PF08544; match to protein
                     family HMM TIGR01240"
                     /codon_start=1
                     /transl_table=11
                     /product="mevalonate diphosphate decarboxylase"
                     /protein_id="ACF55909.1"
                     /translation="MDREPVTVRSYANIAIIKYWGKKKEKEMVPATSSISLTLENMYT
                     ETTLSPLPANVTADEFYINGQLQNEVEHAKMSKIIDRYRPAGEGFVRIDTQNNMPTAA
                     GLSSSSSGLSALVKACNAYFKLGLDRSQLAQEAKFASGSSSRSFYGPLGAWDKDSGEI
                     YPVETDLKLAMIMLVLEDKKKPISSRDGMKLCVETSTTFDDWVRQSEKDYQDMLIYLK
                     ENDFAKIGELTEKNALAMHATTKTARPAFSYLTDASYEAMDFVRQLREKGEACYFTMD
                     AGPNVKVFCQEKDLEHLSEIFGQRYRLIVSKTKDLSQDDCC"
     gene            343067..344074
                     /gene="mvaK2"
                     /locus_tag="SPG_0348"
     CDS             343067..344074
                     /gene="mvaK2"
                     /locus_tag="SPG_0348"
                     /EC_number="2.7.4.2"
                     /note="identified by match to protein family HMM PF00288;
                     match to protein family HMM PF08544; match to protein
                     family HMM TIGR01220"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphomevalonate kinase"
                     /protein_id="ACF56576.1"
                     /translation="MIAVKTCGKLYWAGEYAILEPGQLALIKDIPIYMRAEIAFSDSY
                     RIYSDMFDFAVDLRPNPDYSLIQETIALMGDFLAVRGQNLRPFSLEICGKMEREGKKF
                     GLGSSGSVVVLVVKALLALYNLSIDQNLLFKLTSAVLLKRGDNGSMGDLACIVAEDLV
                     LYQSFARQKVAAWLKEEKLATVLERDWGFSISQVRPTLECDFLVGWTKEVAVSSHMVQ
                     QIKQNINQNFLTSSKETVVSLVEALEQGKSEKIIEQVEVASKLLEGLSTDIYTPLLRQ
                     LKEASQDLQAVAKSSGAGGGDCGIALSFDAQSTKTLKNRWADLGIELLYQERIGHDDK
                     S"
     gene            344058..345068
                     /locus_tag="SPG_0349"
     CDS             344058..345068
                     /locus_tag="SPG_0349"
                     /EC_number="5.3.3.2"
                     /note="identified by match to protein family HMM PF01070;
                     match to protein family HMM TIGR02151"
                     /codon_start=1
                     /transl_table=11
                     /product="isopentenyl-diphosphate delta-isomerase, type 2"
                     /protein_id="ACF55936.1"
                     /translation="MTTNRKDEHILYALEQKSSYNSFDEVELIHSSLPLYNLDEIDLS
                     TEFSGRKWDFPFYINAMTGGSNKGREINQKLAQVAETCGILFVTGSYSAALKNPTDDS
                     FSVKSSHPNLLLGTNIGLDKPVELGFQTVEEMNPVLLQVHVNVMQELLMPEGERKFRS
                     WQSHLADYSKQIPVPIVLKEVGFGMDAKTIERAYEFGVRTVDLSGXGGTSFAYIENRR
                     SGQRDYLNQWGQXTMQALLNAQEWKDKVELLVSGGVRNPLDMIKCLVFGAKAVGLSRT
                     VLELVETYTVEEVIGIVQGWKADLRLIMCSLNCATIADLQKVDYLLYGKLKEANDQMK
                     KA"
     gene            345146..345844
                     /locus_tag="SPG_0350"
     CDS             345146..345844
                     /locus_tag="SPG_0350"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF55636.1"
                     /translation="MRKFKIFLFIEACLLTGALILMVSEHFSRFLLILFLFLLLIRYY
                     TGKEGNNLLLVAATILFFFIVMLNPFVILAIFVAVIYSLFLLYPMMNQEKEQTNLVFE
                     EVVTVKKEKNRWFGNLHHFSSYQTCQFDDINLFRFMGKDTIHLERVILTNHDNVIILR
                     KMVGTTKIIVPVDVEVSLSVNCLYGDLTFFNQPKRALRNEHYHQETKDYLKSNKSVKI
                     FLTTMIGDVEVVRG"
     gene            345841..346836
                     /locus_tag="SPG_0351"
     CDS             345841..346836
                     /locus_tag="SPG_0351"
                     /note="identified by match to protein family HMM PF02518;
                     match to protein family HMM PF07730"
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase TCS03"
                     /protein_id="ACF55019.1"
                     /translation="MKKQAYVIIALTSFLFVFFFSHSLLEILDFDWSIFLHDVEKTEK
                     FVFLLLVFSMSMTCLLALFWRGIEELSLRKMQANLKRLLAGQEVVQVVDPDLDASFKS
                     LSGKLNLLTEALQKAENHSLAQEEEIIEKERKRIARDLHDTVSQELFAAHMILSGISQ
                     QALKLDREKMQTQLQSVTAILETAQKDLRVLLLHLRPVELEQKSLIEGIQILLKELED
                     KSDLRVSLKQNMTKLPKKIEEHIFRILQELISNTLRHAQASCLDVYLYQTDVELQLKV
                     VDNGIGFQLGSLDDLSYGLRNIKDRVEDMAGTVQLLTAPKQGLAVDIRIPLLDKE"
     gene            346850..347482
                     /locus_tag="SPG_0352"
     CDS             346850..347482
                     /locus_tag="SPG_0352"
                     /note="identified by match to protein family HMM PF00072;
                     match to protein family HMM PF00196; match to protein
                     family HMM PF08281"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator TCS03"
                     /protein_id="ACF56826.1"
                     /translation="MKILLVDDHEMVRLGLKSYFDLQDDVEVVGEASNGSQGIDLALE
                     LRPDVIVMDIVMPEMNGIDATLAILKEWPEAKILIVTSYLDNEKIMPVLDAGAKGYML
                     KTSSADELLHAVSKVAAGELAIEQEVSKKVEYHRNHMELHEELTARERDVLQLIAKGY
                     ENQRIADDLFISLKTVKTHVSNILAKLEVSDRTQAAVYAFQHHLVGHEEF"
     gene            347696..347914
                     /locus_tag="SPG_0353"
     CDS             347696..347914
                     /locus_tag="SPG_0353"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein, degenerate"
                     /protein_id="ACF56082.1"
                     /translation="MAANYLKAMQSYLKETDLPKLEQLVVTKSWWDTVDILDRVVGSL
                     VYEHPELEEIILILFENLFKPRQLYLQP"
     gene            347969..348241
                     /locus_tag="SPG_0354"
     CDS             347969..348241
                     /locus_tag="SPG_0354"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA alkylation repair enzyme"
                     /protein_id="ACF56753.1"
                     /translation="MSIKWSLSDNIWLRRVAINHQLLRKEKTNTQLMEKILLHNLNQT
                     EFFINKAIGWTLRDYSKTNPTWVTCFIEKNKERMAELSIKEASKYL"
     gene            348391..348630
                     /locus_tag="SPG_0355"
     CDS             348391..348630
                     /locus_tag="SPG_0355"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF56117.1"
                     /translation="MKKTVYKKLGISIIASTLLASQLSTVSALSVISSTGEEYEVSET
                     LEKGPGSNDSSLSEISPTYGSYYQKQSEVLSVMMI"
     gene            348711..349532
                     /gene="cbpG"
                     /locus_tag="SPG_0356"
     CDS             348711..349532
                     /gene="cbpG"
                     /locus_tag="SPG_0356"
                     /note="identified by match to protein family HMM PF00089;
                     match to protein family HMM PF01473"
                     /codon_start=1
                     /transl_table=11
                     /product="choline binding protein G"
                     /protein_id="ACF55782.1"
                     /translation="MNVEGRGSANFIKDNVLITAAHNYYRHDYGKEADDIYVLPAVSP
                     SQEPFGKIKVKEVRYLKEFRNLNSKDAREYDLALLILEEPIGAKLGTLGLPTSQKNLT
                     GITVTITGYPSYNFKIHQMYTDKKQVLSDDGMFLDYQVDTLEGSSGSTVYDASHRVVG
                     VHTLGDGANQINSAVKLNERNLPFIYSVLKGYSLEGWKKINGSWYHYRQHDKQTGWQE
                     INDTWYYLDSSGKMLTDWQKVNGKWYYLNSNGAMVTGSQTIDGKVYNFASSGEWI"
     gene            349551..349976
                     /locus_tag="SPG_0357"
     CDS             349551..349976
                     /locus_tag="SPG_0357"
                     /codon_start=1
                     /transl_table=11
                     /product="choline-binding protein F, point mutation"
                     /protein_id="ACF55177.1"
                     /translation="MKLLKKMMQVALATFFFGLLGTSTVFADDSEGWQFVQENGRTYY
                     KKGDLKETYWRVIDGKYYYFDPLSGEMVVGWQYIPAPHKGVTIGPSPRIEISLRPDWF
                     YFGQDGVLQEFVGKQVLEAKTATNTNKHHGEEYDSPAEK"
     gene            350094..350573
                     /locus_tag="SPG_0358"
     CDS             350094..350573
                     /locus_tag="SPG_0358"
                     /note="identified by match to protein family HMM PF01473"
                     /codon_start=1
                     /transl_table=11
                     /product="choline-binding protein F, point mutation"
                     /protein_id="ACF55811.1"
                     /translation="MAVGELARGWVKDSPLTYDEEKLKAAPWYYLDPTTGIMQTGWQF
                     LGNRWYYLHSSGAMATGWYKEGSTWYYLDAENGDMRTGWQYLGNKWYYLRSSGAMATG
                     WYQEGSTWYYLNASNGDMKTGWFQVNGNWYYAYDSGALAVNTTVGGYYLNYNGEWVK"
     gene            complement(350701..350850)
                     /locus_tag="SPG_0359"
     CDS             complement(350701..350850)
                     /locus_tag="SPG_0359"
                     /codon_start=1
                     /transl_table=11
                     /product="IS3-Spn1, transposase"
                     /protein_id="ACF55207.1"
                     /translation="MFYGYEKTFKSLNQLEQAIIDYIDYYNNKRIKVKLKGLSPVQYR
                     TKSFG"
     gene            complement(350834..351187)
                     /locus_tag="SPG_0360"
     CDS             complement(350834..351187)
                     /locus_tag="SPG_0360"
                     /codon_start=1
                     /transl_table=11
                     /product="IS3-Spn1, transposase"
                     /protein_id="ACF56493.1"
                     /translation="MIKVLNLQAKMRQKRKYSSHKGDVGKKAENLIQGQFEGSKTMEK
                     CYTDVTEFAIPASTQKLYLSPVLDGFNSEIIAYNLSTSPNLEQVQTMLEQAFTEKHYG
                     GVLLWDSEIGNVLWL"
     gene            complement(351409..351924)
                     /locus_tag="SPG_0361"
     CDS             complement(351409..351924)
                     /locus_tag="SPG_0361"
                     /note="identified by match to protein family HMM PF01527"
                     /codon_start=1
                     /transl_table=11
                     /product="IS3-Spn1, transposase"
                     /protein_id="ACF56042.1"
                     /translation="MKLTYDDKVQIYELRKQGYSLEKLSNKFGINNSNLRYMIKLIDR
                     YGIEFVKKGKNRYYSPDLKQEMINKVLYEGWTKDRVSLEYGLPSRTILLNWLAQYRKN
                     GYTIVEKTRGRVPKMRRKPKKRPEERTELERLQAENEYLRAEKAILKKLRELRLKEEK
                     EKEERQKLFKN"
     gene            352133..353890
                     /locus_tag="SPG_0362"
     CDS             352133..353890
                     /locus_tag="SPG_0362"
                     /EC_number="2.7.1.69"
                     /note="identified by match to protein family HMM PF02302;
                     match to protein family HMM PF02378; match to protein
                     family HMM TIGR00851"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system, IIBC component"
                     /protein_id="ACF55544.1"
                     /translation="MEEKVSLKVRVQKLGTSLSNMVMPNIGAFIAWGVLTALFIADGY
                     LPNEQLATVVGPMLTYLLPILIGYTGGYMIHGQRGAVVGAIATVGAITGSSVPMFIGA
                     MVMGPLGGWTIKKFDEKFQEKIRPGFEMLVNNFSAGLVGFALLLLAFYAIGPVVSTLT
                     GAVGNGVEAIVNARLLPMANIIIEPAKVLFLNNALNHGIFTPLGVEQVAQAGKSILFL
                     LEANPGPGLGILLAYAVFGKGSAKSSSWGAMVIHFFGGIHEIYFPYVMMKPTLFLAAM
                     AGGISGTFTFQLLDAGLKSPASPGSIIAIMATAPKGVWPHLNVLLGVLVAAVVSFLVA
                     ALILHADKSTEDSLEAAQAATQAAKGQLVSTSVDAVVSTDSVEKIIFACDAGMGSSAM
                     GASILRDKVKKAGLEIPVSNQAISNLLDTPKTLIVTQEELTPRAKDKSPSAIHVSVDN
                     FLASPRYDEIVASLTGAFPIAEIEGDIPTSAPVDSQEIDLNHIDAVVVAYGKAQGTAT
                     MGCETIRAIFRNKNIRIPVSTAKISELGEFNSKNIMIVTTISLQAEVQQAAPNSQFLI
                     VDSLVTTPEYDKMAARMYK"
     gene            353914..355869
                     /locus_tag="SPG_0363"
     CDS             353914..355869
                     /locus_tag="SPG_0363"
                     /EC_number="2.7.1.-"
                     /note="identified by match to protein family HMM PF08279"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator MtlR"
                     /protein_id="ACF55068.1"
                     /translation="MLLTKREEQLLKAFLHVGKLSMQDMTEILQVSSRTIYRTLSDLT
                     DSMEQYGIEITKHGKYYILTGELDDLPTELEVLVEYSPQERQELITYRLLTESGFVTN
                     EALQECTKVSNVTIIQDISDIDKRLLDFDLKIERQKGYRISGDSVGKRRFLAILLTNC
                     ISVADFSTGNFGSFDILEADRTRLASQIVNKQLSGFPDMDARMKMFFAILLSLIGQEQ
                     NIENSPNTSKQALEISQKIFQTYSKQTAQFYSIQEIIYFASILDELIIKRQDNPLFTE
                     KFDGEFFYNISNLIDTVSMYTKIDFFKDKVLFNFLFHHIRLSLGVPILFQGENLPESV
                     QILVERNKFLYTVISLLVNDIFPKYLHTEYEYGMIALHFISSLGRSPEIYPVRVLLLT
                     DERRVTRDLLVSKIKSVAPFVELIDIQSLVDYHSIDLSQYDYILSTKPLTNQEIGVIS
                     SFPTVKELLELQERLQYVQAHRTIVARDAIAPEKSYDLQDYLISSSQLLSQFELVQLE
                     NNQSFEHTVEQIIQYQKNVSDRDYLTRKLLSHFQNSPMAIPNTGLVLLHSQSSKVTTN
                     SFTMFELKLPISALSMKREEEEVKRCLLMLMSKEASEEARDLMTAISQSIIENHLYTE
                     IYKTGNQSIIYQMLNTIFNEKIKKLEN"
     gene            355871..356308
                     /locus_tag="SPG_0364"
     CDS             355871..356308
                     /locus_tag="SPG_0364"
                     /EC_number="2.7.1.-"
                     /note="identified by match to protein family HMM PF00359"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system, IIA component"
                     /protein_id="ACF56854.1"
                     /translation="MKLEKHLIKLNKQFSNKEEAICYCGQVLYEGGYVNEDYIEAMIE
                     RDKELSVYMGNFIAIPHGTDAAKNDVLKSGITVVQVPRGVDFGNVSNPQVATVLFGIA
                     GIGNEHLEIIQKISIFCADVDNVLKLADAQSKEEVLRLFDAVE"
     gene            356370..357506
                     /locus_tag="SPG_0365"
     CDS             356370..357506
                     /locus_tag="SPG_0365"
                     /EC_number="1.1.1.17"
                     /note="identified by match to protein family HMM PF01232;
                     match to protein family HMM PF08125"
                     /codon_start=1
                     /transl_table=11
                     /product="mannitol-1-phosphate 5-dehydrogenase"
                     /protein_id="ACF55348.1"
                     /translation="MKHSVHFGAGNIGRGFIGEILFKNGFHIDFVDVNNQIIHALNEK
                     GKYEIEIAQKGQSRIEVTNVAGINSKEHPEQVIEAIQKTDIITTAIGPNILPFIAELL
                     AKGIEARRVAGNTQVLDVMACENMIGGSQFLYQEVKKYLSPEGLTFADNYIGFPNAAV
                     DRIVPAQSHEDSLFVVVEPFNEWVVETKRLKNPDLRLKDVHYEEDLEPFIERKLFSVN
                     SGHATSAYIGAHYGAKTILEALQNPNIKSRIESVLAEIRSLLIAKWNFDKKELENYHK
                     VIIERFENPFIVDEVSRVARTPIRKLGYNERFIRPIRELKELSLSYKNLLKTVGYAFD
                     YRDVNDEESIRLGELLAKQSVKDVVIQVTGLDDQELIEQIVEYI"
     gene            357875..357988
                     /locus_tag="SPG_0366"
     CDS             357875..357988
                     /locus_tag="SPG_0366"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF55664.1"
                     /translation="MDCGKIVEKNNAHQFFSRPREERTKQFWNEFFRMRSI"
     gene            358292..359575
                     /gene="tig"
                     /locus_tag="SPG_0367"
     CDS             358292..359575
                     /gene="tig"
                     /locus_tag="SPG_0367"
                     /EC_number="5.2.1.8"
                     /note="identified by match to protein family HMM PF00254;
                     match to protein family HMM PF05697; match to protein
                     family HMM PF05698; match to protein family HMM TIGR00115"
                     /codon_start=1
                     /transl_table=11
                     /product="trigger factor"
                     /protein_id="ACF56272.1"
                     /translation="MSVSFENKETNRGVLTFTISQDQIKPELDRVFKSVKKSLNVPGF
                     RKGHLPRPIFDKKFGEESLYQDVMNALLPNAYEAAVKEAGLEVVAQPKIDVTSMEKGQ
                     DWVIAAEVVTKPEVKLGDYKNLEVSVDVEKEVTDADVEERIERERNNLAELVIKEAAA
                     ENGDTVVIDFVGSIDGVEFDGGKGENFSLGLGSGQFIPGFEDQLVGHSAGETVDVIVT
                     FPEDYQAEDLAGKEAKFVTTIHEVKAKEVPALDDELAKDIDEEVETLADLKEKYRKEL
                     AAAKEEAYKDAVEGAAIDTAVENAEIVELPEEMIHEEVHRSVNEFLGNLQRQGINPDM
                     YFQITGTTQEDLHNQYQAEAESRTKTNLVIEAVAKAEGFDASEEEIQKEVEQLAADYN
                     MEVAQVQSLLSADMLKHDITIKKAVELITSTATVK"
     gene            complement(359623..361989)
                     /locus_tag="SPG_0368"
     CDS             complement(359623..361989)
                     /locus_tag="SPG_0368"
                     /note="identified by match to protein family HMM
                     TIGR01448"
                     /codon_start=1
                     /transl_table=11
                     /product="helicase, RecD/TraA family"
                     /protein_id="ACF54999.1"
                     /translation="MEVYFSGTIERIIFENPSNFYRILLLEIDDTDAEDFDDFEIIVT
                     GTMADVIEGEDYTFWGQIVQHSKYGEQLQISRYDRAKPTSKGLVKYFSSSHFKGIGLK
                     TAQKIVDTYGENTIDEILQHPEKLEGIAGLSAKNREAFVSTLRLNYGTEMVLAKLANY
                     GIPNKLAFQIQDFYKEETLDVVENYPYQLVEDIKGLGFTIADQLAEELGIESQAPERF
                     RAGLVHSLFQACMETGDTYVEARDLLEQTLTLLESSRPVELDPSQVAQELSYLIEEDK
                     VQQIDTKIFDNSLFFAEEGIRSHLVRILEKGEQKSHHLETIQKHITTIEQELGIEYDN
                     IQKQAICDAIQNKVFILTGGPGTGKTTVINGIIAVYALLEGLDLRKKSNLPILLAAPT
                     GRAARRMNELTGLPSATIHRHLGMTGDDDTSHLEDYLDADFIIVDEFSMVDTWLANQL
                     FSNISSNSKILIVGDSDQLPSVSPGQVLADLLHIPLIPQTRLEKIYRQSKESTIVTLA
                     SQIRQGILPADFTQKKADRSYFEIASGHIPATIEKILGAALRNGIPARDIQVLAPMYR
                     GTAGIDAINQLMQDLLNPPQKDQLSFEAPQCHYRKRDKVIHLVNDAEINVFNGDLGAI
                     TDLIPGKYTESKQDEIVIDFDGNEVSYPRNEWYKIRLAYAMSIHKSQGSEFPVVILPI
                     TSASRRMLERNLIYTAITRAKSKLILLGELQAFDHAIQHIGTARKTYLIERFSDLLEN
                     VEEKQQAVSETVTSSASEQSYILTEENWNRIPAMIGITDTDLKEIFGK"
     gene            complement(362268..362882)
                     /locus_tag="SPG_0369"
     CDS             complement(362268..362882)
                     /locus_tag="SPG_0369"
                     /EC_number="3.4.21.89"
                     /note="identified by match to protein family HMM PF00717;
                     match to protein family HMM TIGR02227"
                     /codon_start=1
                     /transl_table=11
                     /product="signal peptidase I"
                     /protein_id="ACF55954.1"
                     /translation="MNSFKNFLKEWGLFLLILSLLALSRIFFWSNVRVEGHSMDPTLA
                     DGEILFVVKHLPIDRFDIVVAHEEDGNKDIVKRVIGMPGDTIRYENDKLYINDKETDE
                     PYLADYIKRFKDDKLQSTYSGKGFEGNKGTFFRSIAQKAQAFTVDVNYNTNFSFTVPE
                     GEYLLLGDDRLVSSDSRHVGTFKAXDITGEAKFRLWPITRIGTF"
     gene            complement(362886..363767)
                     /gene="rnhC"
                     /locus_tag="SPG_0370"
     CDS             complement(362886..363767)
                     /gene="rnhC"
                     /locus_tag="SPG_0370"
                     /EC_number="3.1.26.-"
                     /note="identified by match to protein family HMM PF01351;
                     match to protein family HMM TIGR00716"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease HIII"
                     /protein_id="ACF56508.1"
                     /translation="MASITLTPSEKDIQAFLEHYQTSLAPSKNPYIRYFLKLPQATVS
                     IYTSGKILLQGEGAEKYASFFGYQAVEQTSGQNLPLIGTDEVGNGSYFGGLAVVAAFV
                     TPDQHDFLRKLGVGDSKTLTDQKIRQIAPILKEKIQHQALLLSPSKYNEVIGDRYNAV
                     SVKVALHNQAIYLLLQKGVQPEKIVIDAFTSAKNYDKYLAQETNRFSNPISLEEKAEG
                     KYLAVAVSSVIARDLFLENLENLGRELGYQLPSGAGTASDKVASQILQAYGMQGLSFC
                     AKLHFKNTEKAKKRLER"
     gene            363854..364156
                     /locus_tag="SPG_0371"
     CDS             363854..364156
                     /locus_tag="SPG_0371"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved domain protein"
                     /protein_id="ACF55263.1"
                     /translation="MANLNRFKFTFGKKSLTLTSEHDNLFMEEIAKVATEKYQAIKEQ
                     MPSADDETIALLLAVNCLSTQLSREIEFDDKEQELEELRHKLVTCKQEQSKIEDSL"
     gene            364153..364701
                     /gene="cvpA"
                     /locus_tag="SPG_0372"
     CDS             364153..364701
                     /gene="cvpA"
                     /locus_tag="SPG_0372"
                     /note="identified by match to protein family HMM PF02674"
                     /codon_start=1
                     /transl_table=11
                     /product="CvpA family protein"
                     /protein_id="ACF55564.1"
                     /translation="MISFLLLLVLVWGFYIGYRRGLLLQVYYLISAMASAFMAGQFYK
                     GLGEQFHLLLPYANSQEDQGTFFFPSDQLFQLDKVFYAGIGYLLVFGIVYSIGRLLGL
                     LLHLIPSQKLGGKLFQVSAGILSMLVTLFVLQMALTILATIPMAVIQNPLEKSIVAKH
                     IIQSIPITTSWLKQIWVTNLIG"
     gene            364805..367141
                     /locus_tag="SPG_0373"
     CDS             364805..367141
                     /locus_tag="SPG_0373"
                     /note="function of MutS2 is unknown. It should not be
                     considered a DNA mismactch repair. MutS2 lineage is
                     currently functionally uncharacterized.; identified by
                     match to protein family HMM PF00488; match to protein
                     family HMM PF01713; match to protein family HMM TIGR01069"
                     /codon_start=1
                     /transl_table=11
                     /product="MutS2 family protein"
                     /protein_id="ACF56110.1"
                     /translation="MNKKILETLEFDKVKALFEPHLLTEQGLEQLRQLAPTAKADKIK
                     QAFAEMKEMQALFVEQPHFTILSTKEIAGVCKRLEMGADLNIEEFLLLKRVLLASREL
                     QSFYANLENVSLEELAFWFEKLHDFPQLQGNLQAFNDAGFIENFASEELARIRRKIHD
                     SESQVRDVLQDLLKQKAQMLTEGIVASRNGRQVLPVKNTYRNKIAGVVHDISASGNTV
                     YIEPREVVKLSEEIASLRADERYEMLRILQEISERVRPHAAEIANDAWIIGHLDLIRA
                     KVRFIQERQAVVPQLSENQEIQLLHVCHPLVKNAVANDVHFGQDLTAIVITGPNTGGK
                     TIMLKTLGLTQVMAQSGLPILADKGSRVGIFEEIFADIGDEQSIEQSLSTFSSHMTNI
                     VDILGKVNQHSLLLLDELGAGTDPQEGAALAMAILEDLRLRQIKTMATTHYPELKAYG
                     IETAFVQNASMEFDTATLRPTYRFMQGVPGRSNAFEIAKRLGLSEVIVGDASQQIDQD
                     NDVNRIIEQLEEQTLESRKRLDNIREVEQENLKMNRALKKLYNELNREKETELNKARE
                     QAAEIVDMALSESDQILKNLHSKSQLKPHEIIEAKAKLKKLAPEKVDLSKNKVLQKAK
                     KKRAPKVGDDIVVLSYGQRGTLTSQLKDGRWEAQVGLIKMTLEEKEFDLVQAQQEKPV
                     KKKQVNVVKRTSGRGPQARLDLRGKRYEEAMNELDTFIDQALLNNMAQVDIIHGIGTG
                     VIREGVTKYLQRNKHVKSFGYAPQNAGGSGATIVTFKG"
     gene            367483..368805
                     /locus_tag="SPG_0374"
     CDS             367483..368805
                     /locus_tag="SPG_0374"
                     /note="identified by match to protein family HMM PF01235;
                     match to protein family HMM TIGR00835"
                     /codon_start=1
                     /transl_table=11
                     /product="Sodium:alanine symporter family"
                     /protein_id="ACF56036.1"
                     /translation="MLELLKSIDDFAWGPPLLILLVGTGVYLTMRLGLLQVLRLPKAF
                     QLIFIQDKGHGDVSSFAALCTALASTVGTGNIIXVATAIXVGGPGALFWMWMAAFFGM
                     ATKYAEGLLAIKYRTKDDHGAVAGGPMHYILLGMGEKWRPLAVLFAVAGVLVALLGIG
                     TFTQVNSITESIQNTTTISPAITALVLSVFVAIAVFGGLKSISKVSTTVVPFMAIIYI
                     LGTLTVIFFNIGKIPGTIALVFTSAFSPLAAVGGFAGASVRMAIQNGVARGVFSNESG
                     LGSAPIAAAAAKTNEPVEQGLISMTGTFIDTLIICTLTGLTILVTGVWSGDLNGVALT
                     QSAFSTVFSHFGPALLTIFLVLFAFTTILGWNYYGERCFEFLFGVRFIWLYRVVFVXM
                     XLLGGFIELDMVWIIADIVNALMAXPNLIALXVLSPVVIAETKKYFDK"
     gene            369023..369571
                     /locus_tag="SPG_0375"
     CDS             369023..369571
                     /locus_tag="SPG_0375"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF55199.1"
                     /translation="MTTFTIHTVESAPAEVKEILETVEKDNNGYIPNLIGLLANAPTV
                     LEAYQIVSSIHRRNSLTPVEREVVQITAAVTNGCAFCVAGHTAFSIKQIQMNDDLIQA
                     LRNRTPIETDPKLDTLAKFTLAVINTKGRVGDEALSEFLEAGYTQQNALDVVFGVSLA
                     ILCNYANNLANTPINPELQPYA"
     gene            369681..370580
                     /locus_tag="SPG_0376"
     CDS             369681..370580
                     /locus_tag="SPG_0376"
                     /note="identified by match to protein family HMM PF03595"
                     /codon_start=1
                     /transl_table=11
                     /product="exfoliative toxin A, putative"
                     /protein_id="ACF55651.1"
                     /translation="MKKLPLVFSGCLLGLAGAGNLILDTLPVLSHLFSLTGLVLWIYF
                     LILHLFNWKETKQELTKPPLLSGMATFPMAGMILSTYVFRVFSYLPLVAQGIWWFSFL
                     LDLTLIAGFTIKFACPGRRVHATPSWTVLYVGIAVAALTYPLVGIIEIAYATLSFGFL
                     LTFYLYPLIYSDLKKHPLPLALLGQEGIYCAPFSLLLASLVRVGGTSLPTWVLIVMIL
                     ASQSFFFFVLTRLPNILKQGFQPAFSALTFPTIITATSLKMAQGILKLPFLDYLVLAE
                     TIICLTILFFVLGAYLIWLRKKV"
     gene            complement(370605..371879)
                     /gene="serS"
                     /locus_tag="SPG_0377"
     CDS             complement(370605..371879)
                     /gene="serS"
                     /locus_tag="SPG_0377"
                     /EC_number="6.1.1.11"
                     /note="identified by match to protein family HMM PF00587;
                     match to protein family HMM PF02403; match to protein
                     family HMM TIGR00414"
                     /codon_start=1
                     /transl_table=11
                     /product="seryl-tRNA synthetase"
                     /protein_id="ACF55879.1"
                     /translation="MLDIKRIRTDFEAVAEKLATRGVDAAVLNEMKEIDAKRRNILIK
                     VETLKAERNTVSAEIAQAKRNKENTDDKIAAMQNLSAEVKALDAELAEIDAKLTEFTT
                     TLPNIPADSVPVGADXXXNVEVRRWGTPREFDFEPKAHWDLGEDLGILDWERGGKVTG
                     ARFLFYKGLGARLERAIYNFMLDEHGKEGYTEVITPYIVNHDSMFGTGQYPKFKEDTF
                     ELSDTNFVLIPTAEVPLTNYYRDEILDGKDLPIYFTAMSPSFRSEAGSAGRDTRGLIR
                     LHQFHKVEMVKFAKPEESYEELEKMTANAENILQKLNLPYRVVALSTGDMGFSATKTY
                     DLEVWIPAQNNYREISSCSNTEDFQARRAQIRYRDEADGKVKLLHTLNGSGLAVGRTV
                     AAILENYQNEDGSVTIPEALRPYMGGAEVIKP"
     gene            complement(372093..372464)
                     /locus_tag="SPG_0378"
     CDS             complement(372093..372464)
                     /locus_tag="SPG_0378"
                     /note="identified by match to protein family HMM PF06115"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF56874.1"
                     /translation="MAQSLNKTVLLSTTGTSYLSIAGKVGKFLVGDQXLEFYPDVNVE
                     QFIQIPWSHINQIGANVTGRKISRHFEVFTDKGKFLFASKDSGAILKIARKKLGNDKV
                     VKLPTLIQTISQKFKNLFAKK"
     gene            complement(372467..373831)
                     /locus_tag="SPG_0379"
     CDS             complement(372467..373831)
                     /locus_tag="SPG_0379"
                     /note="identified by match to protein family HMM PF00696;
                     match to protein family HMM PF01842; match to protein
                     family HMM TIGR00657"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate kinase"
                     /protein_id="ACF54768.1"
                     /translation="MKVVKFGGSSLASASQLEKVLNIVKSDSERRFVVVSAPGKRNAE
                     DTKVTDALIKYYRDYVAGNDISKSQSWIIDRYAAMVSELGLKPAVLEKISXSIHALAT
                     LPIEENEFLYDTFLAAGENNNAKLIAAYFNQNGIDARYMHPREAGIVVTSEPGHARII
                     PSSYDKIEELTNTNEVLVIPGFFGVTKENQICTFSRGGSDITGSIIAAGVKXDLYENF
                     TDVDGIFAAHPGIIHQPHSIPELTYREMRELAYAGFSVLHDEALLPAYRGKIPLVIKN
                     TNNPDHPGTRIVLKHSNDEFPVVGIAGDSGFVSINMSKYLMNREVGFGRKVLQILEEL
                     NIGWEHMPTGIDDLSIILRSRQLTPIKEEEILRQLVQKAKVDHAEIEHDLSIIMIVGE
                     KMKSHIGVTATATRALSENKINIQMMSQGSSEVSIMFVVNKDQEKAAIKALYNAFFGE
                     SKED"
     gene            complement(373915..374208)
                     /locus_tag="SPG_0380"
     CDS             complement(373915..374208)
                     /locus_tag="SPG_0380"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF55417.1"
                     /translation="MFHQGSFLFYKQFILFENLFKPRQLPSATSKQYFELTSSVLFTT
                     SKQCFEQSAASFLVCSLISLSVKLFHCQSISFLGAESKKKSTESVSADKKGSL"
     gene            374200..375009
                     /gene="fabM"
                     /locus_tag="SPG_0381"
     CDS             374200..375009
                     /gene="fabM"
                     /locus_tag="SPG_0381"
                     /note="Marrakchi, H.; 2002 J.Bio.Chem 277:44809-44816;
                     identified by match to protein family HMM PF00378"
                     /codon_start=1
                     /transl_table=11
                     /product="trans-2, cis-3-decenoyl-ACP isomerase"
                     /protein_id="ACF55486.1"
                     /translation="MEHIIYQLEEDLAILTLNRPEVANGFHIPMCEEILEALTLAEEN
                     PAVHFILINANGKVFSVGGDLVEMKRAVDEDDIPSLTKIAELVNTISYKIKQIAKPVL
                     MEVDGAVAGAAANMAVAADFCLATDKAKFIQAFVGVGLAPDAGGIHLLSRSIGVTRAA
                     QLAMTGEALTAEKALEWGLVYRVSEAEKLEKTREQLLKKLRRASSNSYAAIKKLVWES
                     QFKDWQGYATLELNLQKSLAQTEDFKEGVRAHSERRRPKFTRKIKNTCIIL"
     gene            375080..375514
                     /gene="fabT"
                     /locus_tag="SPG_0382"
     CDS             375080..375514
                     /gene="fabT"
                     /locus_tag="SPG_0382"
                     /note="Sullavik, M.C. 1995 Mol.Med.1:436-446; identified
                     by match to protein family HMM PF01047; match to protein
                     family HMM PF03965"
                     /codon_start=1
                     /transl_table=11
                     /product="fatty acid biodynthesys transcriptional
                     regulator"
                     /protein_id="ACF56396.1"
                     /translation="MDYQRINEYLTSIFNNVLVIEEVNLRGSRFKDISIKEMHTIDVI
                     GKAPDVTPSQVSKELMVTLGTVTTSLNNLERKGYIERVRSEQDRRVVHLHLTKKGRLI
                     HRLHKRFHKAMVEKIIDGMSEEEIAVMGKGLTNLYQFLEDLK"
     gene            375514..376488
                     /gene="fabH"
                     /locus_tag="SPG_0383"
     CDS             375514..376488
                     /gene="fabH"
                     /locus_tag="SPG_0383"
                     /note="identified by similarity to GB:AAK91994.1; match to
                     protein family HMM PF08541; match to protein family HMM
                     PF08545; match to protein family HMM TIGR00747"
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-(acyl-carrier-protein) synthase III"
                     /protein_id="ACF56437.1"
                     /translation="MAFAKISQVAHYVPEQVVTNHDLAQIMDTNDEWISSRTGIRQRH
                     ISRTESTSDLATEVAKKLMAKAGITGKELDFIILATITPDSMMPSTAARVQANIGANK
                     AFAFDLTAACSGFVFALSTAEKFIASGRFQKGLVIGSETLSKAVDWSDRSTAVLFGDG
                     AGGVLLEASEQEHFLAESLNSDGSRSECLTYGHSGLHSPFSDQESADSFLKMDGRTVF
                     DFAIRDVAKSIKQTIDESPIEVTDLDYLLLHQANDRILDKMARKIGVDRAKLPANMME
                     YGNTSAASIPILLSECVEQGLIPLDGSQTVLLSGFGGGLTWGTLILTI"
     gene            376548..376772
                     /gene="acpP"
                     /locus_tag="SPG_0384"
     CDS             376548..376772
                     /gene="acpP"
                     /locus_tag="SPG_0384"
                     /note="identified by match to protein family HMM PF00550"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl carrier protein"
                     /protein_id="ACF55027.1"
                     /translation="MAVFEKVQEIIVEELGKDASEVTLESTFDDLDADSLDLFQVISE
                     IEDAFDIQIEAENDLKTVGDLVAYVEEQAK"
     gene            376891..377865
                     /gene="fabK"
                     /locus_tag="SPG_0385"
     CDS             376891..377865
                     /gene="fabK"
                     /locus_tag="SPG_0385"
                     /note="identified by match to protein family HMM PF03060;
                     match to protein family HMM TIGR03151"
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-acyl carrier protein (ACP) reductase II"
                     /protein_id="ACF55489.1"
                     /translation="MKTRITELLKIDYPIFQGGMAWVADGDLAGAVSKAGGLGIIGGG
                     NAPKEVVKANIDKIKSLTDKPFGVNIMLLSPFVEDIVDLVIEEGVKVVTTGAGNPSKY
                     MERFHEAGIIVIPVVPSVALAKRMEKIGADAVIAEGMEAGGHIGKLTTMTLVRQVATA
                     ISIPVIAAGGIADGEGAAAGFMLGAEAVQVGTRFVVAKESNAHPNYKEKILKARDIDT
                     TISAQHFGHAVRAIKNQLTRDFELAEKDAFKQEDPDLEIFEQMGAGALAKAVVHGDVD
                     GGSVMAGQIAGLVSKEETAEEILKDLYYGAAKKIQEEASRWAGVVRND"
     gene            377858..378778
                     /gene="fabD"
                     /locus_tag="SPG_0386"
     CDS             377858..378778
                     /gene="fabD"
                     /locus_tag="SPG_0386"
                     /EC_number="2.3.1.39"
                     /note="identified by match to protein family HMM PF00698;
                     match to protein family HMM TIGR00128"
                     /codon_start=1
                     /transl_table=11
                     /product="malonyl CoA-acyl carrier protein transacylase"
                     /protein_id="ACF56237.1"
                     /translation="MTKTAFLFAGQGAQYLGMGRDFYDQYPIVKETIDRASQVLGYDL
                     RYLIDTEEDKLNQTRYTQPAILATSVAIYRLLQEKGYQPDMVAGLSLGEYSALVASGA
                     LDFEDAVALVAKRGAYMEEAAPADSGKMVAVLNTPVEVIEEACQKASELGVVTPANYN
                     TPAQIVIAGEVVAVDRAVELLQEAGAKRLIPLKVSGPFHTALLEPASQKLAETLAQVS
                     FSDFTCPLVGNTEAAVMQKEDIAQLLTRQVKEPVRFYESIGVMQEAGISNFIEIGPGK
                     VLSGFVKKIDQTAHLAHVEDQASLVALLEK"
     gene            378812..379543
                     /gene="fabG"
                     /locus_tag="SPG_0387"
     CDS             378812..379543
                     /gene="fabG"
                     /locus_tag="SPG_0387"
                     /EC_number="1.1.1.100"
                     /note="identified by match to protein family HMM PF00106;
                     match to protein family HMM PF07993; match to protein
                     family HMM PF08659; match to protein family HMM TIGR01830"
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-[acyl-carrier protein] reductase"
                     /protein_id="ACF56221.1"
                     /translation="MKLEHKNIFITGSSRGIGLAIAHKFAQAGANIVLNSRGAISEEL
                     LAEFSNYGIKVVPISGDVSDFADAKRMIDQAIAELGSVDVLVNNAGITQDTLMLKMTE
                     ADFEKVLKVNLTGAFNMTQSVLKPMMKAREGAIINMSSVVGLMGNIGQANYAASKAGL
                     IGFTKSVAREVASRNIRVNVIAPGMIESDMTAILSDKIKEATLAQIPMKEFGQAEQVA
                     DLTVFLAGQDYLTGQVVAIDGGLSM"
     gene            379565..380800
                     /gene="fabF"
                     /locus_tag="SPG_0388"
     CDS             379565..380800
                     /gene="fabF"
                     /locus_tag="SPG_0388"
                     /note="identified by match to protein family HMM PF00109;
                     match to protein family HMM PF02801; match to protein
                     family HMM TIGR03150"
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-(acyl-carrier-protein) synthase II"
                     /protein_id="ACF56679.1"
                     /translation="MKLNRVVVTGYGVTSPIGNTPEEFWNSLATGKIGIGGITKFDHS
                     DFDVHNAAEIQDFPFDKYFVKKDTNRFDNYSLYALYAAQEAVNHANLDVEALNRDRFG
                     VIVASGIGGIKEIEDQVLRLHEKGPKRVKPMTLPKALPNMASGNVAMRFGANGVCKSI
                     NTACSSSNDAIGDAFRSIKFGFQDVMLVGGTEASITPFAIAGFQALTALSTTEDPTRA
                     SIPFDKDRNGFVMGEGSGMLVLESLEHAEKRGATILAEVVGYGNTCDAYHMTSPHPEG
                     QGAIKAIKLALEEAEISPEQVAYVNAHGTSTPANEKGESGAIVAVLGKEVPVSSTKSF
                     TGHLLGAAGAVEAIVTIEAMRHNFVPMTAGTSEVSDYIEANVVYGQGLEKEIPYAISN
                     TFGFGGHNAVLAFKRWENR"
     gene            380803..381288
                     /gene="accB"
                     /locus_tag="SPG_0389"
     CDS             380803..381288
                     /gene="accB"
                     /locus_tag="SPG_0389"
                     /note="identified by match to protein family HMM PF00364;
                     match to protein family HMM TIGR00531"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA carboxylase, bitoin carboxyl carrier
                     protein"
                     /protein_id="ACF55420.1"
                     /translation="MNLNDIKDLMTQFDQSSLREFSYKNGTDELQFSKNEARPVPEVA
                     TQVAPAPVLATPSPVAPTSAPAETVAEEVPAPAEASVASEGNLVESPLVGVVYLAAGP
                     DKPAFVTVGDSVKKGQTLVIIEAMKVMNEIPAPKDGVVTEILVSNEEMVEFGKGLVRI
                     K"
     gene            381285..381707
                     /gene="fabZ"
                     /locus_tag="SPG_0390"
     CDS             381285..381707
                     /gene="fabZ"
                     /locus_tag="SPG_0390"
                     /EC_number="4.2.1.-"
                     /note="identified by match to protein family HMM PF07977;
                     match to protein family HMM TIGR01750"
                     /codon_start=1
                     /transl_table=11
                     /product="(3R)-hydroxymyristoyl-(acyl-carrier-protein)
                     dehydratase"
                     /protein_id="ACF55734.1"
                     /translation="MIDIQGIKEALPHRYPMLLVDRVLEVSEDTIVAIKNVTINEPFF
                     NGHFPQYPVMPGVLIMEALAQTAGVLELSKPENKGKLVFYAGMDKVKFKKQVVPGDQL
                     VMTATFVKRRGTIAVVEAKAEVDGKLAASGILTFAIGN"
     gene            381719..383086
                     /gene="accC"
                     /locus_tag="SPG_0391"
     CDS             381719..383086
                     /gene="accC"
                     /locus_tag="SPG_0391"
                     /EC_number="6.3.4.14"
                     /note="identified by match to protein family HMM PF00289;
                     match to protein family HMM PF02785; match to protein
                     family HMM PF02786; match to protein family HMM PF08443;
                     match to protein family HMM TIGR00514"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA carboxylase, biotin carboxylase"
                     /protein_id="ACF55874.1"
                     /translation="MFRKILIANRGEIAVRIIRAARELGIATVSVYSTADKEALHTLL
                     ADEAVCIGPGKATESYLNINAVLSAAVLTEAEAIHPGFGFLSENSKFATMCEEVGIKF
                     IGPSGHVMDMMGDKINARAQMIKAGVPVIPGSDGEVHNSEEALIVAEKIGYPVMLKAS
                     AGGGGKGIRKVEKPDDLVSAFETASSEAKANYGNGAMYIERVIYPARHIEVQILGDEH
                     GHVIHLGERDCSLQRNNQKVLEESPSIAIGKTLRHEIGAAAVRAAEFVGYENAGTIEF
                     LLDEASSNFYFMEMNTRVQVEHPVTEFVSGVDIVKEQICIAAGQPLSVKQEDIVLRGH
                     AIECRINAENPAFNFAPSPGKITNLYLPSGGVGLRVDSAVYPGYTIPPYYDSMIAKII
                     VHGENRFDALMKMQRALYELEIEGVQTNADFQLDLISDRNVIAGDYDTSFLMETFLPK
                     YQEKE"
     gene            383123..383989
                     /gene="accD"
                     /locus_tag="SPG_0392"
     CDS             383123..383989
                     /gene="accD"
                     /locus_tag="SPG_0392"
                     /note="identified by match to protein family HMM
                     TIGR00515"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA carboxylase beta subunit"
                     /protein_id="ACF55164.1"
                     /translation="MALFSKKDKYIRINPNRSVREKPQAKPEVPDELFSQCPGCKHTI
                     YQKDLGSERICPHCSYTFRISAQERLALTIDMGTFKELFTGIESKDPLHFPGYQKKLA
                     SMREKTGLHEAVVTGTALIKGQTVALGIMDSNFIMASMGTVVGEKITRLFEYATVEKL
                     PVVLFTASGGARMQEGIMSLMQMAKISAAVKRHSNAGLFYLTILTDPTTGGVTASFAM
                     EGDIILAEPQSLVGFAGRRVIENTVRESLPEDFQKAEFLLEHGFVDAIVKRRDLPDTI
                     ASLVRLHGGSPR"
     gene            383986..384753
                     /gene="accA"
                     /locus_tag="SPG_0393"
     CDS             383986..384753
                     /gene="accA"
                     /locus_tag="SPG_0393"
                     /EC_number="6.4.1.2"
                     /note="identified by match to protein family HMM PF03255;
                     match to protein family HMM TIGR00513"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-coenzyme A carboxylase carboxyl
                     transferase subunit alpha"
                     /protein_id="ACF56282.1"
                     /translation="MNIAKIVREAREQSRLTTLDFATGIFDEFIQLHGDRSFRDDGAV
                     VGGIGWLGDQAVTVVGIQKGKSLQDNLKRNFGQPHPEGYRKALRLMKQAEKFGRPVVT
                     FINTAGAYPGVGAEERGQGEAIARNLMEMSDLKVPIIAIIIGEGGSGGALALAVADRV
                     WMLENSIYAILSPEGFASILWKDGTRAMEAAELMKITSHELLEMDVVDKVISEIGLSS
                     KELIKSVKKELQTELARLSQKPLEELLEERYQRFRKY"
     gene            384912..385097
                     /locus_tag="SPG_0394"
     CDS             384912..385097
                     /locus_tag="SPG_0394"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF56654.1"
                     /translation="MTGTNTFTVLSTEDLEQTSGGLAVWEDGYSRWLYYREFAPYMRQ
                     GALNSYIDAWKYGFRAG"
     gene            385154..385588
                     /locus_tag="SPG_0395"
     CDS             385154..385588
                     /locus_tag="SPG_0395"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF55097.1"
                     /translation="MLIILLSTYLPQTIGLYVTIILGLGADVYSLILTMGLVGSFLLL
                     IWRLKKKKMLFIFEKKSWNWSFVFYLFATYVVYQILGNFWARYAHLINHRNIHDEYFT
                     VLFSNGQPTFLSTILSFVLPVIIGPVFEETLDRGYFMNTFFP"
     gene            complement(385887..386309)
                     /gene="nusB"
                     /locus_tag="SPG_0396"
     CDS             complement(385887..386309)
                     /gene="nusB"
                     /locus_tag="SPG_0396"
                     /note="identified by match to protein family HMM PF01029;
                     match to protein family HMM TIGR01951"
                     /codon_start=1
                     /transl_table=11
                     /product="transcription antitermination factor NusB"
                     /protein_id="ACF54894.1"
                     /translation="MTSPLLESRRQLRKCAFQALMSLEFGTDVETACRFAYTHDREDT
                     DVQLPAFLIDLVSGVQAKKEELDKQITQHLKAGWTIERLTLVERNLLRLGVFEITSFD
                     TPQLVAVNEAIELAKDFSDQKSARFINGLLSQFVTEEQ"
     gene            complement(386302..386691)
                     /locus_tag="SPG_0397"
     CDS             complement(386302..386691)
                     /locus_tag="SPG_0397"
                     /note="identified by match to protein family HMM PF03780"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF54936.1"
                     /translation="MGIEEQLGEIVIAPRVLEKIIAIATAKVEGVHSFSNRSVSDTLS
                     KLSLGRGIYLKNVDEELTADIYLYLEYGVKVPKVAVAIQKAVKDAVRNMADVELAAIN
                     IHVAGIVPDKTPKPELKDLFDEDFLND"
     gene            complement(386713..387273)
                     /locus_tag="SPG_0398"
     CDS             complement(386713..387273)
                     /locus_tag="SPG_0398"
                     /note="identified by match to protein family HMM PF01132;
                     match to protein family HMM PF08207; match to protein
                     family HMM PF09285; match to protein family HMM TIGR00038"
                     /codon_start=1
                     /transl_table=11
                     /product="translation elongation factor P"
                     /protein_id="ACF56214.1"
                     /translation="MIEASKLKAGMTFETADGKLIRVLEASHHKPGKGNTIMRMKLRD
                     VRTGSTFDTSYRPEEKFEQAIIETVPAQYLYKMDDTAYFMNTETYDQYEIPVVNVENE
                     LLYILENSDVKIQFYGTEVIGVTVPTTVELTVAETQPSIKGATVTGSGKPATMETGLV
                     VNVPDFIEAGQKLVINTAEGTYVSRA"
     gene            complement(387402..388844)
                     /gene="gatB"
                     /locus_tag="SPG_0399"
     CDS             complement(387402..388844)
                     /gene="gatB"
                     /locus_tag="SPG_0399"
                     /EC_number="6.3.5.-"
                     /note="identified by match to protein family HMM PF01162;
                     match to protein family HMM PF02637; match to protein
                     family HMM PF02934; match to protein family HMM TIGR00133"
                     /codon_start=1
                     /transl_table=11
                     /product="Asp-tRNAAsn/Glu-tRNAGln amidotransferase B
                     subunit"
                     /protein_id="ACF56666.1"
                     /translation="MNFETVIGLEVHVELNTNSKIFSPTSAHFGNDQNANTNVIDWSF
                     PGVLPVLNKGVVDAGIKAALALNMDIHKKMHFDRKNYFYPDNPKAYQISQFDEPIGYN
                     GWIEVELEDGTTKKIGIERAHLEEDAGKNTHGTDGYSYVDLNRQGVPLIEIVSEADMR
                     SPEEAYAYLTALKEVIQYAGISDVKMEEGSMRVDANISLRPYGQEKFGTKTELKNLNS
                     FSNVRKGLEYEVQRQAEILRSGGQIRQETRRYDEANKATILMRVKEGAADYRYFPEPD
                     XPLFEIXDEWIEEMRTELPEFPKERRARYVSDLGLSDYDASQLTANKVTSDFFEKAVA
                     LDGDAKQVSNWLQGEVAQFLNAEGKTLEQIELTPENLVEMIAIIEDGTISSKIAKKVF
                     VHLAKNGGGAREYVEKAGMVQISDPAILIPIIHQVFADNEAAVVDFKSGKRNADKAFT
                     GFLMKATKGQANPQVALKLLAQELAKLKEN"
     gene            complement(388844..390310)
                     /gene="gatA"
                     /locus_tag="SPG_0400"
     CDS             complement(388844..390310)
                     /gene="gatA"
                     /locus_tag="SPG_0400"
                     /EC_number="6.3.5.-"
                     /note="identified by match to protein family HMM PF01425;
                     match to protein family HMM TIGR00132"
                     /codon_start=1
                     /transl_table=11
                     /product="Asp-tRNAAsn/Glu-tRNAGln amidotransferase A
                     subunit"
                     /protein_id="ACF55261.1"
                     /translation="MTFNNKTIEELHNLLVSKEISATELTQATLENIKSREEALNSFV
                     TIAEEQALVQAKAIDEAGIDADNVLSGIPLAVKDNISTDGILTTAASKMLYNYEPIFD
                     ATAVANAKTKGMIVVGKTNMDEFAMGGSGETSHYGATKNAWDHSKVPGGSSSGSAAAV
                     ASGQVRLSLGSDTGGSIRQPAAFNGIVGLKPTYGTVSRFGLIAFGSSLDQIGPFAPTV
                     KENALLLNAIASEDAKDSTSAPVRIADFTSKIGQDIKGMKIALPKEYLGEGINPEVKE
                     TILNAAKHFEKLGAIVEEVSLPHSKYGVAVYYIIASSEASSNLQRFDGIRYGYRAEDA
                     TNLDEIYVNSRSQGFGEEVKRRIMLGTFSLSSGYYDAYYKKAGQVRTLIIQDFEKVFA
                     DYDLILGPTAPSVAYDLDSLNHDPVAMYLADLLTIPVNLAGLPGISIPAGFSQGLPVG
                     LQLIGPKYSEETIYQAAAAFEATTDYHKQQPVIFGGDN"
     gene            complement(390310..390612)
                     /gene="gatC"
                     /locus_tag="SPG_0401"
     CDS             complement(390310..390612)
                     /gene="gatC"
                     /locus_tag="SPG_0401"
                     /EC_number="6.3.5.-"
                     /note="identified by match to protein family HMM PF02686;
                     match to protein family HMM TIGR00135"
                     /codon_start=1
                     /transl_table=11
                     /product="Asp-tRNAAsn/Glu-tRNAGln amidotransferase C
                     subunit"
                     /protein_id="ACF55264.1"
                     /translation="MKITQEEVTHVANLSKLRFSEKETAAFATTLSKIVDMVELLGEV
                     DTTGVAPTTTMADRKTVLRPDVAEEGTDRDRLFKNVPKKDNYYIKVPAILDDGGDA"
     gene            390825..392369
                     /gene="prfC"
                     /locus_tag="SPG_0402"
     CDS             390825..392369
                     /gene="prfC"
                     /locus_tag="SPG_0402"
                     /note="identified by match to protein family HMM PF00009;
                     match to protein family HMM PF03144; match to protein
                     family HMM TIGR00231; match to protein family HMM
                     TIGR00503"
                     /codon_start=1
                     /transl_table=11
                     /product="peptide chain release factor 3"
                     /protein_id="ACF56317.1"
                     /translation="MNIQEEIKKRRTFAIISHPDAGKTTITEQLLYFGGEIREAGTVK
                     GKKTGTFAKSDWMDIEKQRGISVTSSVMQFDYDGKRVNXLDTPGHEDFSEDTYRTLMA
                     VDAAVMVVDSAKGIEAQTXKLFEVVKHRGIPVFTFMNKLDRDGREPLDLLQELEEILG
                     IASYPMNWPIGMGKAFEGLYDLYNQRLELYKGDERFASLEDGDKLFGSNPFYEQVKDD
                     IELLNEAGNEFSEEAILAGELTPVFFGSALTNFGVQTFLETFLKFAPEPHGHKKTDGE
                     IVDPYDKDFSGFVFKIQANMDPRHRDRIAFVRIVSGEFERGMSVNLPRTGKGAKLSNV
                     TQFMAESRENVINAVAGDIIGVYDTGTYQVGDTLTVGKNKFEFEPLPTFTPEIFMKVS
                     AKNVMKQKSFHKGIEQLVQEGAIQLYKNYQTGEYMLGAVGQLQFEVFKHRMEGEYNAE
                     VVMNPMGKKTVRWIKPEDLDERMSSSRNXLAKDRFDQPVFLFENDFALRWFADKYPDV
                     ELEEKM"
     gene            393085..393273
                     /gene="rpmB"
                     /locus_tag="SPG_0403"
     CDS             393085..393273
                     /gene="rpmB"
                     /locus_tag="SPG_0403"
                     /note="identified by match to protein family HMM PF00830;
                     match to protein family HMM TIGR00009"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal protein L28"
                     /protein_id="ACF54926.1"
                     /translation="MAKVCYFTGRKTVSGNNRSHAMNQTKRAVKPNLQKVTVLIDGKP
                     KKVWASARALKSGKVERV"
     gene            393430..393795
                     /locus_tag="SPG_0404"
     CDS             393430..393795
                     /locus_tag="SPG_0404"
                     /note="identified by match to protein family HMM PF03780"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF56466.1"
                     /translation="MTVKIXTKDGQXELTDEVIATVVGGAATEIFGVVGMASKNALKD
                     NFQALLGKENYSKGVVVKAAEDGSIAVDVYTVLSYGTKISEVSKNIQERVAFSLENQL
                     GITAQTVNVYIQNIKVVGE"
     gene            393798..395465
                     /locus_tag="SPG_0405"
     CDS             393798..395465
                     /locus_tag="SPG_0405"
                     /note="identified by match to protein family HMM PF02734;
                     match to protein family HMM TIGR03599"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF56127.1"
                     /translation="MSKITTSLFQEMVQAASTRLNKQAEYVNSLNVFPVPDGDTGTNM
                     GMTIENGAKEVADKPASTVGEVASILAKGLLMGARGNSGVITSQLFRGFSQAIKDKDE
                     LTGQDLALAFQSGVEVAYKAVMKPVEGTILTVSRGAAIGAKKKAEQTDDTVEVMRAAL
                     EGAKTALAKTPDMLPVLKEVGVVDSGGQGLVFIYEGFLSALTGEYIASEDFVATPANM
                     SEMINVEHHKSVAGHVATEDITFGYCTEIMVALKQGPTYAKDFDYDEFRNYLDELGDS
                     LLVVNDDEIVKVHVHTEDPGLVMQEGLKYGSLVKVKVDNMRNQHEAQVEKEATQVIKS
                     AEEKEYALIAVVAGKGLADIFCSQGVDYVIEGGQTMNPSTEDFIKAVEQVNARNIIFL
                     PNNKNXFMAAQSAAEVLEQPAVVVEARTLPQGMTSLLAFDPSKSIEENQERMTAALSD
                     VVSGSVTTAVRDTTIDGLEIHENDNLGMVDGKILVSNPDMHQTLTETLKHMLDEDSEI
                     VTFYVGEDGSEELANEIAQEIVEEFEDVEVEIHQGQQPVYPYLFSVE"
     gene            complement(395509..396765)
                     /locus_tag="SPG_0406"
     CDS             complement(395509..396765)
                     /locus_tag="SPG_0406"
                     /note="identified by match to protein family HMM PF01610"
                     /codon_start=1
                     /transl_table=11
                     /product="IS1167 transposase"
                     /protein_id="ACF56736.1"
                     /translation="MEQLHFITKLLDIKDPNIKILDIINMDTHKEIIAKLDYEAPSCP
                     DCGSLMKKYDFQKPSKIPYLETTGMPSRILLRKRRFKCYHSSKMMVAETPLVKKNHQI
                     PRIINQKIAQKLIEKISMTDIAHQLAISTSTVIRKLNDFHFEHDFSRLPKIMSWDEYA
                     FTKGKMSFIAQDFDNLNIITVLEGRTQAVIRNHFLRYDRAVRCQVKIITMDMFSPYYD
                     LAKQLFPCAKIVLDRFHIIQHLSRAMSRFRVQIMNQFERKSHEYKTIKRYWKLIQQDS
                     RKLSDKRFYRPTFRMHLTNKEILDKILSYSEDLKHHYQIYQLLLFHFQNKEPEKFFGL
                     IEDNLKQVHPLFQTVFKTFLKDKEKIVNALQLHYSNAKLEATNNLIKLIKRNAFGFRN
                     FENFKKRIFIALNIKKERTKFVLSRA"
     gene            397089..398789
                     /locus_tag="SPG_0407"
     CDS             397089..398789
                     /locus_tag="SPG_0407"
                     /EC_number="2.2.1.6"
                     /note="identified by match to protein family HMM PF00205;
                     match to protein family HMM PF02775; match to protein
                     family HMM PF02776; match to protein family HMM TIGR00118"
                     /codon_start=1
                     /transl_table=11
                     /product="acetolactate synthase large subunit"
                     /protein_id="ACF54907.1"
                     /translation="MEKISLESPKTGSDLVLETLRDLGVDTIFGYPGGAVLPFYDAIY
                     NFKGIRHILGRHEQGCLHEAEGYAKSTGKLGVAVVTSGPGATNAITGIADAMSDSVPL
                     LVFTGQVARAGIGKDAFQEADIVGITMPITKYNYQVRETADIPRIITEAVHIATTGRP
                     GPVVIDLPKDISALETDFIYSPEVNLPSYQPTLEPNDMQIKKILKQLSKAKKPVLLAG
                     GGISYAEAATELNEFAERYQIPVVTSLLGQGTIATSHPLFLGMGGMHGSFAANIAMTE
                     ADFMISIGSRFDDRLTGNPKTFAKNAKVAHIDIDPAEIGKIISADIPVVGDAKKALQM
                     LLAEPTVHNNTEKWIEKVTKDKNRVRSYDKKERVVQPQAVIERIGELTNGDAIVVTDV
                     GQHQMWTAQYYPYQNERQLVTSGGLGTMGFGIPAAIGAKIANPDKEVVLFVGDGGFQM
                     TNQELAILNIYKVPIKVVMLNNHSLGMVRQWQESFYEGRTSESVFDTLPDFQLMAQAY
                     GIKNYKFDNPETLAQDLEVITEDVPMLIEVDISRKEQVLPMVPAGKSNHEMLGVQFHA
                     "
     gene            398782..399258
                     /locus_tag="SPG_0408"
     CDS             398782..399258
                     /locus_tag="SPG_0408"
                     /EC_number="2.2.1.6"
                     /note="identified by match to protein family HMM PF01842;
                     match to protein family HMM TIGR00119"
                     /codon_start=1
                     /transl_table=11
                     /product="acetolactate synthase small subunit"
                     /protein_id="ACF55057.1"
                     /translation="MRRMLTAKLQNRSGVLNRFTGVLSRRQVNIESISVGATEDPNVS
                     RITIIIDVASHDEVEQIIKQLNRQIDVIRIRDITDKPHLEREVILVKMSAPAEKRAEI
                     LAIIQPFRATVVDVAPSSITIQMTGNAEKSEALLRVIRPYGIRNIARTGATGFTRD"
     gene            399324..400346
                     /locus_tag="SPG_0409"
     CDS             399324..400346
                     /locus_tag="SPG_0409"
                     /EC_number="1.1.1.86"
                     /note="identified by match to protein family HMM PF01450;
                     match to protein family HMM PF02629; match to protein
                     family HMM PF07991; match to protein family HMM TIGR00465"
                     /codon_start=1
                     /transl_table=11
                     /product="ketol-acid reductoisomerase"
                     /protein_id="ACF55185.1"
                     /translation="MTVQMEYEKDVKVAALDGKKIAVIGYGSQGHAHAQNLRDSGRDV
                     IIGVRPGKSFDKAKEDGFDTYTVAEATKLADVIMILAPDEIQQELYEAEIAPSLEAGN
                     AVGFAHGFNIHFEFIKVPADVDVFMCAPKGPGHLVRRTYEEGFGVPALYAVYXDATGN
                     AKNIXMDWCKGVGAARVGLLETTYKEETEEDLFGEQAVLCGGLTALIEAGFEVLTEAG
                     YAPELAYFEVLHEMKLIVDLIYEGGFKKMRQSISNTAEYGDYVSGPRVITEQVKENMK
                     AVLADIQNGKFANDFVNDYKAGRPKLTAYREQAANLEIEKVGAELRKAMPFVGKNDDD
                     AFKIYN"
     gene            400453..400689
                     /locus_tag="SPG_0410"
     CDS             400453..400689
                     /locus_tag="SPG_0410"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF56758.1"
                     /translation="MLADQNKADWSYDENAVINIYDDANFEDGRLHMTFEQFFKLAQI
                     AREEGLEIHSPFERAGATKSARYIAKWILRNKKH"
     gene            400927..401283
                     /locus_tag="SPG_0411"
     CDS             400927..401283
                     /locus_tag="SPG_0411"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF55327.1"
                     /translation="MNITNLFSIKTGCDETDRQLQKLFFQLDLQLGELTDQLRKLDSN
                     FVPRSQFVDTLDLNDVEYKEILNYFIFHRNDSEESLVEWLYDWISTNRYELPKEFSIR
                     MAHKYHESVTEVFGDE"
     gene            401333..402583
                     /locus_tag="SPG_0412"
     CDS             401333..402583
                     /locus_tag="SPG_0412"
                     /EC_number="4.3.1.19"
                     /note="identified by match to protein family HMM PF00291;
                     match to protein family HMM PF00585; match to protein
                     family HMM TIGR02079"
                     /codon_start=1
                     /transl_table=11
                     /product="threonine dehydratase biosynthetic"
                     /protein_id="ACF56032.1"
                     /translation="MLSSKDIIKAHKVLNGVVVNTPLDYDHYLSEKYGAKIYLKKENA
                     QRVRSFKIRGAYYAISQLSKEERERGVVCASAGNHAQGVAYTCNEMKIPATIFMPITT
                     PQQKIGQVRFFGGDFVTIKLVGDTFDASAKAAQEFTVSENRTFIDPFDDAHVQAGQGT
                     VAYEILEEARKESIDFDAVLVPVGGGGLIAGVSTYIKETSPEIEVIGVEANGARSMKA
                     AFEAGGPVKLKEIDKFADGIAVQKVGQLTYEATRQHIQTLVGVDEGLISETLIDLYSK
                     QGIVAEPAGAASIASLEVLAEYIKGKTICCIISGGNNDINRMPEMEERALIYDGIKHY
                     FVVNFPQRPGALREFVNDILGPNDDITRFEYIKRASKGTGPVLIGIALADKHDYAGLI
                     RRMEGFDPAYINLNGNETLYNMLV"
     gene            402725..402913
                     /locus_tag="SPG_0413"
     CDS             402725..402913
                     /locus_tag="SPG_0413"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF56842.1"
                     /translation="MAQISILHFDFLSIDKHSHTVFNTLRKSLQTTLALSETSKQCFE
                     QFAASFLVCSLIFIEYKV"
     gene            403454..403669
                     /locus_tag="SPG_0414"
     CDS             403454..403669
                     /locus_tag="SPG_0414"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF55042.1"
                     /translation="MAKSNFEKVESVVGWVRDKKITGYRISKETNAREMSIIALAQGR
                     AKVKNISFETALGLIDFYEKNHEKFED"
     gene            complement(403868..404632)
                     /locus_tag="SPG_0415"
     CDS             complement(403868..404632)
                     /locus_tag="SPG_0415"
                     /note="identified by match to protein family HMM PF00005"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, ATP-binding protein"
                     /protein_id="ACF54813.1"
                     /translation="MTQAILEIKHLKKSYGQNEVLKDISLTVHKGEVISIIGSSGSGK
                     STFLRSINLLETPTDGQILYHGQNVLEKGYDLTQYREKLGMVFQSFNLFENLNVLENT
                     IVAQTTVLKRERTEAEEIAKENLEKVGMGERYWQARPKQLSGGQKQRVAIARALSMNP
                     DAILFDEPTSALDPEMVGEVLKIMQDLAQEGLTMIVVTHEMEFARDVSHRVIFMDKGV
                     IAEEGKPEDLFTNPKEDRTKEFLQRYLILNENQRAN"
     gene            complement(404632..406197)
                     /locus_tag="SPG_0416"
     CDS             complement(404632..406197)
                     /locus_tag="SPG_0416"
                     /note="identified by match to protein family HMM PF00497;
                     match to protein family HMM PF00528; match to protein
                     family HMM TIGR01726"
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter, amino acid-binding
                     protein/permease protein"
                     /protein_id="ACF55412.1"
                     /translation="MRKIYLSIFTSLLLMLGLVNVAQADEYLRIGMEAAYAPFNWTQD
                     DDSNGAVKIDGTNQYANGYDVQIAKKIAKDLGKEPLVVKTKWEGLVPALTSGKIDMII
                     AGMSPTAERKQEIAFSSSYYTSEPVLLVKKDSAYASAKSLDDFNGAKITSQQGVYLYD
                     LIAQIPGAKKETAMGDFAQMRQALEAGVIDAYVSERPEALTAEAANSKFKMIQVEPGF
                     KTGEEDTAIAIGLRKNDNRISQINASIETISKDDQVALMDRMIKEQPAEATTTEETSS
                     SFFSQVAKILSENWQQLLRGAGITLLISIVGTIIGLIIGLAIGVFRTAPLSENKAIYG
                     LQKLVGWVLNVYIEIFRGTPMIVQSMVIYYGTAQAFGINLDRTLAAIFIVSINTGAYM
                     TEIVRGGILAVDKGQFEAATALGMTHNQTMCKIVLPQVVRNILPATGNEFVINIKDTS
                     VLNVISVVELYFSGNTVATQTYQYFQTFTIIAVIYFVLTFTVTRILRFIERRMDMDTY
                     TTGANQMQTEDLK"
     gene            406335..408224
                     /locus_tag="SPG_0418"
     CDS             406335..408224
                     /locus_tag="SPG_0418"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF56585.1"
                     /translation="MKKTFFLLVLGLFCLLPLSVFAIDFKINSYQGDLYIHADNTAEF
                     RQKIVYQFEEDFKGQIVGLGRAGKMPSGFDIDPHPKVQAAKNGAELADVTSEVTEEAD
                     GYTVRVYNPGQEGDIVEVDLVWNLKNLLFLYDDIAELNWQPLTDSSESIEKFEFHVRG
                     DKGAEKLFFHTGKLFREGTIEKSNLDYTIRLDNLPAKRGVELHAYWSRTDFASARDQG
                     LKGNRLEEFNKIEDSIVREKDQSKQLVTWVLPSILSISLLLSVCFYFIYRRKTTPSVK
                     YAKNHRLYEPPMELEPMVLSEAVYSTSLEEVSPLVKGAGKFTFDQLIQATLLDVIDRG
                     NVSIISEGDAVGLRLVKEDGLSRFERDCLNLAFSGKKEATLSNLFADYKVSDSLYRRA
                     KVSDEKRIQARGLQLKSSFEEVLNQMQEGVRKRVSFWGLPDYYRPLTGLEKTLQVGIG
                     VLTILPLFIGFGLFLYSLDVHGYLYLPLPILGFLGLVLSVFYYWKLRLDNRDGVLNEA
                     GAEVYYLWTSFENMLREIARLDKAELESIVVWNRLLVYATLFGYADKVSHLMKVHQIQ
                     VENPDINLYVAYGWHSMFYHSSAQMSHYASVANTASTYSVSSGSGSSGGGFSGGGGGG
                     SIGAF"
     gene            complement(408221..408391)
                     /locus_tag="SPG_0417"
     CDS             complement(408221..408391)
                     /locus_tag="SPG_0417"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved domain protein"
                     /protein_id="ACF55995.1"
                     /translation="MKKWTFSRAFCRALKSSPNHQIEIRNSLDKTIDFSYSLSFFYLP
                     LYHTFSVYGSSL"
     gene            complement(408423..409553)
                     /locus_tag="SPG_0419"
     CDS             complement(408423..409553)
                     /locus_tag="SPG_0419"
                     /note="identified by match to protein family HMM PF02371"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="ACF55251.1"
                     /translation="MLYVGIDIAKNKHDVTALNVPGKTVLKPLTFSNNKAGFELLDLS
                     LRQLNQDCLIALENTGHYAFNLLNFLHEQGYKVYTYTPLLIKEFAKSLSLRKTKTNKK
                     DAHGIALKLLSDPNREQFQHDNRQVELKILARHIHRLKKKQSDWKVQYTRCLDIIFPE
                     LDKIVGKHSEYTYQLLTRYPNPQKRLEAGFDKLIEIKRLTASKIQDILSVAPRSIGTT
                     SPAREFEIIEIIKHYKRLIDKAETCVNDLMAEFNSVITTVTGIGGRLGAVILAEIRNI
                     HAFDNPAQLQAFAGLDSSIYQSGQIDLAGRMIKRGSPHLRWALIQAAKACARFSPAFK
                     AYLKTKLEQGKHYNVAIIHLAKKLIRTLFYILKKSCHLTNKK"
     gene            409640..409777
                     /locus_tag="SPG_0420"
     CDS             409640..409777
                     /locus_tag="SPG_0420"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF55738.1"
                     /translation="MRYQTHYQLKQKLWLEPFGNRQAIGGNELIHSGLFQVYHLGFGS
                     S"
     gene            409808..410653
                     /gene="bacA"
                     /locus_tag="SPG_0421"
     CDS             409808..410653
                     /gene="bacA"
                     /locus_tag="SPG_0421"
                     /EC_number="2.7.1.66"
                     /note="identified by similarity to SP:P60935; match to
                     protein family HMM PF02673"
                     /codon_start=1
                     /transl_table=11
                     /product="undecaprenol kinase"
                     /protein_id="ACF55432.1"
                     /translation="MYLIEILKSIFFGIVEGITEWLPISSTGHLILAEEFIQYQNQNE
                     AFMSMFNVVIQLGAILAVMVIYFNKLNPFKPTKDKQEVRKTWRLWLKVLIATLPLLGV
                     FKFDDWFDTHFHNMVSVALMLIIYGVAFIYLEKRNKARAIEPSVTELDKLPYTTAFYI
                     GLFQVLALLPGTSRSGATIVGGLLNGTSRSVVTEFTFYLGIPVMFGASALKIFKFVKA
                     GELLSFGQLFLLLVAMGVAFAVSMVAIRFLTSYVKKHDFTLFGKYRIVLGSVLLLYSF
                     VRLFV"
     gene            410646..410774
                     /locus_tag="SPG_0422"
     CDS             410646..410774
                     /locus_tag="SPG_0422"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF56140.1"
                     /translation="MYKKNLEGATLQGFILFENLFKPRQLYLQPQNSVLSSLRLAS"
     gene            complement(410800..411861)
                     /gene="dinB"
                     /locus_tag="SPG_0423"
     CDS             complement(410800..411861)
                     /gene="dinB"
                     /locus_tag="SPG_0423"
                     /EC_number="2.7.7.7"
                     /note="identified by match to protein family HMM PF00817"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase IV DinB"
                     /protein_id="ACF55546.1"
                     /translation="MLIFPLLNDLSRKIIHIDMDAFFAAVEIRDNPKLRGKPVIIGSD
                     PRQTGGRGVVSTCSYEARAFGVHSAMSSKEAYERCPQAVFISGNYEKYKSVGLQIRAI
                     FKRYTDLIEPMSIDEAYLDVTENKLGIKSAVKIARLIQKDIWQELHLTASAGVSYNKF
                     LAKMASDYQKPHGLTVILPEQAEDFLKQMDISKFHGVGKKTVERLHQMGVFTGADLLE
                     VPEVTLIDRFGRLGYDLYRKARGIHNSPVKSNRIRKSIGKEKTYGKILLAEEDIKKEL
                     TLLSEKVALNLHQQEKAGKIVILKIRYEDFSTLTKRKSLAQKTQDASQISQIALQLYE
                     ELSKKERGVRLLGITMTGF"
     gene            412209..414533
                     /locus_tag="SPG_0424"
     CDS             412209..414533
                     /locus_tag="SPG_0424"
                     /EC_number="2.3.1.54"
                     /note="identified by match to protein family HMM PF01228;
                     match to protein family HMM PF02901; match to protein
                     family HMM TIGR01255"
                     /codon_start=1
                     /transl_table=11
                     /product="formate acetyltransferase"
                     /protein_id="ACF54932.1"
                     /translation="MVVKTVVEAQDIFDKAWEGFKGVDWKEKASVSRFVQANYTPYDG
                     DESFLAGPTERSLHIKKIVEETKAHYEETRFPMDTRPTSIADIPAGFIDKENEVIFGI
                     QNDELFKLNFMPKGGIRMAETTLKENGYEPDPAVHEIFTKYVTTVNDGIFRAYTSNIR
                     RARHAHTVTGLPDAYSRGRIIGVYARLALYGADYLMQEKVNDWNAIKEIDEETIRLRE
                     EVNLQYQALQQVVRLGDLYGVDVRKPAMNVKEAIQWVNIAFMAVCRVINGAATSLGRV
                     PIVLDIFAERDLARGTFTESEIQEFVDDFVMKLRTVKFARTKAYDQLYSGDPTFITTS
                     MAGMGNDGRHRVTKMDYRFLNTLDNIGNSPEPNLTVLWTDKLPYNFRRYCMHMSHKHS
                     SIQYEGVTTMAKDGYGEMSCISCCVSPLDPENEEQRHNIQYFGARVNVLKALLTGLNG
                     GYDDVHKDYKVFDIEPIRDEVLEFESVKANFEKSLDWLTDTYVDALNIIHYMTDRYNY
                     EAVQMAFLPTKQRANMGFGICGFANTVDTLSAIKYATVKPIRDEDGYIYDYETIGDYP
                     RWGEDDPRSNELAEWLIEAYTTRLRSHKLYKDAEATVSLLTITSNVAYSKQTGNSPVH
                     KGVYLNEDGSVNLSKLEFFSPGANPSNKAKGGWLQNLNSLSSLDFSYAADGISLTTQV
                     SPRALGKTRDEQVDNLVTILDGYFENGGQHVNLNVMDLNDVYEKIMSGEDVIVRISGY
                     CVNTKYLTPEQKTELTQRVFHEVLSMDDALDALS"
     gene            complement(414900..415118)
                     /locus_tag="SPG_0425"
     CDS             complement(414900..415118)
                     /locus_tag="SPG_0425"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF56473.1"
                     /translation="MMSIREQDLKDIGAIIKYKNFHSPFDTFKYLKDMGFDTIDLSVL
                     LEXFSYAYGMDWLEKFFKENQDKLREFY"
     gene            complement(415445..415729)
                     /locus_tag="SPG_0426"
     CDS             complement(415445..415729)
                     /locus_tag="SPG_0426"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF55181.1"
                     /translation="MDWYDYMIQASKQSQFNASHWFRYLRKVIFEDYSYLTNQDVEKL
                     LDSKELTRFQKISLKYAFQEHTPTHKYVISLNKPAKLTNVQKLMEKYKHG"
     gene            416949..417086
                     /locus_tag="SPG_0427"
     CDS             416949..417086
                     /locus_tag="SPG_0427"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF55809.1"
                     /translation="MLLTSSVLSTTSKQCFEQPAASFLVCSLIFIEYKENCKNKNGDF
                     I"
     gene            complement(417326..418549)
                     /locus_tag="SPG_0428"
     CDS             complement(417326..418549)
                     /locus_tag="SPG_0428"
                     /note="identified by match to protein family HMM PF00480"
                     /codon_start=1
                     /transl_table=11
                     /product="ROK family protein"
                     /protein_id="ACF55243.1"
                     /translation="MITKQSAFLQNRATILEFLYRNPATSRXDIXNETGLTPATTTNI
                     IKELSEQSLIYETGDEFSEFSGSGRRRKTISITDNIPYVVGGIEINVLGIFLSLCDLQ
                     GKTLFETEILNEDYPISEINSTITNMIKTAIEYVPLETKLLGFGLSIPGHYNKDSGSI
                     ITNNPIWESFNLLNVIKRFNFPFIVKNNIDCMAIGQYLFNPHNTPDNFIFLHAGLGIY
                     TSFFTKEKIGASKNPYIGEIGHTIVELNGQYCECGKKGCLQTYISDAWLIKHAQLLFK
                     NSQLTVLKSLVKTEKDIHLDTLLTAYNLGDSALRQQIDKGVNLLATSIANLLLINPAD
                     KIYINSQLLNYQPFTHEVRDKIQDQLHFVPFTRNIEIEILPYNKHRGSIGACALAIVA
                     FFIEHSNVLQDIISP"
     gene            418717..420039
                     /locus_tag="SPG_0429"
     CDS             418717..420039
                     /locus_tag="SPG_0429"
                     /EC_number="2.7.1.69"
                     /note="identified by match to protein family HMM PF02378;
                     match to protein family HMM TIGR00410"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system, IIC component"
                     /protein_id="ACF54862.1"
                     /translation="MNNILAFLETKVAPFGEKVGNQRHLKAIREGFMMAMPLILVGSL
                     FLILISWPQEAFTNWLNSVGLLSILTTMNQSTVAIISLVACFGIAYRLSEGYGTDGPS
                     AGIIALSSFVLMAPRFSSMVYDKNGEQVKQLFGGAIPFSSLNASSLFMAITIGLVTAE
                     IYRMFIQRGITIKMPSGVPXVVSKSFSALLPGFTTFVLWALVLKGLEAAGVAXGLNGL
                     LGAIVGTPLKLIAGTLPGMILCVIVNSFFWFCGVNGGQVLNAFVDPVWLQFTTENQEA
                     VAAGQTLQHIITLPFKDLFVFIGGGGATIGLAICLFLFSKSRANKTLGKLAIIPSIFN
                     INTAILFTFPTVLNPIMLIPFIATPTINALITYVSMAVGLVPYTTGVILPWTMPPIIG
                     GFLATGASWRGALLQVVLILVSVAIYYPFFKIADKRNLEKEKATVGGK"
     gene            420041..420235
                     /locus_tag="SPG_0430"
     CDS             420041..420235
                     /locus_tag="SPG_0430"
                     /note="contains potential frameshift"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF56764.1"
                     /translation="MVIRVFDQQKNTYSSFALEELSYYMNRVFKTNIELVEEKEADIF
                     VGLVNKEDSKRPCSYLIRQG"
     gene            420288..421928
                     /locus_tag="SPG_0431"
     CDS             420288..421928
                     /locus_tag="SPG_0431"
                     /note="contains potential frameshift"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF56194.1"
                     /translation="MFHEFGVVYTRPGRRHDFVPELRFEDFLDKQLSIDETASYYHRG
                     VCIEGADSFENILDFIDWLPKIGMNSFFIQFENPYSFLKRWYEHEFNPYLNKEQFSNE
                     LVQELSDRLDKELQKRGLIHHRVGHGWTGEVLGYXSKFGWESGLSISEEKKPYVAEIN
                     GKRELFNTAPILTSLDFSNPDVADKMVEIIKDYAKKRPDVNYLHVWLSDARNNICECE
                     NCRQELVSDQYIRILNQLDRALTSEGLDTKICFXLYHELLWAPQKEKLDNPERFTMMF
                     APITRTFEMSYADVDFDNSIPTPKPYMRNKIILPNSLEENLSYLFEWQKAFKGDSFVY
                     DYPLGRAHYGDLGYMKISQTIYRDVSYLSNLHLNGYISCQELRAGFPHNFPNYVMGEM
                     LWKKTRSYEELIEEYFSALYGENWQSVVEYLEKLSIYSSCDYFNAIGSRQSDVLANHY
                     YIAYNLADNFLPIIEENISKLLNSQKDEWKQLSYHREYVVKMAKALYLQATGKTRQAQ
                     DEWRNVLNYIRGHELLFQSNLDVYRVIEVAKNYAGFHL"
     gene            422096..422440
                     /locus_tag="SPG_0432"
     CDS             422096..422440
                     /locus_tag="SPG_0432"
                     /EC_number="2.7.1.-"
                     /note="identified by match to protein family HMM PF02255"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system, IIA component"
                     /protein_id="ACF55038.1"
                     /translation="MKSKEEINMLGFTIVAYAGDARSDLMDALAFARDGYFEQARELV
                     ESANDSIVSAHREQTNLLAEEASGDNFEVSFIMIHGQDTLMTTMLLYDQVKFFIDEYE
                     RIRKIEEHIGLQ"
     gene            422450..423862
                     /locus_tag="SPG_0433"
     CDS             422450..423862
                     /locus_tag="SPG_0433"
                     /EC_number="3.2.1.85"
                     /note="identified by match to protein family HMM PF00232;
                     match to protein family HMM TIGR01233"
                     /codon_start=1
                     /transl_table=11
                     /product="6-phospho-beta-galactosidase"
                     /protein_id="ACF55638.1"
                     /translation="MENLQVKALPKEFLLGAATAAYQVEGATRVDGKGTNMWDVYLQE
                     NSPFLPDPASDFYYRYEEDITLAAEHGLQALRLSISWVRIFPDIDGEPNILAVRYYHR
                     VFQSCLKHNVIPFVSLHHFDSPQKMLETGDWLNRENIDRFIRYARFCFQEFTEVKHWF
                     TINELMSLAAGQYIGGQFPPNHHFQLSEAIQANHNMLLAHALAVLEFHQLGIEGKVGC
                     IHALKPGYPIDGQKENILAAKRYDVYNNKFLLDGTFLGYYSEDTLFHLNQILEANNSS
                     FIIEDGDLEIMKRAAPLNTMFGMNYYRSEFIREYKGENRQEFNSTGIKGQSSFKLNAL
                     GEFVKKPGIPTTDWDWNIYPQGLFDMLLRIKEEYPQHPVIYLTENGTALKEVKPEGEN
                     DIIDDSKRIRYIEQHLHKVLEARDRGVNIQGYFIWSLQDQFSWANGYNKRYGLFFVDY
                     ETQKRYIKKSALWVKGLKRN"
     gene            423931..425610
                     /locus_tag="SPG_0434"
     CDS             423931..425610
                     /locus_tag="SPG_0434"
                     /EC_number="2.7.1.69"
                     /note="identified by match to protein family HMM PF02302;
                     match to protein family HMM PF02378; match to protein
                     family HMM TIGR00410"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system, IIBC component"
                     /protein_id="ACF55403.1"
                     /translation="MDKLVAAIEKQQGKFEKISTNNYMMAIKDGFIATMPLIMFSSFL
                     MIIIMIPKNFGVELPSPAIVWMRKVYMLTMGVLGIIVSGTVGKSLVGNVNRKMPHGKV
                     INDISAMLAAICSYLVLTVTLVVDEKTGSTSLSTNYLGSQGLITSFVSAFITVNVYRF
                     CIKRDITIHLPKEVPGAISQAFRDIFPFSFVLLISGLLDIVSRFSLDVPFAQVFQQLL
                     TPIFKGAESYPAMMLIWFMCALLWFVGIHGPSIVLPAVTALQLSNMEENAQLLANGQF
                     PYHSLTPNFGNYIAAIGGTGATFVVPFILIFFMRSKQLKSVGKATITPVLFAVNEPLL
                     FGMPVILNPYLFVPFLMTPPVNVFLGKVFIDFFGMNGFYIQLPWTFPGPLGLLIGTNF
                     QLISFVFLSLILVVDILIYLPFCRAYDRQLLVKEDIASSNDIILEEDTSEIIPGEIDE
                     IKSKELKVLVLCAGSGTSAQLANAINEGANLTEVRVIANSGAYGAHYDIMGVYDLIIL
                     APQVRSYYREMKVDAERLGIQIVATRGMEYIHLTKNPSKALQFVLEHYQAV"
     gene            complement(425735..427174)
                     /locus_tag="SPG_0435"
     CDS             complement(425735..427174)
                     /locus_tag="SPG_0435"
                     /note="identified by match to protein family HMM PF02386"
                     /codon_start=1
                     /transl_table=11
                     /product="Trk transporter membrane-spanning protein"
                     /protein_id="ACF56010.1"
                     /translation="MNKSMIRYLLSKLLLIEAVLLLVPVAIAVYYRESSQVFTALFST
                     IGILVLLGGSGSLQKPXNQRIYAKEGVLIVALCWILWSFFGGLPFVFSGQIPSLIDAF
                     FEISSGFTTTGASILNDVSVLSRSLLFWRSFTHLIGGMGVLVFALAIMDNAKNSHLEV
                     MKAEVPGPVFGKVVSKLKNTAQILYLLYLALFSLFVIIYYLAGMPLYDSFVIAMGTAG
                     TGGFTVYNDGIAHYGSSLITYLVSIGVLVFGVNFNLYYYLMLRRIKAFFGDEELRAYL
                     VIVLVSTGLISLNTLYLYPGFSKSFEMTFFQVSNIITTTGFGYGDITNWPLFSQFILL
                     FLMAIGGSAGSTAGGLKIIRGLILSKIAKNQILSILSPHRVLTLHVNQTVIDKDTQHK
                     ILKYFVIYAMILLALIFIVSLDSNDFLVVTSAVFSCFNNIGPILGTTSSFSIFSPISK
                     ILLSFTMIAGRLEIYPILLLFMKRTWSKR"
     gene            complement(427178..428527)
                     /locus_tag="SPG_0436"
     CDS             complement(427178..428527)
                     /locus_tag="SPG_0436"
                     /note="identified by match to protein family HMM PF02080;
                     match to protein family HMM PF02254"
                     /codon_start=1
                     /transl_table=11
                     /product="Trk transporter"
                     /protein_id="ACF56827.1"
                     /translation="MKIILVGGGKVGFALCRSLVAEKHDVLLIEQDEAVLNHIVSRFD
                     IIGILGNGADFAILEQASVQDCDIFIALTEHDEVNMIAAVLAKKMGAKETIVRVRNPE
                     YSNSYFKEKNILGFSLIVNPELLAARAIANIIDFPNALSVERFAGGRVSLMEFVVKST
                     SGLCQMPISDFRKKFGNVIVCAIEREHQIIIPSGDMTVQDKDRIFVTGNRVDMILFHN
                     YFKSRAVKSLLIVGAGRIAYYLLGILKDSRIDTKVIEINPEIASFFSEKFPNLYIVQG
                     DGTAKDILLEESAQHYDAVATLTGVDEENLITSMFLDRVGVQKNITKVNRTSLLEIIN
                     APDFSSIITPKSIAVDTIMHFIRGRVNAQYSDLQAMHHLANGQIETLQFHIKEANKMT
                     AKPLSQLKLKKGVLIAAIIRKGKTIFPTGEDMLEVGDKLXVTTLLPNITKIYDLIAR"
     gene            428716..429564
                     /locus_tag="SPG_0437"
     CDS             428716..429564
                     /locus_tag="SPG_0437"
                     /note="identified by match to protein family HMM PF01887"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF54763.1"
                     /translation="MNNNLLVLQSDFGLVDGAVSAMIGVALEESPTLKIHHLTHDITP
                     YNIFEGSYRLFQTVDYWPEGTTFVSVVDPGVGSKRKSVVAKTAKNQYIVTPDNGTLSF
                     IKKHVGIVAIREISEVANRRQNTEHSYTFHGRDVYAYTGAKLASGHITFEEVGPELSV
                     EQIVELPVVATIIEDHLVKGAIDILDVRFGSLWTSITREEFYKLEPEFGDRFEVTIYH
                     ADMLVYQNQVVYGKSFADVRIGQPILYINSLYRLGLAINQGSFAKAYNVGVGSSWTIE
                     IKKIEG"
     gene            429579..430127
                     /locus_tag="SPG_0438"
     CDS             429579..430127
                     /locus_tag="SPG_0438"
                     /note="identified by match to protein family HMM PF07155"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF55776.1"
                     /translation="MEIKFTIKQVVAVGIGAALFVVIGMINIPTPVPNTSIQLQYAVQ
                     ALLSIIFGPIIGLLVGLIGHAIKDSLVGYGLWWTWIIASGLFGLVVGLFRKYVRVINS
                     VFDWKDILIFNLIQLLANALVWGVLAPLGDVVIYQEAAEKVFAQGIVAGIANGVSVAI
                     AGTLLLLAYAGTQTRAGSLKKD"
     gene            430448..432130
                     /locus_tag="SPG_0439"
     CDS             430448..432130
                     /locus_tag="SPG_0439"
                     /note="identified by match to protein family HMM PF00005"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, ATP-binding protein"
                     /protein_id="ACF56590.1"
                     /translation="MKEAIIEWKDFSFRYETQQEPTLQGIDLTIYKGEKVLIVGPSGS
                     GKSTLGQCLNGIIPNIYKGQTYGEFLIKGQVAFDMSIYDKSHLVSTVLQDTDGQFIGL
                     SVAEDLAFALENDVTALDEMKGRVYKWAEKLDLLPLLDQRPQDLSGGQKQRVSLAGVL
                     IDESPILLFDEPLANLDPKSGQDIIELIDQIHKEEGTTTLIIEHRLEDVLHRPVDRIV
                     LINDGRILFNGSPDQLLATDLLTQNGIREPLYLTTLRQLGVDLVKEEQLADLDNLSIS
                     KGQIQLQTELVKETPALQSLFILEEVSFSYNDRPILKSLHLDIKKGEKIAIVGKNGAG
                     KSTLAKAISSFIQTEGRYLWEKQDIKGDSVAERAERVGYVLQNPNQMISTNMIFDEVA
                     LGLRLRGVNEKEIETRVYETLKICGLYEFRNWPISALSFGQKKRVTIASILVLGAEII
                     LLDEPTAGQDQKNYTEIMEFLEELHQKGHTIVMITHDMQLMLDYSDRVLVMVDGELIA
                     DTVPASLLSDPELLVKANLKETSIFNLAKKLDVGPLDLTAFYKERREGCKLN"
     gene            432115..432945
                     /locus_tag="SPG_0440"
     CDS             432115..432945
                     /locus_tag="SPG_0440"
                     /note="identified by match to protein family HMM PF02361"
                     /codon_start=1
                     /transl_table=11
                     /product="cobalt transport protein"
                     /protein_id="ACF56660.1"
                     /translation="MQAKLIGYQHRDTVIHRLSGAGKLLFFILVSLAAMISYDTRMLL
                     LIAIFSVFLLYLSEIRFKDVSFVAVFATVFAVLNVLMVYLFSPEYGVGLYGERSVIWQ
                     GIGVYTLTSQELFYLLNLAIKYLCTIPLAIIFLMTTHPSQFASSLNQIGVPYKIAYSV
                     SLTLRYIPDLQEEFFTIKMSQEARGMELSKKASLMQRIKGNLLIITPLIFSSLERIDT
                     IATAMELRRFGKEKKRTWYSYQALKKGDYITLLLATLFLVVSLLLILQNQGRFYNPWK
                     "
     gene            433138..433641
                     /locus_tag="SPG_0441"
     CDS             433138..433641
                     /locus_tag="SPG_0441"
                     /note="identified by match to protein family HMM PF00588"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA methyltransferase, TrmH family"
                     /protein_id="ACF56629.1"
                     /translation="MTNHIVLFEPQIPQNTGNIARTCAATNSPLHIIKPMGFPIDDRK
                     MKRAGLDYWDKLEIYFYESLEDFISQMKGKLYLISKFAEKIYSEVDLSTDEDHYFLFG
                     REDKGLPEDFMREHPDKALRIPMNDEHVRSLNVSNTVCMIVYEALRQQNFAGLELVHT
                     YEVDKLK"
     gene            434094..434657
                     /locus_tag="SPG_0442"
     CDS             434094..434657
                     /locus_tag="SPG_0442"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF55878.1"
                     /translation="MTNTRRLSTIAILSAISFVLMYFDFPLLPAASFLKIEFSILPVL
                     VGLVVMDLPAALGVLLLRSLLKLLLNSQGVNTYIGLPMNIVALGVFVIVFALIWKKER
                     TTLRFLLGSLAGTIGLTLAMLVLNYVYAVPLYAKFANFDIGKILGLSNYLMTMVLPFN
                     LIEGVIFSVSFWLLYVLLKPTLKHYER"
     gene            434647..435297
                     /locus_tag="SPG_0443"
     CDS             434647..435297
                     /locus_tag="SPG_0443"
                     /note="identified by match to protein family HMM PF01569"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF55355.1"
                     /translation="MRDKQTFLMKGSFALLLFVILGYMVKFYPETLVNFDQSIQTAIR
                     GDLPDYLTILFRALTRLIDIPVIITWVVITAFVFYRKRWKIESFFMLGNLALAGLLIV
                     TFKNIYQRPRPDILHLVEEKGFSFPSGHSLAVTLMVGTLIVILSQRIKDPVWRKIVQI
                     VLGLYLVSVLVSRVYLGVHYPSDVLASLCVGLGVLFIEFPXYDKLRFQWRFKGKQK"
     gene            435325..435714
                     /locus_tag="SPG_0444"
     CDS             435325..435714
                     /locus_tag="SPG_0444"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF55733.1"
                     /translation="MKVNIADLHPTQLYLSEKKLQDIQMLYQSAETIQVDPISILAFG
                     DCLLITDGHHRAYQTLLADRDTISAEWDRDGGDELYHLYAQACEERKIYSVFDLEDRI
                     LAQDGYEAKWYNWCDGFNQAATLLLKR"
     gene            435719..436168
                     /locus_tag="SPG_0445"
     CDS             435719..436168
                     /locus_tag="SPG_0445"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF56860.1"
                     /translation="MCFVPYYKVNHCEEAFAWYQDVNLVYLVDGVKLPYSQATLEAMY
                     SYLDRHGELFWIEVKEKGEWFPIGDITLSQDNLPIVIGNSAYQHRGLGKKILSALIEL
                     ARVKGWKELRVKEIYTYNHASRRCFKSLGFVENGATEKGMSFILELV"
     gene            436296..436883
                     /gene="rpoE"
                     /locus_tag="SPG_0446"
     CDS             436296..436883
                     /gene="rpoE"
                     /locus_tag="SPG_0446"
                     /EC_number="2.7.7.6"
                     /note="identified by match to protein family HMM PF05066"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase, delta subunit"
                     /protein_id="ACF56139.1"
                     /translation="MELEVFAGQEKSELSMIEVARAILELRGRDHEMHFSDLVNEIQN
                     YLGTSNSDIREALPLFYTELNFDGSFISLGDNKWGLRSWYGVDEIDEEIIALEENDDD
                     EVAPKAKKKRVNAFMDGDSDAIDYNADDPEDEDAYEADPALSYDDENPDDEKNEVEAY
                     DAEINEIAPDDLGEDVDLNEDDDEFSDDDAETSEE"
     gene            complement(436973..437098)
                     /locus_tag="SPG_0447"
     CDS             complement(436973..437098)
                     /locus_tag="SPG_0447"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF55512.1"
                     /translation="MSVLSTTSKQCFEQPTASFLACSLIFIEYKIQEDNFLKKQK"
     gene            437273..438880
                     /gene="pyrG"
                     /locus_tag="SPG_0448"
     CDS             437273..438880
                     /gene="pyrG"
                     /locus_tag="SPG_0448"
                     /EC_number="6.3.4.2"
                     /note="identified by match to protein family HMM PF00117;
                     match to protein family HMM PF06418; match to protein
                     family HMM TIGR00337"
                     /codon_start=1
                     /transl_table=11
                     /product="CTP synthase (UTP-ammonia lyase)"
                     /protein_id="ACF54902.1"
                     /translation="MSTKYIFVTGGVVSSIGKGIVAASLGRLLKNRGLKVTIQKFDPY
                     INIDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSEVLRK
                     ERRGEYLGATVQVIPHITDALKEKIKRAALTTDSDVIITEVGGTVGDIESLPFLEALR
                     QMKADVGADNVMYIHTTLLPYLKAAGEMKTKPTQHSVKELRGLGIQPNMLVIRTEEPA
                     GQGIKNKLAQFCDVAPEAVIESLDVEHLYQIPLNLQAQGMDQIVCDHLKLDAPAAAMT
                     EWSAMVDKVMNLKKQVKISLVGKYVELQDAYISVVEALKHSGYVNDAEVKINWVNAND
                     VTAENVAELLSDADGIIVPGGFGQRGTEGKIQAIRYARENDVPMLGVCLGMQLTCIEF
                     ARHVLGLEGANSAELAPETKYPIIDIMRDQIDIEDMGGTLRLGLYPSKLKRGSKAAAA
                     YHNQEVVQRRHRHRYEFNNAFREQFEAAGFVFSGVSPDNRLVEIVEIPENKFFVACQY
                     HPELSSRPNRPEELYTAFVTAAVENSN"
     gene            complement(439439..441070)
                     /locus_tag="SPG_0449"
     CDS             complement(439439..441070)
                     /locus_tag="SPG_0449"
                     /note="identified by match to protein family HMM PF02690;
                     match to protein family HMM TIGR00704"
                     /codon_start=1
                     /transl_table=11
                     /product="Na/Pi-cotransporter II-related protein"
                     /protein_id="ACF54910.1"
                     /translation="MSINWQEILFHFLGGLGLFLYSIKTMGDGLQQAAGDRLRFYIDK
                     YTSNPFFGVLVGIGMTALIQSSSGVTVITVGLVSAGLLTLRQAIGIVMGANIGTTVTS
                     FLIGFKLGNYALPMLFIGAVCLFFTKNRTVNNIGRILFGVGGIFFALNLMSGAMAPLK
                     DLQVFKDYMIELSKNPVLGVFVGTGLTLLIQASSATIGILQNLYAGDLIDLQGALPVL
                     FGDNIGTTITAIIASLGANIAAKRVAGAHVAFNVIGTVVCVIFLVPFTVLIHWFEATL
                     NLAPEMTIAFAHGTFNITNTIIQFPFIGALAYFVTKIIPGEDEVVKYEPLYLDEHFIK
                     QAPSIALGNAKKELLHLGNYAAKAFDLSYKYIIDLDEKVAEKGHKTEEAINTIDEQLT
                     RYLIALSSEALSQKESEVLTNILDSSRDLERIGDHTEALLNLTDYLQRKNVEFSDAAL
                     KELEEVYRQTSDFIKDALDSVENNDIEKARSLVERHEAINKIERVLRKTHIKRLNKGE
                     CSTQAGVNFIDIISHYTRVSDHAMNLAEKVFAEQI"
     gene            441435..444923
                     /locus_tag="SPG_0450"
     CDS             441435..444923
                     /locus_tag="SPG_0450"
                     /note="identified by match to protein family HMM PF00754;
                     match to protein family HMM PF03644; match to protein
                     family HMM PF07523"
                     /codon_start=1
                     /transl_table=11
                     /product="endo-beta-N-acetylglucosaminidase, point
                     mutation"
                     /protein_id="ACF56726.1"
                     /translation="MIGAXLFAGPALAEETAVPENSGANTELVSGESEHSTNEADKQN
                     EGEHARENKLEKAEGVATASETASPASNEAATTETAEAASAAKPEEKASEVVAETPSA
                     EAKPKSDKETEAKPEATNQGDESKPAAEANKTEKEVQPDVPKNTEKTLKPKEIKFNSW
                     EELLKWEPGAREDDAINRGSVVLASRRTGHLVNEKASKEAKVQALSNTNSKAKDHASV
                     GGEEFKAYAFDYWQYLDSMVFWEGLVPTPDVIDAGHRNGVPVYGTLFFNWSNSIADQE
                     RFAEALKQDADGSFPIARKLVDMAKYYGYDGYFINQETTGDLVKPLGEXMRQFMLYSK
                     EYAAKVNHPIKYSWYDAMTYNYGRYHQDGLGEYNYQFMQPEGDKVPADNFFANFNWDK
                     AKNDYTIATANWIGRNPYDVFAGLELQQGGSYKTKVKWNDILDENGKLRLSLGLFAPD
                     TITSLGKTGEDYHKNEDIFFTGYQGDPTGQKPGDKDWYGIANLVADRTPAVGNTFTTS
                     FNTGHGKKWFVDGKVSKDSEWNYRSVSGVLPTWRWWQTSTGEKLRAEYDFTDAYNGGN
                     SLKFSGDVAGKTVQDVRLYSTKLEVTEKTKLRVAHKGGKGSKVYMAFSTTSDYKFDDA
                     DAWKELTLSDNWTNEEFDLSSLAGKTIYAVKLFFEHEGAVKDYQFNLGQLTISDNHQE
                     PQSPTSFSVVKQSLKNAQEAEAVVQFKGNKDADFYEVYEKDGDSWKLLTGSSSTTIYL
                     PKVSRSASAQGTTQELKVVAVGKNGVRSEAATTTFDWGMTVKDTSLPKPLAENIVPGA
                     TVIDSTFPKTEGGEGIEGMLNGTITSLSDKWSSAQLSGSVDIRLTKPRTVVRWVMDHA
                     GAGGESVNDGLMNTKDFDLYYKDADGEWKLAKEVRGNKAHVTDITLDKPITAQDWRLN
                     VVTSDNGTPWKAIRIYNWKMYEKLDTESVNIPMAKAAARSLGNNKVQVGFSDVPAGAT
                     ITVYDNPNSQTPLATLKSEVGGDLASAPLDLTNQSGLLYYRTQLPGKEISNVLAVSVP
                     KDDRRIKSVSLETGPKKTSYAEGEDLDLRGGVLRVQYEGGTEDELIRLTHAGVSVSGF
                     DTHHKGEQNLTLQYLGQPVNANLSVTVTGKDEASPKTILGIEVSQEPKKDYLVGDSLD
                     LSEGRFAVAYSNDTME"
     gene            444990..446342
                     /locus_tag="SPG_0451"
     CDS             444990..446342
                     /locus_tag="SPG_0451"
                     /note="identified by match to protein family HMM PF00746;
                     match to protein family HMM PF07501; match to protein
                     family HMM PF07554; match to protein family HMM TIGR01167"
                     /codon_start=1
                     /transl_table=11
                     /product="endo-beta-N-acetylglucosaminidase, point
                     mutation"
                     /protein_id="ACF56537.1"
                     /translation="MTLHYQGHEVSFDVLVSPKAALNDEYLKQKLAEVEAAKNKVVYN
                     FASPEVKEAFLKAIEAAEQVLKDHETSTQDQVNDRLNKLTEAHKALNGQEKFKEEKTE
                     LDRLTGEVQELLAAKPNHPSGSALAPLLEKNKALVEKVDLSPEELTTAXQSLKDLVAL
                     LKEDKPAVFSDSKTGVEVHFSNKEKTVIKGLKVERVQASAEEKKYFAGEDAHVFEIEG
                     LDEKGQDVDLSYASIVKIPIEKDKKVKKVFFLPEGKEAVELAFEQTDSHVIFTAPHFT
                     HYAFVYESAEKPQPAKPAPQNTVLPKPTYQPASDQQKAPKLEVQEEKVAFHRQEHENA
                     EMLVGEQRVIIQGRDGLLRHVFEVDENGQRRLRSTEVIQEAIPEIVEIGTKVKTVPAV
                     VATQEKPAQNTAVKSEEASKQLPNTGTADANEALIAGLASLGLASLALTLRRKREDKD
                     "
     gene            446432..447628
                     /gene="pgk"
                     /locus_tag="SPG_0452"
     CDS             446432..447628
                     /gene="pgk"
                     /locus_tag="SPG_0452"
                     /EC_number="2.7.2.3"
                     /note="identified by match to protein family HMM PF00162"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglycerate kinase"
                     /protein_id="ACF55930.1"
                     /translation="MAKLTVKDVDLKGKKVLVRVDFNVPLKDGVITNDNRITAALPTI
                     KYIIEQGGRAILFSHLGRVKEEADKAGKSLAPVAADLAAKLGQDVVFPGVTRGAELEA
                     AINVLEDGQVLLVENTRYEDVDGXKESKNDPELGKYWASLGDGIFVNDAFGTAHRAHA
                     SNVGISANVEKAVAGFLLENEIAYIQEAVETPERPFVAILGGSKVSDKIGVIENLLEK
                     ADKVLIGGGMTYTFYKAQGIEIGNSLVEEDKLDVAKALLEKANGKLILPVDSKEANAF
                     AGYTEVRDTEGEAVSEGFLGLDIGPKSIAKFDEALTGAKTVVWNGPMGVFENPDFQAG
                     TIGVMDAIVKQPGVKSIIGGGDSAAAAINLGRADKFSWISTGGGASMELLEGKVLPGL
                     AALTEK"
     gene            complement(447906..448247)
                     /locus_tag="SPG_0453"
     CDS             complement(447906..448247)
                     /locus_tag="SPG_0453"
                     /codon_start=1
                     /transl_table=11
                     /product="IS1380-Spn1, transposase"
                     /protein_id="ACF55792.1"
                     /translation="MKEGFFGDKTDSSTLIKNEVRMMMSCIAYNLYLFLKHLAGGDFP
                     TLTIKRFRHLFLHVVGKCVRTGRKQLLKLSSLYAYSELFSALYSRIRKVNLNLPVPYE
                     PPRRKASLMMH"
     gene            complement(448222..449121)
                     /locus_tag="SPG_0454"
     CDS             complement(448222..449121)
                     /locus_tag="SPG_0454"
                     /note="identified by match to protein family HMM PF01609"
                     /codon_start=1
                     /transl_table=11
                     /product="IS1380-Spn1, transposase"
                     /protein_id="ACF55180.1"
                     /translation="MTNADLVTNDQRRYCRYSDSDILVQFLFQLLTGYGTDYACKELS
                     ADAYFPKLLEGGQLASQPTLSRFLSRTDKETVHSLRCLNLELVEFFLQFHQLNQLIVD
                     IDSTHFTTYGKQEGVAYNAHYRAHGYHPHYAFEGKTGYCFNAQLRPGNRYCSEEADSF
                     ITPVLERFNQLLFRMDSGFATPKLYDLIEKTGQCYLIKLKKNTVLSRLGDLSLPCPQD
                     EDLTILPHSAYSETLYQAGSWSHKRRVCQFSERKEGNLFYDVISLVTNMTSGTSQDQF
                     QLYRGPWSSREFHQGDEGGIFWR"
     gene            complement(449093..449278)
                     /locus_tag="SPG_0455"
     CDS             complement(449093..449278)
                     /locus_tag="SPG_0455"
                     /codon_start=1
                     /transl_table=11
                     /product="IS1380-Spn1, transposase"
                     /protein_id="ACF55200.1"
                     /translation="MNSLPNHHFQNKSFYQLSFDGGHLTQYGGLIFFQELFSQLKLKE
                     RISKYLVTNDQRRFSNE"
     gene            449498..450025
                     /locus_tag="SPG_0456"
     CDS             449498..450025
                     /locus_tag="SPG_0456"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF56742.1"
                     /translation="MSYFKKYKFDKSQFKLGMRTFKTGIAVFLVLLIFGFFGWKGLQI
                     GALTAVFSLRESFDESVHFGTSRILGNSIGGLYALVFFLLNTFFHEAFWVTLVVVPIC
                     TMLTIMTNVAMNNKAGVIGGVAAMLIITLSIPSGETISYVFVRVSETFMGVFVAIIVN
                     YDIDRIRLFLEKKEK"
     gene            450102..450458
                     /gene="glnR"
                     /locus_tag="SPG_0457"
     CDS             450102..450458
                     /gene="glnR"
                     /locus_tag="SPG_0457"
                     /note="identified by match to protein family HMM PF00376"
                     /codon_start=1
                     /transl_table=11
                     /product="HTH-type transcriptional regulator GlnR"
                     /protein_id="ACF56145.1"
                     /translation="MKEKEFRRNMAVFPIGSVMKLTDLSARQIRYYEDQELIKPDRNE
                     GNRRMYSLNDMDRLLEIKDYISEGYNIAAIKKKYAEREAKSKKAVSQTEVRRALHNEL
                     LQQGRFASVQSPFGRG"
     gene            450495..451841
                     /gene="glnA"
                     /locus_tag="SPG_0458"
     CDS             450495..451841
                     /gene="glnA"
                     /locus_tag="SPG_0458"
                     /EC_number="6.3.1.2"
                     /note="identified by match to protein family HMM PF00120;
                     match to protein family HMM PF03951; match to protein
                     family HMM TIGR00653"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine synthetase, type I"
                     /protein_id="ACF55011.1"
                     /translation="MPITAADIRREVKEKNVTFIRLMFSDILGTMKNVEIPATDEQLD
                     KVLSNKVMFDGSSIEGFVRINESDMYLYPDLDTWTVFPWGDENGSVAGLICDVYTTEG
                     EPFAGDPRGNLKRALRHMEEVGFKSFNLGPEPEFFLFKLDENGDPTLEVNDKGGYFDL
                     APTDLADNTRREIVNVLTKMGFEVEASHHEVAVGQHEIDFKYDEVLRACDKIQIFKLV
                     VKTIARKHGLYATFMAKPKFGIAGSGMHCNMSLFDAEGNNAFFDPNDPKGMQLSETAY
                     HFLGGLIKHAYNYTAIMNPTVNSYKRLVPGYEAPVYIAWAGRNRSPLVRVPASRGMGT
                     RLELRSVDPMANPYVAMAVLLEVGLYGIENKIEAPAPIEENIYIMTAEERKEAGITDL
                     PSTLHNALKALTEDEVVKAALGDHIYTSFLEAKRIEWASYATFVSQWEIDNYLDLY"
     gene            452021..452170
                     /locus_tag="SPG_0459"
     CDS             452021..452170
                     /locus_tag="SPG_0459"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF54868.1"
                     /translation="MEKFNFKNNIGQENKLLQIEIYKFTNFYKLQNYTSVNIFSKDIF
                     EAIVN"
     gene            452623..453921
                     /locus_tag="SPG_0460"
     CDS             452623..453921
                     /locus_tag="SPG_0460"
                     /note="identified by match to protein family HMM PF01420"
                     /codon_start=1
                     /transl_table=11
                     /product="type I restriction-modification system, S
                     subunit"
                     /protein_id="ACF56519.1"
                     /translation="MRXSTLVEIVRGGSPRPIKDYLTSEVDGINWIKIGDTEKGEKYI
                     NNVKEKIKKSGLNKTRFVKKGTFLLTNSMSFGRPYILNVDGAIHDGWLAISNYENSLN
                     KDYLFYILSSNVVYSQFLSLISGAVVKNLNSDKVASILIPLPPLSEQQRIIEAIESAL
                     EKVDEYAESYNRLEQLDKEFPDKLKKSILQYAMQGKLVEQDPNDESVEVLLEKIRAEK
                     QKLFEEGKIKKKDLDISIVSQGDDNSYYGNKDETTSYPIYEIPEAWRYIKFASLVNFR
                     IGKTPPRSEATFWGTEIPWVSISDMPISGYVTNTRESISKLALKSKKIDISPKGTLLM
                     SFKLSIGKVAILDIPATHNEAIISIFPYANKENIIRDYLMIFLPLISTLGDSKDAIKG
                     KTLNSTSISELLIPISNHEEMKRIISKVDLLFQKVSQLFE"
     gene            complement(454332..455426)
                     /locus_tag="SPG_0461"
     CDS             complement(454332..455426)
                     /locus_tag="SPG_0461"
                     /note="identified by match to protein family HMM PF01420"
                     /codon_start=1
                     /transl_table=11
                     /product="Type I restriction modification DNA specificity
                     domain"
                     /protein_id="ACF56019.1"
                     /translation="MTPEQLKASILQRAMEGKLVPQNPNDEPASELLKRIKAEKEKLI
                     SEGKIKRDKKETEIFRGDDGKHYGKFADGSTQEIDVPYDIPDTWEWVRISTLVEIVRG
                     GSPRPIKDYLTSEVDGINWIKIGDTEKGEKYINNVKEKIKKSGLNKTRFVKKGTFLLT
                     NSMSFGRPYILNVDGAIHDGWLAISNYENSLNKDYLFYILSSNVVYSQFLSLISGAVV
                     KNLNSDKVASILIPLPPLSEQQRIIEAIESALEKVDEYAESYNRLEQLDKEFPDKLKK
                     SILQYAMQGKLVEQDPNDESVEVLLEKIRAEKQKLFEEGKIKKKDLDISIVSQGDDNS
                     YYGNIPMNWVVIKIKDIFSMNTGLSWRFKH"
     gene            complement(455426..456889)
                     /locus_tag="SPG_0462"
     CDS             complement(455426..456889)
                     /locus_tag="SPG_0462"
                     /EC_number="2.1.1.72"
                     /note="identified by match to protein family HMM PF02384;
                     match to protein family HMM PF05175"
                     /codon_start=1
                     /transl_table=11
                     /product="type I restriction-modification system, M
                     subunit"
                     /protein_id="ACF55649.1"
                     /translation="MSITSFVKRIQDITRNDAGVNGDAQRIEQMSWLLFLKIYDSREM
                     VWELEEDEYESIIPKELKWRNWAHAQNGERVLTGDELLDFVNNKLFKELKELEITSNM
                     PIRKTIVKSAFEDANNYMKNGVLLRQVINVIDEVDFNSPEDRHSFNDIYEKILKDIQN
                     AGNSGEFYTPRAATDFIAEVLDPKLGESMADLACGTGGFLTSTLNRLSSQRKTSEDTK
                     KYNTAVFGIEKKAFPHLLAVTNLFLHEIDDPKIVHGNTLEKNVREYTDDEKFDIIMMN
                     PPFGGSELETIKNNFPAELRSSETADLFMAVIMYRLKENGRVGVILPDGFLFGEGVKT
                     RLKQKLVDEFNLHTIIRLPHSVFAPYTGIHTNILFFDKTKKTEETWFYRLDMPDGYKN
                     FSKTKPMKSEHFNPVRDWWENREEILEGKFYKSKSFTPSELAELNYNLDQCGFPKEEE
                     EILNPFELIQNYQAERATLNHKIDNVLADILQLLEDK"
     gene            complement(456902..459235)
                     /locus_tag="SPG_0463"
     CDS             complement(456902..459235)
                     /locus_tag="SPG_0463"
                     /EC_number="3.1.21.3"
                     /note="identified by match to protein family HMM PF00270;
                     match to protein family HMM PF04313; match to protein
                     family HMM PF04851; match to protein family HMM PF08463"
                     /codon_start=1
                     /transl_table=11
                     /product="type I restriction-modification system, R
                     subunit"
                     /protein_id="ACF54824.1"
                     /translation="MVEFIKSKKEMSEEDIKANFITPAIVSKGWKNGEHIAYEEYFTD
                     GRIEVRGDKARRKEGKKSDYSLYYQFGTRIAIVEAKDNKHSVRAGLQQAIEYGEILDV
                     PFVYSSNGDGFIEHDRITREERELELDEFPTREELFSRMTKEKGLTYEITEAISTPYY
                     TDAFSMKTPRYYQQIAINRTIETVARGQKRVMFVMATGTGKTFMAFQIIHRLRKAGLA
                     KRVLFLADRNILVDQTMAEDFRPFEKVMTKITPKLLTAPEKLNSFEIYLGLYQQLTGE
                     DGTETHYQKFDKDFFDLIVIDEAHRGSAKEDSNWRKVIDYFSSATQIGMTATPKETKN
                     ASNTEYFGEPIYTYSLKQGIEDGFLAPYRVMRVNLDVDVDGYRPETGKVDANGQLIED
                     RYYGRKDFDKTIVIDDRTQRVAKFVSDYMKQNNARFDKTIVFCVDIDHAERMRAALVK
                     ENLDLVQEDYRYVMQVTGDNAEGKAQLDNFMDVNSNFPAIVTTSKLLTTGVNAKTCRL
                     IVLDSNIQSMTEFKQIIGRGTRLYPQKGKEFFTIIDFRNVTNLFADPDFDGEPVKVLE
                     TGAKTVSGSTPGFVGEEGDPVEKYIVTDKQVTILNSTVQVLDENGKLITESLTDYTRK
                     NILGSYATLNDFITVWHTADKKKLILDELYKKGVYLDAIRESEGISEQEIDDFDLLLK
                     LAYGQKELTKTERINKLKQSGYLYKYSEEARAVLEILLNKYMDKGIGELESIETLKLP
                     EFQIYGGTFKIINTYFGDKKRYLQAIKELEQELFTVA"
     gene            complement(459585..459713)
                     /locus_tag="SPG_0464"
     CDS             complement(459585..459713)
                     /locus_tag="SPG_0464"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF56618.1"
                     /translation="MKIKNTPQLKELPPVTNFEKNGSRAKKRSKIGSIRIVKIRLA"
     gene            459920..460351
                     /locus_tag="SPG_0465"
     CDS             459920..460351
                     /locus_tag="SPG_0465"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF56797.1"
                     /translation="MKGWRYRTSRFGLFYFEQGQPDDVIYRIYDSRFLKKYKHELQDF
                     RDRGWELIGAGSCSILRKSSSDLLPEVQVYMSKGLKWEVMRSRLRSCTATFLGGLVVC
                     MSLFREDLSMSFFLIFVLYAFLISYLIHGYFRLKRKYRVDE"
     gene            460515..461549
                     /gene="hrcA"
                     /locus_tag="SPG_0466"
     CDS             460515..461549
                     /gene="hrcA"
                     /locus_tag="SPG_0466"
                     /note="identified by match to protein family HMM PF01628;
                     match to protein family HMM PF08220; match to protein
                     family HMM TIGR00331"
                     /codon_start=1
                     /transl_table=11
                     /product="heat-inducible transcription repressor HrcA"
                     /protein_id="ACF55413.1"
                     /translation="MVTERQQDILNLIIDIFTKTHEPVGSKALQESINSSSATIRNDM
                     AELEKQGLLEKAHTSSGRMPSVAGFQYYVKHSLDFDRLAENEVYEIVKAFDQEFFKLE
                     DILQEAANLLTDLSGCTVVALDVEPSRQRLTAFDIVVLGQHTALAVFTLDESRTVTSQ
                     FLIPRNFLQEDLLKLKSIIQERFLGHTVLDIHYKIRTEIPQIIQRYFTTTDNVIDLFE
                     HIFKEMFNENIVMAGKVHLLNFANLAAYQFFDQPQKVALEIREGLREDQMQNVRVADG
                     QESCLADLAVISSKFLIPYRGVGILAIIGPVNLDYQQLINQVNVVNRVLTMKLTDFYR
                     YLSSNHYEVH"
     gene            461576..462100
                     /gene="grpE"
                     /locus_tag="SPG_0467"
     CDS             461576..462100
                     /gene="grpE"
                     /locus_tag="SPG_0467"
                     /note="identified by match to protein family HMM PF01025"
                     /codon_start=1
                     /transl_table=11
                     /product="co-chaperone GrpE"
                     /protein_id="ACF55601.1"
                     /translation="MAQDIKNEEVEEVQEEEVVETAEETTPEKSELDLANERADEFEN
                     KYLRAHAEMQNIQRRANEERQNLQRYRSQDLAKAILPSLDNLERALAVEGLTDDVKKG
                     LGMVQESLIHALKEEGIEEIAADGEFDHNYHMAIQTLPADDEHPVDTIAQVFQKGYKL
                     HDRILRPAMVVVYN"
     gene            462580..464403
                     /gene="dnaK"
                     /locus_tag="SPG_0468"
     CDS             462580..464403
                     /gene="dnaK"
                     /locus_tag="SPG_0468"
                     /note="identified by match to protein family HMM PF00012;
                     match to protein family HMM TIGR02350"
                     /codon_start=1
                     /transl_table=11
                     /product="chaperone protein DnaK"
                     /protein_id="ACF55265.1"
                     /translation="MSKIIGIDLGTTNSAVAVLEGTESKIIANPEGNRTTPSVVSFKN
                     GEIIVGDAAKRQAVTNPDTVISIKSKMGTSEKVSANGKEYTPQEISAMILQYLKGYAE
                     DYLGEKVTKAVITVPAYFNDAQRQATKDAGKIAGLEVXRIVNEPTAAALAYGLDKTDK
                     EEKXXVFDLGGGTFDVSILELGDGVFDVLSTAGDNKLGGDDFDQKIIDHLVAEFKKEN
                     GIDLSTDKMAMQRLKDAAEKAKKDLSGVTSTQISLPFITAGEAGPLHLEMTLTRAKFD
                     DLTRDLVERTKVPVRQALSDAGLSLSEIDEVILVGGSTRIPAVVEAVKAETGKEPNKS
                     VNPDEVVAMGAAIQGGVITGDVKDVVLLDVTPLSLGIETMGGVFTKLIDRNTTIPTSK
                     SQVFSTAADNQPAVDIHVLQGERPMAADNKTLGRFQLTDIPAAPRGIPQIEVTFDIDK
                     NGIVSVKAKDLGTQKEQTIVIQSNSGLTDEEIDRMMKDAEANAEADKKRKEEVDLRNE
                     VDQAIFATEKTIKETEGKGFDAERDAAQAALDDLKKAQEDNNLDDMKAKLEALNEKAQ
                     GLAVKLYEQAAAAQQAQEGAEGAQATGNAGDDVVDGEFTEK"
     gene            465033..466169
                     /gene="dnaJ"
                     /locus_tag="SPG_0469"
     CDS             465033..466169
                     /gene="dnaJ"
                     /locus_tag="SPG_0469"
                     /note="identified by match to protein family HMM PF00226;
                     match to protein family HMM PF00684; match to protein
                     family HMM PF01556; match to protein family HMM TIGR02349"
                     /codon_start=1
                     /transl_table=11
                     /product="chaperone protein DnaJ"
                     /protein_id="ACF55338.1"
                     /translation="MNNTEFYDRLGVSKNASADEIKKAYRKLSKKYHPDINKEPGAED
                     KYKEVQEAYETLSDDQKRAAYDQYGAAGANGGFGGAGGFGGFNGAGGFGGFEDIFSSF
                     FGGGGSSRNPNAPRQGDDLQYRVNLTFEEAIFGTEKEVKYHREAGCRTCNGSGAKPGT
                     SPVTCGRCHGAGVINVDTQTPLGMMRRQVTCDVCHGRGKEIKYPCTTCHGTGHEKQAH
                     SVHVKIPAGVETGQQIRLAGQGEAGFNGGPYGDLYVVVSVEASDKFEREGTTIFYNLN
                     LNFVQAALGDTVDIPTVHGDVELVIPEGTQTGKKFRLRSKGAPSLRGGAVGDQYVTVN
                     VVTPTGLNDRQKVALKEFAAAGDLKVNPKKKGFFDHIKDAFDGE"
     gene            complement(466536..466823)
                     /locus_tag="SPG_0470"
     CDS             complement(466536..466823)
                     /locus_tag="SPG_0470"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF55002.1"
                     /translation="MKLSNLLLFAGAAAGSYLVTKNRQTITDEVLNTTDRVQAIKDDV
                     DIIQNSLQIIDQQKELIKEYQEDLTYKFKVLEKDIQTRLAVIKEMQGTEDK"
     gene            complement(466833..467243)
                     /locus_tag="SPG_0471"
     CDS             complement(466833..467243)
                     /locus_tag="SPG_0471"
                     /note="identified by match to protein family HMM PF01230"
                     /codon_start=1
                     /transl_table=11
                     /product="histidine triad domain"
                     /protein_id="ACF55464.1"
                     /translation="MSDCIFCKIIAGEIPASKVYXXEQVLAFLDISQVTLGHTLVVPK
                     EHYRNLLEMDATSASQLFAQVPXVAQKVMKVTKAAGMNIISNCEEVAGQTVFHTHVHL
                     VPRYSADDDLKIDFIAHEPDFDKLAQVAETIKNA"
     gene            467311..468042
                     /locus_tag="SPG_0472"
     CDS             467311..468042
                     /locus_tag="SPG_0472"
                     /note="identified by match to protein family HMM PF00005"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, ATP-binding protein"
                     /protein_id="ACF55022.1"
                     /translation="MLEIKNLTGGYVHVPVLKDVSFTVESGQLVGLIGLNGAGKSTTI
                     NEIIGLLTPYSGSININGLTLQEDATSYRKQIGYIPETPSLYEELTLREHIETVAMAY
                     GIEQKVTFERVEPLLKMFRLEQKLDWFPVHFSKGMKQKVMIICAFVVDPSLFIVDEPF
                     LGLDPLAISDLIQLLEVEKQKGKSILMSTHVLDSAXXMCDAFVILHKGEVRAKGNLLQ
                     LREAFDMPEASLNDIYLALTKEEDL"
     gene            468039..469088
                     /locus_tag="SPG_0473"
     CDS             468039..469088
                     /locus_tag="SPG_0473"
                     /note="identified by match to protein family HMM PF05975"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, permease protein"
                     /protein_id="ACF56550.1"
                     /translation="MKDLFLKRKQAFRKECLGYLRYVLNDHFVLFLLVLLGFLAYQYS
                     QLLQHFPENHWPILLFVGITSVLLLLWGGIATYMEAPDKLFLLVGEEEIKLHLKRQTG
                     ISLVFWLFVQTLFLLLFAPLFLAMGYGLPVFLLYVLLLGVGKYFHFRQKASKFFTETG
                     LDWDYVISQESKRKQVLLRFFALFTQVKGISNSVKRRAYLDFILKAVQKVPGKIWQNL
                     YLRSYLRNGDLFALSLRLLLLSVLAQVFIEQAWIATAVVVLFNYLLLFQLLALYHAFD
                     YQYLTQLFPLDKGQKEKGLQEVVRGLTSFVLLVELVVGLITFQEKLALLALLGAGLVL
                     LVLYLPYQVKRQMQD"
     gene            complement(469256..469585)
                     /gene="blpT"
                     /locus_tag="SPG_0474"
     CDS             complement(469256..469585)
                     /gene="blpT"
                     /locus_tag="SPG_0474"
                     /note="De Saizieu, A.; 2000 J.Bact 182:4696-4703"
                     /codon_start=1
                     /transl_table=11
                     /product="BlpT protein, fusion"
                     /protein_id="ACF55843.1"
                     /translation="MTDTDPIKRAHTLITDLNKAYQACKQASADDVRFQEQLNSILGF
                     LAKAETVDNRFLIELEXFYQTSSLLMGLSALDPDAPTRAAWRAYDRFHFDQVKTKLIL
                     NENQRAN"
     gene            469862..470200
                     /gene="blpS"
                     /locus_tag="SPG_0475"
     CDS             469862..470200
                     /gene="blpS"
                     /locus_tag="SPG_0475"
                     /note="De Saizieu, A.; 2000 J.Bact 182:4696-4703;
                     identified by match to protein family HMM PF04397"
                     /codon_start=1
                     /transl_table=11
                     /product="BlpS protein"
                     /protein_id="ACF55842.1"
                     /translation="MKYMIIQTQKTVYKVNIDDIYYIQTHPTKAHTVQIVTEEASFNM
                     LQNLSNLENQCGETLMRCHRNCLVNLDKLKSIDFQERILFLGEEGQYAVKYARRRYRE
                     IRQKWLKEGE"
     gene            470205..470942
                     /gene="blpR"
                     /locus_tag="SPG_0476"
     CDS             470205..470942
                     /gene="blpR"
                     /locus_tag="SPG_0476"
                     /note="de Saizieu A J Bacteriol. 2000
                     Sep;182(17):4696-703.; identified by match to protein
                     family HMM PF00072; match to protein family HMM PF04397"
                     /codon_start=1
                     /transl_table=11
                     /product="BlpR response regulator TCS13"
                     /protein_id="ACF55252.1"
                     /translation="MRIFVLEDDFSQQTRIETTXEKLLKAHHIIPSSFEVFGKPDQLL
                     AEVHEKGAHQLFFLDIEIRNEEMKGLEVARKIRDRDPYALIVFVTTHSEFMPLSFRYQ
                     VSALDYIDKALSAEEFESRIETALLYANSQDSKSLAEDCFYFKSKFAQFQYPFKEVYY
                     LETSPRAHRVILYTKTDRLEFTASLEEVFKQEPRLLQCHRSFLINPANVVHLDKKEKL
                     LFFPNGGSCLIARYKVREVSEAINKLH"
     gene            470956..472296
                     /gene="blpH"
                     /locus_tag="SPG_0477"
     CDS             470956..472296
                     /gene="blpH"
                     /locus_tag="SPG_0477"
                     /note="de Saizieu A J Bacteriol. 2000
                     Sep;182(17):4696-703.; identified by match to protein
                     family HMM PF02518"
                     /codon_start=1
                     /transl_table=11
                     /product="BlpH histidine kinase TCS13"
                     /protein_id="ACF56847.1"
                     /translation="MNIAWILLYTLVTNGLEIVIFFKVDGIDLAFERIFKAFLFKILL
                     AFVFVMISYIVGNVYLSYFMEPLYGIGLSFLLLRGLPKKLLFFYGLFPMILVNLFYRG
                     VSYFVLPFLGQGQVYDGYSFTGLCIIIFNFFISLAFLKWLDYDFTSLRKEILDKAFQK
                     SLTQINWIMGGYYLVMESLSFFEYEQSIQSKTVRHLILVFYLLFFMGVIKKLDTYLKE
                     KLYERLEQEQALRYRDMERYSRHIEELYKEVRSFRHDYTNLLTSLRLGIEEEDMEQIK
                     EVYGSVLKDSSQKLQNNKYDLGRLVNIRDKALKSLXAGKFLKARDKNIVFNVEVPEEI
                     QVEGMSLLDFLTIVSILCDNAIEASVEASQPHVSIAFLKNGAQETFIIENSIKEEGID
                     ISEIFSFGASSKGEERGVGLYTVMKIVESHPNTSLNTTCQNQVFRQVLTVIHTE"
     gene            complement(472367..472495)
                     /gene="blpC"
                     /locus_tag="SPG_0478"
     CDS             complement(472367..472495)
                     /gene="blpC"
                     /locus_tag="SPG_0478"
                     /note="De Saizieu, A.; 2000 J.Bact 182:4696-4703;
                     identified by match to protein family HMM PF08128; match
                     to protein family HMM TIGR01847"
                     /codon_start=1
                     /transl_table=11
                     /product="bacteriocin BlpC"
                     /protein_id="ACF56106.1"
                     /translation="MDKKQNLTSFQELTTTELNQITGGGLWEDLLYNINRYAHYIT"
     gene            complement(472552..473913)
                     /gene="blpB"
                     /locus_tag="SPG_0479"
     CDS             complement(472552..473913)
                     /gene="blpB"
                     /locus_tag="SPG_0479"
                     /note="De Saizieu, A.; 2000 J.Bact 182:4696-4703;
                     identified by match to protein family HMM TIGR01000"
                     /codon_start=1
                     /transl_table=11
                     /product="BlpC ABC transporter"
                     /protein_id="ACF56304.1"
                     /translation="MNPNLFRSVEFYQRRYHNYATVLIIPLSLLFTFILIFSLVATKE
                     ITVTSQGEIAPTSVIASIQSTSDNPILANHLVANQVVEKGDLLIXYSEXMEESQKTAL
                     ATQLQRLEKQKEGLGILKQSLEKATDLFSGEDEFGYHNTFMNFTKQSHDIELGITKTN
                     TEVSNQANLSNSSSSAIEQEITKVQQQIGEYQELRDAIINNRARLPTGNPHQSILNRY
                     LVASQGQTQGTAEEPFLSQINQSIAGLESSIASLKIQQAGIGSVATYDNSLATKIEVL
                     RTQFLQTASQQQLTVENQLTELKVQLDQATQRLENNTLTSPSKGIVHLNSEFEGKNRI
                     PTGTEIAQIFPVITDTREVLITYYVSSDYLPLLDKGQTVRLKLEKIGNHGTTIIGQLQ
                     TIDQTPTRTEQGNLFKLTALAKLSNEDSKLIQYGLQGRVTSVTTKKTYFDYFKDKILT
                     HSD"
     gene            complement(473924..476077)
                     /gene="blpA"
                     /locus_tag="SPG_0480"
     CDS             complement(473924..476077)
                     /gene="blpA"
                     /locus_tag="SPG_0480"
                     /EC_number="3.4.22.-"
                     /note="De Saizieu, A.; 2000 J.Bact 182:4696-4703;
                     identified by match to protein family HMM PF00005; match
                     to protein family HMM PF00664; match to protein family HMM
                     PF03412; match to protein family HMM TIGR01193"
                     /codon_start=1
                     /transl_table=11
                     /product="BlpC ABC transporter, ATP-binding protein
                     (blpA)"
                     /protein_id="ACF56739.1"
                     /translation="MTSYKRTFVPQIDARDCGVAALASIAKFYGSDFSLAHLRELAKT
                     NKEGTTALGIVKAADEMGFETRPVQADKTLFDMSDVPYPFIVHVNKEGKLQHYYVVYQ
                     TKKDYLVIGDPDPSVKITKMSKERFFSEWTGVAIFLAPKPSYQPHKDKKNGLLSFLPL
                     IFKQKSLIAYIVLSSLLVTIINIGGSYYLQGILDEYIPNQMKSTLGIISVGLVITYIL
                     QQVMSFSRDYLLTVLSQRLSIDVILSYIRHIFELPMSFFATRRTGEIISRFTDANSII
                     DALASTILSLFLDVSILILVGGVLLAQNPNLFLLSLISIPIYMFIIFSFMKPFEKMNH
                     DVMQSNSMVSSAIIEDINGIETIKSLTSEENRYQNIDSEFVDYLEKSFKLSKYSILQT
                     SLKQGTKLVLNILILWFGAQLVMSSKISIGQLITFNTLFSYFTTPMENIINLQTKLQS
                     AKVANNRLNEVYLVESEFQVQENPVHSHFLMGDIEFDDLSYKYGFGRDTLTDINLTIK
                     QGDKVSLVGVSGSGKTTLAKMIVNFFEPYKGHISINHQDIKNIDKKVLRRHINYLPQQ
                     AYIFNGSILENLTLGGNHMISQEDILRACELAEIRQDIERMPMGYQTQLSDGAGLSGG
                     QKQRIALARALLTKSPVLILDEATSGLDVLTEKKVIDNLMSLTDKTILFVAHRLSIAE
                     RTNRVIVLDQGKIIEVGSHQELMQAQGFYHHLFNK"
     gene            476358..476561
                     /gene="blpPQ"
                     /locus_tag="SPG_0481"
     CDS             476358..476561
                     /gene="blpPQ"
                     /locus_tag="SPG_0481"
                     /codon_start=1
                     /transl_table=11
                     /product="bacteriocin blpPQ"
                     /protein_id="ACF55901.1"
                     /translation="MNTKMMSQFSVMDNEMLDRIEGGIFGVDDALFWAGLGYVAGSIV
                     DTAIDDFTNQCRKNPHQWFCVRV"
     gene            476879..477082
                     /locus_tag="SPG_0482"
     CDS             476879..477082
                     /locus_tag="SPG_0482"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF56382.1"
                     /translation="MEKIDYITLNEVELETISGGDDCFIGDIGCIGWGLLKSIGGMIK
                     PAPYVPPVCIPKSSWNPAPPVPC"
     gene            477656..477820
                     /locus_tag="SPG_0483"
     CDS             477656..477820
                     /locus_tag="SPG_0483"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF55779.1"
                     /translation="MKKKILIIFILYLIMSIFLYPLRESIWYQLFYTIAYVIAVMIYF
                     ALTKKKGAKK"
     gene            478116..478487
                     /locus_tag="SPG_0484"
     CDS             478116..478487
                     /locus_tag="SPG_0484"
                     /codon_start=1
                     /transl_table=11
                     /product="IS1381, transposase OrfA"
                     /protein_id="ACF56124.1"
                     /translation="MHDLSVLLVGVQRTTFEEMLAVLKTAYQLKHAKGGRKPKLSLED
                     LLMATLQYVREYRTYEEIAADFGIHESNLIRRSQWVEVTLVQSGVTISRTPLSSEDTV
                     MIDATEVKINRPKKTISESFW"
     gene            478575..478874
                     /locus_tag="SPG_0485"
     CDS             478575..478874
                     /locus_tag="SPG_0485"
                     /codon_start=1
                     /transl_table=11
                     /product="IS1381, transposase OrfB"
                     /protein_id="ACF56729.1"
                     /translation="MSRRNIGQAGKILADSGYQGLMKIYPQAQTSRKSSKLKPLTVED
                     KACNHALSKERSKVENIFAKVKTFKMFSTTYRNHRKRFGLRMNLSAGIINHELGF"
     gene            479024..479278
                     /gene="blpM"
                     /locus_tag="SPG_0486"
     CDS             479024..479278
                     /gene="blpM"
                     /locus_tag="SPG_0486"
                     /note="De Saizieu, A.; 2000 J.Bact 182:4696-4703;
                     identified by match to protein family HMM TIGR01847"
                     /codon_start=1
                     /transl_table=11
                     /product="bacteriocin BlpM"
                     /protein_id="ACF54924.1"
                     /translation="MDTKIMEQFHEMDITMLSSIEGGKNNWQTNVLEGXGAAFGGWGL
                     GTAICAASGVGAPFMGACGYIGAKFGVDLWAGVTGATGGF"
     gene            479294..479497
                     /gene="blpN"
                     /locus_tag="SPG_0487"
     CDS             479294..479497
                     /gene="blpN"
                     /locus_tag="SPG_0487"
                     /note="De Saizieu, A.; 2000 J.Bact 182:4696-4703"
                     /codon_start=1
                     /transl_table=11
                     /product="bacteriocin BlpN"
                     /protein_id="ACF55518.1"
                     /translation="MNTYCNINETMLSEVYGGNSGGAAVVAALGCAAGXVKYGRLLGP
                     WGAAIGGIGGAVVCGYLAYTATS"
     gene            479516..479725
                     /locus_tag="SPG_0488"
     CDS             479516..479725
                     /locus_tag="SPG_0488"
                     /codon_start=1
                     /transl_table=11
                     /product="bacteriocin blp"
                     /protein_id="ACF56807.1"
                     /translation="MKAIFFIILFAFQTYLIYLSISISDKKQKTIELTSLNCFVILFL
                     IYDKLIFLFIAYVFLIIFILNLFRN"
     gene            479741..479890
                     /gene="blpO"
                     /locus_tag="SPG_0489"
     CDS             479741..479890
                     /gene="blpO"
                     /locus_tag="SPG_0489"
                     /note="De Saizieu, A.; 2000 J.Bact 182:4696-4703;
                     identified by match to protein family HMM TIGR01847"
                     /codon_start=1
                     /transl_table=11
                     /product="bacteriocin BlpO"
                     /protein_id="ACF55862.1"
                     /translation="MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDG
                     CATTV"
     gene            479872..479991
                     /locus_tag="SPG_0490"
     CDS             479872..479991
                     /locus_tag="SPG_0490"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF55302.1"
                     /translation="MCNNGLTFLLGPFAIGIGVTGAAGGAILGGVAYAAICWW"
     gene            479994..480113
                     /locus_tag="SPG_0491"
     CDS             479994..480113
                     /locus_tag="SPG_0491"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF56056.1"
                     /translation="MDFKSFIIGLVVGIFGPYMDDLIRKIFSKSSKKDTDSTL"
     gene            480899..481282
                     /gene="blpX"
                     /locus_tag="SPG_0492"
     CDS             480899..481282
                     /gene="blpX"
                     /locus_tag="SPG_0492"
                     /note="De Saizieu, A.; 2000 J.Bact 182:4696-4703"
                     /codon_start=1
                     /transl_table=11
                     /product="immunity protein BlpX"
                     /protein_id="ACF55471.1"
                     /translation="MKYRLFFVIFLSSVLDILLGTFLQISIVSIGWLVLYSGLFEAGV
                     FLLANKGVAVKIKEVDIRNRFKFIFGKTLWFQILLLIFLIIKLYLGLDARLILFYGHI
                     FIVFNALMYLLSSSQVSLKKNKLSS"
     gene            481334..482023
                     /locus_tag="SPG_0493"
     CDS             481334..482023
                     /locus_tag="SPG_0493"
                     /note="De Saizieu, A.; 2000 J.Bact 182:4696-4703;
                     identified by match to protein family HMM PF02517"
                     /codon_start=1
                     /transl_table=11
                     /product="immunity protein BlpY"
                     /protein_id="ACF55006.1"
                     /translation="MKKYQLLFKISAVFSYLFFVFGLSQLTLIVQNYWQFSSQIGNLF
                     WIQNILSLLFIGVMIVVLVKTGHGYLFRIPRKKWLWYSILTVLVVVLQISFNVQTAKH
                     VQSTAEGWAVLIGYSGTNFAELGIYIALFFLVPLMEELIYRGLLQHAFFKHSRFGLDL
                     LLPSILFALPHFLSLPSLLDIFVFATFGIIFAGLTRYTKSIYPSYAVHVINNIVATFP
                     FLLTFLHRVLG"
     gene            482065..482313
                     /gene="blpZ"
                     /locus_tag="SPG_0494"
     CDS             482065..482313
                     /gene="blpZ"
                     /locus_tag="SPG_0494"
                     /note="De Saizieu, A.; 2000 J.Bact 182:4696-4703"
                     /codon_start=1
                     /transl_table=11
                     /product="BlpZ protein, fusion"
                     /protein_id="ACF56447.1"
                     /translation="MYKHLFFLDSKTLDRLTPYILVLASDTIAFNVFVLTFVSAVVFN
                     FLNSMLALMAIFIGAGYVVGFWLLKWFVLERLELKNDV"
     gene            482343..482954
                     /locus_tag="SPG_0495"
     CDS             482343..482954
                     /locus_tag="SPG_0495"
                     /note="identified by match to protein family HMM PF02517"
                     /codon_start=1
                     /transl_table=11
                     /product="CAAX amino terminal protease family"
                     /protein_id="ACF55940.1"
                     /translation="MEFFDKFHALCFGFLVLIIVITVPYTINHGDFFQNESALIIVSL
                     LVTSLSVAYARKFEMISFGMLSKKQLLLFIAIFLLSVLETLVYIHFFAVSSGSGVQHL
                     AEVSRGISLSLILTTSVFGPIQEELIFRGLLQGAVFDNSWLGLVLTSSLFSFMHGPSN
                     VPSFIFYLLGGLLLGFAYKKSQNLWVSTLVHMLYNSWPLLYYL"
     gene            483115..483909
                     /locus_tag="SPG_0496"
     CDS             483115..483909
                     /locus_tag="SPG_0496"
                     /note="identified by match to protein family HMM PF01636"
                     /codon_start=1
                     /transl_table=11
                     /product="Phosphotransferase enzyme family protein"
                     /protein_id="ACF56126.1"
                     /translation="MDLGDNELTLTPIPGKSGKAYMGSYPDGKRIFVKMNTSPILPGL
                     AREQIAPQLLWSRRLADGRDMCAQEWLTGKILTPYDMNRKQIVNILTRLHRSRPLMTQ
                     LSRLGYAMETPVDLLQSWQETAPDALRKNHFISEVMADLRQTIPGFREDHATIVHGDV
                     RHSNWIETDSGLIYLVDWDSVRLTDRMFDVAHMLCHYISEHQWKEWLTYYGYKYNQTV
                     LSKLYWYGQLSYLSQISKYYMNQDLENVNREIHGLRHFRDKYGKRR"
     gene            483906..484541
                     /gene="trmB"
                     /locus_tag="SPG_0497"
     CDS             483906..484541
                     /gene="trmB"
                     /locus_tag="SPG_0497"
                     /EC_number="2.1.1.33"
                     /note="identified by match to protein family HMM PF02390;
                     match to protein family HMM TIGR00091"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA (guanine-N(7)-)-methyltransferase"
                     /protein_id="ACF55826.1"
                     /translation="MRVRNRKGATELLEANPQYVVLNPLEAKAKWRDLFGNDNPIHVE
                     VGSGKGAFVSGMAKQNPDINYIGIDIQKSVLSYALDKVLEAGVSNIKLLWVDGSDLTD
                     YFEDGEIDRLYLNFSDPWPKKRHEKRRLTYKTFLDTFKRILPENGEIHFKTDNRGLFE
                     YSLVSFSQYGMKLNGVWLDLHASDFEGNVMTEYEQKFSNKGQVIYRVEAEF"
     gene            484667..485146
                     /locus_tag="SPG_0498"
     CDS             484667..485146
                     /locus_tag="SPG_0498"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF54897.1"
                     /translation="MDAIATIVELVREVVEPVIEAPFELVDIEYGKIGSDMILSIFVD
                     KPEGITLNDTADLTEIISPVLDTIKPDPFPEQYFLEITSPGLERPLKTKDAVAGAVGK
                     YIHVGLYQAIDKQKVFEGTLLAFEEDELTMEYMDKTRKKTVQIPYSLVSKARLAVKL"
     gene            485190..486326
                     /gene="nusA"
                     /locus_tag="SPG_0499"
     CDS             485190..486326
                     /gene="nusA"
                     /locus_tag="SPG_0499"
                     /note="identified by match to protein family HMM PF00575;
                     match to protein family HMM PF08529; match to protein
                     family HMM TIGR01953"
                     /codon_start=1
                     /transl_table=11
                     /product="transcription termination factor NusA"
                     /protein_id="ACF56743.1"
                     /translation="MSKEMLEAFRILEEDKGIKKEDIIDAVVESLRSAYRRRYGQSDS
                     VAIDFNEKTGDFTVYTVREVVDEVFDSRLEISLKDALAINSAYELGDKIKFEEAPAEF
                     GRVAAQSAKQTIMEKMRKQTRAITYNTYKEHEQEIMSGTVERFDNRFIYVNLGSIEAQ
                     LSKQDQIPGEVFASHDRIEVYVYKVEDNPRGVNVFVSRSHPEMIKRLMEQEIPEVYDG
                     TVEIMSVAREAGDRTKVAVRSHNPNVDAIGTIVGRGGANIKKITSKFHPARYDAKNDR
                     MVPIEENIDVIEWVADPAEFIYNAIAPAEVDQVIFDENDSKRALVVVPXNKLSLAIGR
                     RGQNVRLAAHLTGYRIDIKSASEFEAMEDAASVELEVENDTVEE"
     gene            486348..486641
                     /locus_tag="SPG_0500"
     CDS             486348..486641
                     /locus_tag="SPG_0500"
                     /note="identified by match to protein family HMM PF04296"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF54998.1"
                     /translation="MKTRKIPLRKSVVSNEVIDKRDLLRIVKNKEGQVFIDPTGKANG
                     RGAYIKLDNAEALEAKKKKVFNRSFSMEVEESFYDELIAYVDHKVKRRELGLE"
     gene            486634..486933
                     /locus_tag="SPG_0501"
     CDS             486634..486933
                     /locus_tag="SPG_0501"
                     /note="identified by match to protein family HMM PF01248"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal protein L7A family protein"
                     /protein_id="ACF56697.1"
                     /translation="MNKQKMSNLLGLAQRAGRIISGEELVVKAIQDGKAKLVFLAHDA
                     GPNLTKKIQDKSHYYQVEIVTVFSTLELSIAVGKSRKVLAVTDAGFTKKMRSLME"
     gene            486950..489742
                     /locus_tag="SPG_0502"
     CDS             486950..489742
                     /locus_tag="SPG_0502"
                     /note="identified by match to protein family HMM PF00009;
                     match to protein family HMM PF01926; match to protein
                     family HMM PF03144; match to protein family HMM PF04760;
                     match to protein family HMM TIGR00231; match to protein
                     family HMM TIGR00487"
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor IF-2"
                     /protein_id="ACF56844.1"
                     /translation="MSKKRLYEIAKELGKESKEVVARAKELGLDVKSHSSSVEEAVAA
                     KIAASFKPAAAPKVEAKPAAPKVSAEKKAEKSEPAKPAVAKEEAKPAEPVAPKTEKVA
                     AKPQSRNFKAEREARAKEQAERRKQNKGNNRDQQQNGNRQKNDGRNGGKQGQSNRDNR
                     RFNDQAKKEQGQQKRRNERRQQEDKRSNQVAPRIDFKARAAALKAEQNAEYARSSEER
                     FKQYQAAKEALAQANKRKEPEEIFEEAAKLAEQAQQVQAVVEVVPEKKEPAVDTRRKK
                     QARPDKNRDDYDHEEDGPRKQQKNRSSQNQVRNQKNSNWNNNKKNKKGNNKNNRNQTP
                     KPVTERKFHELPTEFEYTDGMTVAEIAKRIKREPAEIVKKLFMMGVMATQNQSLDGET
                     IELLMVDYGIEAKQKVEVDNADIERFFVEDGYLNEDELVERPPVVTIMGHVDHGKTTL
                     LDTLRNSRVATGEAGGITQHIGAYQIVENGKKITFLDTPGHAAFTSMRARGASVTDIT
                     ILVVAADDGVMPQTIEAINHSKAANVPIIVAINKIDKPGANPERVIGELAEHGVMSTA
                     WGGDSEFVEISAKFNQNIEELLETVLLVAEIQELKADPTVRAIGTVIEARLDKGKGAV
                     ATLLVQQGTLNVQDPIVVGNTFGRVRAMTNDLGRRVKVAGPSTPVSITGLNEAPMAGD
                     HFAVYEDEKSARAAGEERAKRALMKQRQATQRVSLENLFDTLKAGELKSVNVIIKADV
                     QGSVEALSASLQKIDVEGVKVTIVHSAVGAINESDVTLAEASNAFIVGFNVRPTPQAR
                     QQAEADDVEIRLHSIIYKVIEEMEEAMKGMLDPEFEEKVIGEAVIRETFKVSKVGTIG
                     GFMVINGKVARDSKVRVIRDGVVIYDGELASLKHYKDDVKEVTNGREGGLMIDGYNDI
                     KMDDVIEAYVMEEIKR"
     gene            489993..490343
                     /locus_tag="SPG_0503"
     CDS             489993..490343
                     /locus_tag="SPG_0503"
                     /note="identified by match to protein family HMM PF02033;
                     match to protein family HMM TIGR00082"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome-binding factor A"
                     /protein_id="ACF56049.1"
                     /translation="MANHFRTDRVGMEIKREVNEILQKKVRDPRVQGVTITDVQMLGD
                     LSVAKVYYTILSNLASDNQKAQIGLEKATGTIKRELGRNLKLYKIPDLTFVKDESIEY
                     GNKIDEMLRNLDKN"
     gene            490631..491977
                     /locus_tag="SPG_0504"
     CDS             490631..491977
                     /locus_tag="SPG_0504"
                     /note="identified by match to protein family HMM PF01609"
                     /codon_start=1
                     /transl_table=11
                     /product="IS1380-Spn1, transposase"
                     /protein_id="ACF55317.1"
                     /translation="MNSLPNHHFQNKSFYQLSFDGGHLTQYGGLIFFQELFSQLKLKE
                     RISKYLVTNDQRRYCRYSDSDILVQFLFQLLTGYGTDYACKELSADAYFPKLLEGGQL
                     ASQPTLSRFLSRTDKDTVHSLRCLNLELVEFFLQFHQLNQLIVDIDSTHFTTYGKQEG
                     VAYNAHYRAHGYHPLYAFEGKTGYCFNAHLRPGIRYCSEEADSFITPVLERFNQLLFR
                     MDSGFATPKLYDLIEKTGQCYLIKLKKNTVLSRLGDLSLPCPQDEDLTILPHSAYSET
                     LYQAGSWSHKRRVCQFSERKEGNLFYDVISLVTNMTSGTSQDQFQLYRGRGQAENFIK
                     EMKEGFFGDKTDSSTLIKNEVRMMMSCIAYNLYLFLKHLAGGDFQTLTIKRFRHLFLH
                     VVGKCVRTGRKQLLKLSSLYAYSELFSALYSRIRKVNLNLPVPYEPPRRKASLMMH"
     gene            492330..493109
                     /locus_tag="SPG_0505"
     CDS             492330..493109
                     /locus_tag="SPG_0505"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF55615.1"
                     /translation="MAEQDLAMQVLQQVVKLPVVKVDRSKFLVDKFSKELGPQDIPTL
                     LEQGPTSLLSQEILDRVANACIRDNVLLASGTSVLAGLPGGLAMAITIPADVAQFYTF
                     SLKLAQELGYIYGYEDLWASREELSEDAQNTLLLYLGVMLGVNGTAALLRAGGITIAK
                     QVMKTVPNKALTKTLWYPILKKVLKIFGVNLTKGGLAKGIGKFIPILGGIISGGLTFA
                     TMKPMGESLQKELSKLVNYSEVQYQEDVETIRKEAEIIEGE"
     gene            493180..493293
                     /locus_tag="SPG_0506"
     CDS             493180..493293
                     /locus_tag="SPG_0506"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF55137.1"
                     /translation="MKTIKKDDNAVVGLGKLFIADKLMDTARWLIKPEDKK"
     gene            493290..493442
                     /locus_tag="SPG_0507"
     CDS             493290..493442
                     /locus_tag="SPG_0507"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF56798.1"
                     /translation="MKFFWGLLAIIFIKPIIGIVKFFWMIISFAVQLLFYKIVFKILD
                     WLFKLI"
     gene            493755..493988
                     /locus_tag="SPG_0508"
     CDS             493755..493988
                     /locus_tag="SPG_0508"
                     /note="identified by match to protein family HMM PF08984"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF55352.1"
                     /translation="MDNIIDVSIPVAEVVDKHPEVLEILVELGFKPLANPIMRNTVGR
                     KVSLKQGSKLAGTPMDKIVRTLEANGYEVIGLD"
     gene            493988..495322
                     /locus_tag="SPG_0509"
     CDS             493988..495322
                     /locus_tag="SPG_0509"
                     /note="identified by match to protein family HMM PF01814;
                     match to protein family HMM PF04282"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF54883.1"
                     /translation="MTDERIHILRDILLELHNGASPESVQERFDATFAGVSAIEISLM
                     EHELMNSDSGVTFEDVMELCDVHANLFKNAIKGVEVLDTEHPGHPVRVFKEENLALRA
                     ALIRIRRLLDTYESMEDEEMLAEMRKGLVRQMGLVGQFDIHYQRKEELFFPIMERYGH
                     DSPPKVMWGVDDQIRELFQTALTTAKSLPEVSISSVKEAFEAFATEFESMIFKEESIL
                     LMILLESFTQDDWLQIADESDAYGYAIIRPSEKWVPERQSFIEEKIAEEPVQLDTAEG
                     QVQQVIDTPEGHFTITFTPKEKEAVLDRHSQQAFGNGYLSVEQANLILNHLPMEITFV
                     NKEDIFQYYNDNTPADEMIFKRTPSQVGRNVELCHPPKYLDKVKTIMKGLREGTKDKY
                     EMWFKSESRGKFVHITYAAVHDEDGEFQGVLEYVQDIQPYREIDTDYFRGLE"
     gene            495332..495586
                     /locus_tag="SPG_0510"
     CDS             495332..495586
                     /locus_tag="SPG_0510"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF55712.1"
                     /translation="MSYEQEFMKEFEAWVNTQIMINDMAHKESQKVYEEDQDERAKDA
                     MIRYESRLDAYQFLLGKFENFKAGKGFHDLPEGLFGERNY"
     gene            495682..495855
                     /locus_tag="SPG_0511"
     CDS             495682..495855
                     /locus_tag="SPG_0511"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF56427.1"
                     /translation="MSKKLNRKKQLRNGLRRAGAFSSTVTKVVDETKKVVKXADSQQA
                     QLVRLFLKKLNKQ"
     gene            495915..496076
                     /locus_tag="SPG_0512"
     CDS             495915..496076
                     /locus_tag="SPG_0512"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF55424.1"
                     /translation="MGGLPLDRAKTFYDEGIKSASDFKNWTEKELLALKGIGPATIKK
                     LKENGIKFK"
     gene            496620..496937
                     /locus_tag="SPG_0513"
     CDS             496620..496937
                     /locus_tag="SPG_0513"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF55877.1"
                     /translation="MERLGVHYEISERTQIPILDACPLVLDCRVDRIVEEDGICHIFA
                     KILERLVAPELLDEKGHFKNQLFAPTYFMGDGYQRVYRYLDKRVDMKGSFIKKARKKD
                     GKN"
     gene            496924..497484
                     /locus_tag="SPG_0514"
     CDS             496924..497484
                     /locus_tag="SPG_0514"
                     /note="identified by match to protein family HMM PF00583"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase, GNAT family"
                     /protein_id="ACF56656.1"
                     /translation="MARTELPDKIETERLVLRVRTVADAEDIFDYASLPEVAYPAGFP
                     PVKTLEDEIYYLEHILPERNQKENLPAGYGIVVKGTDKIVGSIYFNHRHEDDVMEIGY
                     TLHSDYWGRGYVPEAARALIDLAFKDLGLHKIELTCFGYNLQSQRVAEKLGFTLEARI
                     RDRKDAQGNCCDDLRYALLKSEWEVI"
     gene            497484..498062
                     /locus_tag="SPG_0515"
     CDS             497484..498062
                     /locus_tag="SPG_0515"
                     /note="identified by glimmer; putative"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="ACF54922.1"
                     /translation="MHLFIIGAPASGKMTIGQELSRLTDATLFYNHQAIDFALEIYQD
                     YTEEMWEFVRGITFSFLGASARNQRSVILTDVIDFSNQYQLMYLKQIQNLLDDYHQEI
                     LFVELETSLEECIRRNRTENRLKHKPLKRHIEVSEREILETAETLQLNSQYQPNELHH
                     YFKINNTNLSAEEAAKQIQNKINKIEKGHTHV"
     gene            498055..500706
                     /gene="valS"
                     /locus_tag="SPG_0516"
     CDS             498055..500706
                     /gene="valS"
                     /locus_tag="SPG_0516"
                     /note="identified by match to protein family HMM PF00133;
                     match to protein family HMM PF08264; match to protein
                     family HMM PF09334; match to protein family HMM TIGR00422"
                     /codon_start=1
                     /transl_table=11
                     /product="valyl-tRNA synthetase"
                     /protein_id="ACF56196.1"
                     /translation="MSKELSSKYNPADVEAGRYQKWLDADVFKPSGDQKAKPYSIVIP
                     PPNVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLRGEG
                     ITRYDLGRESFLTKVWEWKDEYATTIKEQWGKMGLSVDYSRERFTLDEGLSKAVRKVF
                     VDLYKKGWIYRGEFIINWDPAARTALSDIEVIHKDVEGAFYHMNYMLEDGSRALEVAT
                     TRPETMFGDVAVAINPEDPRYKDLIGKNVILPIANKLIPIVGDEHADPEFGTGVVKIT
                     PAHXPNDFLVGQRHNLPQVNVMNDDGTMNELAFEFSGMDRFEARKAVVAKLEEIGALV
                     KIEKRVHSVGHSERTGVVVEPRLSTQWFVKMDQLAKNAIANQDTEDKVEFYPPRFNDT
                     FLQWMENVHDWVISRQLWWGHQIPAWYNADGEMYVGEEAPEGDGWTQDEDVLDTWFSS
                     ALWPFSTMGWPEVDSEDFKRYFPTSTLVTGYDIIFFWVSRMIFQSLEFTGRQPFQNVL
                     IHGLIRDEQGRKMSKSLGNGIDPMDVIEKYGADALRWFLSNGSAPGQDVRFSYEKMDA
                     SWNFINKIWNISRYILMNNGGLTLDVAHDNVTKVATGEAGNVTDRWILHNLNETIAKV
                     TENFDKFEFGVAGHILYNFIWEEFANWYVELTKEVLYSDNEEEKVITRSVLLYTLDKI
                     LRLLHPIMPFVTEEIFGQISEGSIVTAAYPTVNLAFEDLAAHTGVESLKDLIRAVRNA
                     RAEVNVAPSKPITILVKTSDSDLEAFFNSNVNYIKRFTNPEHLEIASTIPAPELAMSS
                     VITGAEIFLPLADLLNVEEELARLDKELAKWQKELDMVGKKLSNERFVANAKPEVVQK
                     EKDKQADYQAKYDVTVARIDEMKKLVK"
     gene            500776..501072
                     /locus_tag="SPG_0517"
     CDS             500776..501072
                     /locus_tag="SPG_0517"
                     /note="contains potential frameshift"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF56687.1"
                     /translation="MSKHPHYELLNLIGYGLAKFDKLFIKEFQCSSKSEFYRYVVSLG
                     IAETTGVVKNRMDLFDPYFDNNRKGWWQKAEVYRFRKDLIDMMFGNEDVHSYAE"
     gene            501171..501530
                     /locus_tag="SPG_0518"
     CDS             501171..501530
                     /locus_tag="SPG_0518"
                     /note="contains potential frameshift"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF55259.1"
                     /translation="MEAENYFILHFDKEEKFQGGQLTDARLYGDGYDFQVDVQEYSYL
                     AEVKGIRKSKGRVRLTAKEFEKVKEFQSDFILSLVTNLDDIPKLVLIDNPLKHFEFKK
                     NIIKNEIIEYRSVEDLY"
     gene            501809..502612
                     /locus_tag="SPG_0519"
     CDS             501809..502612
                     /locus_tag="SPG_0519"
                     /note="identified by match to protein family HMM PF02661"
                     /codon_start=1
                     /transl_table=11
                     /product="cell filamentation protein Fic-related protein"
                     /protein_id="ACF55762.1"
                     /translation="MQPTYNIDNPNLSYEAKRDLWRIGFGLQKVDNLVPSAYMESLAE
                     KQARGELTYEQVYEDATAYHHTIDASTEEADLVSLRIVELLSRRGFSFSPATLLAIHK
                     ELFQDIFEPSIPVGQFRQTNITKNEPVLNGESVVYSDYSMIQMTLDYDFNQEKQVAYA
                     TLTQADMVKKIQHFISGIWQIHPFREGNARTVTVFLIQYLREFGFDIDNIPFQQHSKY
                     FRDALVLDNAKILQRRPEFLTAFFENLLLGGQNDLSSEKMYLDLDLDFS"
     gene            complement(502728..502946)
                     /locus_tag="SPG_0520"
     CDS             complement(502728..502946)
                     /locus_tag="SPG_0520"
                     /codon_start=1
                     /transl_table=11
                     /product="IS3-Spn1, transposase"
                     /protein_id="ACF56215.1"
                     /translation="MSRKGNSPDNGMMESFFGILKSEMFYGYEKSFQSLKQLEQAIVD
                     YIDYYNNKRIKVKLKGLSPVQYRTKSFG"
     gene            complement(503224..503553)
                     /locus_tag="SPG_0521"
     CDS             complement(503224..503553)
                     /locus_tag="SPG_0521"
                     /codon_start=1
                     /transl_table=11
                     /product="IS3-Spn1, transposase"
                     /protein_id="ACF55209.1"
                     /translation="MTEFSLDILLKAIKLARSTYYYHLKQLDKPDKDQELKAEIQSIF
                     IEHKGNYAYRRIYLELRNRGYLVNHKRVQGLMKVLNLQAKMRQTRKYSSHKGDVGKKA
                     EISFKAI"
     gene            complement(503553..503720)
                     /locus_tag="SPG_0522"
     CDS             complement(503553..503720)
                     /locus_tag="SPG_0522"
                     /codon_start=1
                     /transl_table=11
                     /product="Degenerate transposase (orf1)"
                     /protein_id="ACF55810.1"
                     /translation="MGRKPKKRPEERTELEHLQAENEYLRAENAILKKLRELRLKEEK
                     EKEERQKLFKN"
     gene            complement(503857..504069)
                     /locus_tag="SPG_0523"
     CDS             complement(503857..504069)
                     /locus_tag="SPG_0523"
                     /codon_start=1
                     /transl_table=11
                     /product="IS3-Spn1, transposase"
                     /protein_id="ACF56131.1"
                     /translation="MKLTYDDKVQIYELRKQGYSLEKLSNKFGINNSNLRYMIKLIDR
                     YGIXFVKKGKNRYYSPDLKQEMIHKV"
     gene            504611..505450
                     /gene="licT"
                     /locus_tag="SPG_0524"
     CDS             504611..505450
                     /gene="licT"
                     /locus_tag="SPG_0524"
                     /note="identified by match to protein family HMM PF00874;
                     match to protein family HMM PF03123"
                     /codon_start=1
                     /transl_table=11
                     /product="transcription antiterminator LicT"
                     /protein_id="ACF56756.1"
                     /translation="MIIKRILNHNAVIAQSKKDIDILLFGRGIAFGRKTGDKVNPIDI
                     EKSFFLKNRDNMTRFTEMFINVPLELVYITEKIINLGKITLGNNFDEIIYINLTDHIS
                     SSIERYKEGVIISNPLRWEISKYYKEEFELGKRALQIIKKELGIELPIDEAAFIALHF
                     VNANLENNFQESYKITEIIMGIEKIIQDFYCTEFNQDSIDYYRFITHIKLFAHRLVEN
                     TTYCDDDDEDLLALMKNKYPREYECGEQVAMFIQTEYNYLLTSSELVYLMAHIRRLTK
                     NLD"
     gene            505468..507306
                     /locus_tag="SPG_0525"
     CDS             505468..507306
                     /locus_tag="SPG_0525"
                     /EC_number="2.7.1.69"
                     /EC_number="2.7.1.-"
                     /note="identified by match to protein family HMM PF00358;
                     match to protein family HMM PF00367; match to protein
                     family HMM PF02378; match to protein family HMM TIGR00830;
                     match to protein family HMM TIGR01995"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system, IIBCA components"
                     /protein_id="ACF55475.1"
                     /translation="MSYKDTVQKILDVIGGEKNVNRVTHCVTRLRLELKDENLVNDDD
                     VKKIPGVIGIMKKNGQYQIILGNDVANYYKEFVKLGNFESDSVNQGYKGNILERIIEY
                     IAGSMTPIIPAMLGGGMLKVLVIILPMLGILQSDSQTIAFLTFFGDAPYYFLPLLLAY
                     SASQKLKVTSTLAMSVAGVLLHPNFVQMVQSGNPLSLFGAPVTPASYGSSVVPILIMV
                     WLMKYIEKIIAKLTPAITKSFLQPTLVLLVSSCIALVVVGPIGVIVGEGLSNLVGQMY
                     GVAGWLTLAILGAIMPFIVMTGMHWAFAPIFLAASIATPDVLILPAMLGSNLAQGAAS
                     MAVALKSKNNNTKQIAFAAGFSALLAGITEPALYGVTLKYKKPLYAAMIGGGLAGLFA
                     GLTSVKAYLFAVPSLIALPQFIYSDVPSNIVNALIVAVISVVITFVLAYIFGIDEEES
                     SSNLEVEAGVSNKKMIFSPISGEIIPLSDVQDKTFSDKLIGDGVAIIPSEGKVYAPFD
                     GKITNIFPTKHAIGLKSDEGVELLIHIGLDTVELKGQGFISHVEEGDRVFKNQLIFEM
                     DLNLIKTKGYETVTPVIVTNTNDFLDVLVLPNNQTIEHSKELLAIL"
     gene            507319..508734
                     /locus_tag="SPG_0526"
     CDS             507319..508734
                     /locus_tag="SPG_0526"
                     /EC_number="3.2.1.21"
                     /note="identified by match to protein family HMM PF00232"
                     /codon_start=1
                     /transl_table=11
                     /product="beta-glucosidase"
                     /protein_id="ACF56062.1"
                     /translation="MTIFPDDFLWGGAVAANQVEGAYNEDGKGLSVQDVLPKGGLGEA
                     TENPTEDNLKLLGIDFYHKYKEDISLFSEMGFNVFRTSIAWSRIFPKGDEXEPNEAGL
                     KYYDELFDELHAHGIEPLVTLSHYETPLYLARKYHGWIDRRMIHFYEKFARTVLERYK
                     DKVKYWLTFNEVNSVLELPFTSGGIDIPKENLSKQELYQAIHHELVASSLVTKIAREI
                     NSEFKVGCMVLAMPAYPMTPNPKDVWATHEYENLNXLFSDVHVRGYYPNYAKRYFKEH
                     DINIEFAAEDAELLKNYTVDFLSFSYYMSVTQSALPTQYNSGEGNIIGGLVNPYLESS
                     EWGWQIDPIGLRIILNRYYDRYQIPLFIVENGLGAKDQLIKDEFNNLTVQDDYRIQYM
                     KEHLLQVAEALQDGVEIMGYTSWGCIDCVSMSTAQLSKRYGLIYVDRNDDGNGTFNRY
                     KKMSFTWYKGVIESNGESLFK"
     gene            509284..510372
                     /gene="pheS"
                     /locus_tag="SPG_0527"
     CDS             509284..510372
                     /gene="pheS"
                     /locus_tag="SPG_0527"
                     /EC_number="6.1.1.20"
                     /note="identified by match to protein family HMM PF01409;
                     match to protein family HMM PF02912; match to protein
                     family HMM TIGR00468"
                     /codon_start=1
                     /transl_table=11
                     /product="phenylalanyl-tRNA synthetase alpha chain"
                     /protein_id="ACF56478.1"
                     /translation="MWFSFYLRETDGGNMSTIEEQLKALREETLASLKQITAGNEKEM
                     QDLRVSVLGKKGSLTEILKGMKDVSAEMRPIIGKHVNEARDVLTAAFEETAKLLEEKK
                     VASQLASESIDVTLPGRPVATGHRHVLTQTSEEIEDIFIGMGYQVVDGFEVEQDYYNF
                     ERMNLPKDHPARDMQDTFYITEEILLRTHTSPVQARAMDAHDFSKGPLKMISPGRVFR
                     RDTDDATHSHQFHQIEGLVVGKNISMADLQGTLQLIVQKMFGEERQIRLRPSYFPFTE
                     PSVEVDVSCFKCGGEGCNVCKKTGWIEIMGAGMVHPRVLEMSGIDATVYSGFAFGLGQ
                     ERVAMLRYGINDIRGFYQGDVRFSEQFK"
     gene            510372..510869
                     /locus_tag="SPG_0528"
     CDS             510372..510869
                     /locus_tag="SPG_0528"
                     /note="identified by match to protein family HMM PF00583"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase, GNAT family"
                     /protein_id="ACF54839.1"
                     /translation="MIRKVEMADVEVLAKIAKQTFAYDNTEEQLQEYFEEAYSLKTLS
                     TELGNPDSETYFIMHEEEIAGFLKVNWGSAQTERELEDAFEIQRLYVLQKFQGFGLGK
                     QLFEFALELATKNSFSWAWLGVWEHNTKAQAFYNRYGFEKFSQHHFMVGQKVDTDWLL
                     RKKLR"
     gene            510946..513351
                     /gene="pheT"
                     /locus_tag="SPG_0529"
     CDS             510946..513351
                     /gene="pheT"
                     /locus_tag="SPG_0529"
                     /EC_number="6.1.1.20"
                     /note="identified by match to protein family HMM PF01588;
                     match to protein family HMM PF03147; match to protein
                     family HMM PF03483; match to protein family HMM PF03484;
                     match to protein family HMM TIGR00472"
                     /codon_start=1
                     /transl_table=11
                     /product="phenylalanyl-tRNA synthetase beta chain"
                     /protein_id="ACF55813.1"
                     /translation="MLVSYKWLKELVDIDVPSQELAEKMSTTGIEVEGVESPAAGLSK
                     IVVGEVLSCEDVPETHLHVCQINVGEEEERQIVCGAPNVRAGIKVMVALPGARIADNY
                     KIKKGKIRGLESLGMICSLGELGISDSVVPKEFADGIQILPEDAVPGEEVFSYLDLDD
                     EIIELSITPNRADALSMCGVAHEVAAIYDKAVNFKEFTLTETDQVAADALSVGIETDK
                     APYYAARILDNVTIAPSPQWLQNLLMNEGIRPINNVVDVTNYILLYFGQPMHAFDLDT
                     FEGTDIRVREARAGEKLVTLDGEERDLDVNDLVITVADKPVALAGVMGGQATEISEKS
                     SRVVLEAAVFNGKSIRKTSGRLNLRSESSSRFEKGINVATVNEALDAAASLIAELAGA
                     TVRKGIVSAGELDTSDVEVSSTLADVNRVLGTELSYADVEDVFRRLGFGLSGNADSFT
                     VRVPRRRWDITIEADLFEEIARIYGYDRLPTSLPKDDGTAGELTVTQKLRRQVRTIAE
                     GAGLTEIITYALTTPEKAVEFTAQPSNLTELMWPMTVDRSVLRQNMISGILDTVAYNV
                     ARKNKNLALYEIGKVFEQTGNPKEELPNEINSFAFALTGLVAEKDFQTAAVPVDFFYA
                     KGILEALFTRLGLQVTYTATSEIASLHPGRTAVISLGDQVLGFLGQVHPVTAKAYDIP
                     ETYVAELNLSAIEAALQPATPFVEITKFPAVSRDVALLLKAEVTHQEVVDAIQAAGVK
                     RLTDIKLFDVFSGEKLGLGMKSMAYSLTFQNPEDSLTDEEVARYMEKIQASLEEKVNA
                     EVR"
     gene            complement(513419..514426)
                     /locus_tag="SPG_0530"
     CDS             complement(513419..514426)
                     /locus_tag="SPG_0530"
                     /note="identified by match to protein family HMM PF03372"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF55864.1"
                     /translation="MIKTFLSALSVILFVIPIIAYSFFPSSNLNIWLSTRPILAQIYA
                     FPLATATMASILSFVFFSLSFYKKNKQIRFYSGILLLLSLILLLFGTDKTLSSAPNKT
                     KTLKLVTWNVANQIEAQHIERIFSHFDADMAIFPELATNIRGEQENQRIKLLFHQVGL
                     SMANYDIFTSPPTNSGIAPVTVIVIVKKSYGFYTEAKTFHTTRFGTIVLHSRKQNIPD
                     IIALHTAPPLPGLMEIWKQDLNIIHNQLASKYPKAIIAGDFNATMRHGALAKISSHRD
                     ALNALPPFERGTWNSQSPKLFNATIDHILLPKNHYYVRDLDIVSFQNSDHRCIFTEIT
                     F"
     gene            514582..514806
                     /locus_tag="SPG_0531"
     CDS             514582..514806
                     /locus_tag="SPG_0531"
                     /codon_start=1
                     /transl_table=11
                     /product="IS1239, transposase"
                     /protein_id="ACF56533.1"
                     /translation="MQDNYTTKGKHLTIDSRRLIERWKKEGKSNREIASLLGKAPQTI
                     HTEIKRGTVRQCLGKGRFKEIYSADYAQQS"
     gene            514869..514988
                     /locus_tag="SPG_0532"
     CDS             514869..514988
                     /locus_tag="SPG_0532"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase, putative"
                     /protein_id="ACF55851.1"
                     /translation="MAKGVNVGISTIYYWIHRGKLGLSKQDLLYPRKGKSLKK"
     gene            515110..515376
                     /locus_tag="SPG_0533"
     CDS             515110..515376
                     /locus_tag="SPG_0533"
                     /note="contains potential frameshift; identified by match
                     to protein family HMM PF01381"
                     /codon_start=1
                     /transl_table=11
                     /product="conserved hypothetical protein"
                     /protein_id="ACF56314.1"
                     /translation="MEGCPSELFSKEEILESDMRVAIMSELIEARYEQGISQKKLEEV
                     SGISQPVIARMETGKTSPQLDTVLKVLASLGKTLAIVPLEQGKS"
     gene            515637..517886
                     /locus_tag="SPG_0534"
     CDS             515637..517886
                     /locus_tag="SPG_0534"
                     /EC_number="2.1.1.14"
                     /note="identified by match to protein family HMM PF01717;
                     match to protein family HMM PF08267; match to protein
                     family HMM TIGR01371"
                     /codon_start=1
                     /transl_table=11
                     /product="5-methyltetrahydropteroyltriglutamate--
                     homocysteine methyltransferase"
                     /protein_id="ACF55710.1"
                     /translation="MSTTIIGFPRLGEFRELKFTTEKYFRKEISEEELLAAAKDLRAK
                     HWNIVKEKGITEIPSNDFSHYDNFLDAAFLFNVVPASVQNLDLSDLERYFALGRGYQG
                     EKGDVRALPMKKWFNTNYHYIVPKFEKDTQVKLAGHKIFDEFQEAKELGLNTRPVLVG
                     PFTFLQLSDFEEGVKADDFVDSLVAAYQEVFAKLAELGATRIQLDEAALVKDLTAEEK
                     ALFLNLYNKLLADKKGLEVLLQTYFGDVRDVYADLVNLPVDAIGLDFVEGKKTLELVK
                     GGFPADKTLYVGIVNGKNIWRNNYEKSLAVLEQIPAENIVLTSSCSLLHVPFTTANEE
                     FEPALLNHFAFAVEKLDEIRDLDAIRNGQGSEALAANKELFATERVGENAELRARIAG
                     LTDVDYTRLPAFAEREAIQEEAFKLPALPTTTIGSFPQTKEVRAKRLAYRKGELSQKE
                     YDAFLAETIDEWIKWQEDIDFDVLVHGEFERNDMVEYFGQNLSGYLFSKNGWVQSYGM
                     RGVKPPIIWGDVTRLNPITVKWSSYAQSRTNKPVKGMLTGPVTILNWSFPREDISIKD
                     STLQIALAIKDEVLDLEAAGVKIIQIDEAALREKLPLRRSDWYEDYLDWAIPAFRLVH
                     STVASDTQIHTHMCYSEFTDIIPAIDNMDADVISFEASRSNLEILDELKAKNFQTEVG
                     PGVYDIHSPRVPNEGEIDNTIEAILAKVPSKKVWINPDCGLKTRGIPETKESLIRLVE
                     AAKAAREKL"
     gene            517950..518816
                     /gene="metF"
                     /locus_tag="SPG_0535"
     CDS             517950..518816
                     /gene="metF"
                     /locus_tag="SPG_0535"
                     /EC_number="1.5.1.20"
                     /note="identified by match to protein family HMM PF02219;
                     match to protein family HMM TIGR00676"
                     /codon_start=1
                     /transl_table=11
                     /product="5,10-methylenetetrahydrofolate reductase"
                     /protein_id="ACF55056.1"
                     /translation="MSRQTPSLSFEVFPPNPAVGNGNIISALQDMQELAPHFISVTAS
                     NNKFNIKETTVRLADFIQNDLAIPTIAHLPAIYLTKDKVAETIADLDKVGVQKILALR
                     GDIIPDVEPQKDFRYATDLIEFIKEQTPHFDIIGACYPEGHPDSPNQISDIQNLKKKV
                     DAGCSSLVTQLFFDNERFYDFQDKCILAGIDVPIHAGIMPILNRNQALRLLKTCENIH
                     LPRKFKAILDKYEHDPESLRAAGLAYAVDQIVDLVTQDVAGVHLYTMNNADTAKYIHQ
                     ATHALFNHQSLG"
     gene            519501..521714
                     /locus_tag="SPG_0536"
     CDS             519501..521714
                     /locus_tag="SPG_0536"
                     /EC_number="2.7.7.8"
                     /note="identified by match to protein family HMM PF00013;
                     match to protein family HMM PF00575; match to protein
                     family HMM PF01138; match to protein family HMM PF03725;
                     match to protein family HMM PF03726"
                     /codon_start=1
                     /transl_table=11
                     /product="polyribonucleotide nucleotidyltransferase"
                     /protein_id="ACF56579.1"
                     /translation="MAKQVFQTTFAGRELIVETGQVAKQANGSVVVRYGESTVLTAAV
                     MSKKMATGDFFPLQVNYEEKMYAAGKFPGGFMKREGRPSTDATLTARLIDRPIRPMFA
                     EGFRNEVQVINTVLSYDENASAPMAAMFGSSLALSISDIPFDGPIAGVQVGYVDGQII
                     INPSQEQAEQSLLELTVAGTKHAINMVESGAKELSEEIMLEALLKGHEAVKELIAFQE
                     EIVAAVGKEKAEVELLHVDAELQAEIIAAYNSDLQKAVQVEEKLAREAATQVVKDQVT
                     AVYEEKYADHEEFDRIMRDVAEILEQMEHAEVRRLITEDKVRPDGRKVDEIRPLDAVV
                     DFLPRVHGSGLFTRGQTQALSVLTLAPMGETQIIDGLDPEYKKRFMHHYNFPQYSVGE
                     TGRYGAPGRREIGHGALGERALAQVLPSLEEFPYAIRLVAEVLESNGSSSQASICAGT
                     LALMAGGVPIKAPVAGIAMGLISDGNNYTVLTDIQGLEDHFGDMDFKVAGTRDGITAL
                     QMDIKIQGITAEILTEALAQAKKARFEILDVIEATIPEVRLELAPTAPKIDTIKIDVD
                     KIKIVIGKGGETIDKIIAETGVKIDIDEEGNVSIYSSDQDAINRAKEIIAGLVREAKV
                     DEVYRAKVVRIEKFGAFVNLFDKTDALVHISEMAWTRTNRVEDLVEIGDEVDVKVIKI
                     DEKGRIDASMKALLPRPPKPEHDEKGEKSERPHRPRHHKDHKPKKEFTETPKDSE"
     gene            521730..522347
                     /gene="cysE"
                     /locus_tag="SPG_0537"
     CDS             521730..522347
                     /gene="cysE"
                     /locus_tag="SPG_0537"
                     /EC_numb