LOCUS       AF083106                4086 bp    mRNA    linear   HUM 14-APR-2000
DEFINITION  Homo sapiens sirtuin type 1 (SIRT1) mRNA, complete cds.
ACCESSION   AF083106
VERSION     AF083106.2
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 4086)
  AUTHORS   Frye,R.A.
  TITLE     Characterization of five human cDNAs with homology to the yeast
            SIR2 gene: Sir2-like proteins (sirtuins) metabolize NAD and may
            have protein ADP-ribosyltransferase activity
  JOURNAL   Biochem. Biophys. Res. Commun. 260 (1), 273-279 (1999)
   PUBMED   10381378
REFERENCE   2  (bases 1 to 4086)
  AUTHORS   Frye,R.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-AUG-1998) Pathology, VA Med. Cent. (132L), Univ. of
            Pittsburgh, University Drive C, Pittsburgh, PA 15240, USA
REFERENCE   3  (bases 1 to 4086)
  AUTHORS   Frye,R.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (14-APR-2000) Pathology, VA Med. Cent. (132L), Univ. of
            Pittsburgh, University Drive C, Pittsburgh, PA 15240, USA
  REMARK    Sequence update by submitter
COMMENT     On Apr 14, 2000 this sequence version replaced gi:5225317.
FEATURES             Location/Qualifiers
     source          1..4086
                     /db_xref="H-InvDB:HIT000066539"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /tissue_type="testis"
     gene            1..4086
                     /gene="SIRT1"
     CDS             54..2297
                     /gene="SIRT1"
                     /note="yeast silent information regulator 2 (Sir2p)
                     homolog"
                     /codon_start=1
                     /product="sirtuin type 1"
                     /protein_id="AAD40849.2"
                     /db_xref="GI:7555471"
                     /translation="MADEAALALQPGGSPSAAGADREAASSPAGEPLRKRPRRDGPGL
                     ERSPGEPGGAAPEREVPAAARGCPGAAAAALWREAEAEAAAAGGEQEAQATAAAGEGD
                     NGPGLQGPSREPPLADNLYDEDDDDEGEEEEEAAAAAIGYRDNLLFGDEIITNGFHSC
                     ESDEEDRASHASSSDWTPRPRIGPYTFVQQHLMIGTDPRTILKDLLPETIPPPELDDM
                     TLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSR
                     DGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSD
                     KEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGDIFNQVV
                     PRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVAL
                     IPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYAKLCCNPVKLS
                     EITEKPPRTQKELAYLSELPPTPLHVSEDSSSPERTSPPDSSVIVTLLDQAAKSNDDL
                     DVSESKGCMEEKPQEVQTSRNVESIAEQMENPDLKNVGSSTGEKNERTSVAGTVRKCW
                     PNRVAKEQISRRLDGNQYLFLPPNRYIFHGAEVYSDSEDDVLSSSSCGSNSDSGTCQS
                     PSLEEPMEDESEIEEFYNGLEDEPDVPERAGGAGFGTDGDDQEAINEAISVKQEVTDM
                     NYPSNKS"
     misc_feature    750..767
                     /gene="SIRT1"
                     /note="encodes putative nuclear localization signal"
BASE COUNT         1225 a          732 c          925 g         1204 t
ORIGIN      
        1 gtcgagcggg agcagaggag gcgagggagg agggccagag aggcagttgg aagatggcgg
       61 acgaggcggc cctcgccctt cagcccggcg gctccccctc ggcggcgggg gccgacaggg
      121 aggccgcgtc gtcccccgcc ggggagccgc tccgcaagag gccgcggaga gatggtcccg
      181 gcctcgagcg gagcccgggc gagcccggtg gggcggcccc agagcgtgag gtgccggcgg
      241 cggccagggg ctgcccgggt gcggcggcgg cggcgctgtg gcgggaggcg gaggcagagg
      301 cggcggcggc aggcggggag caagaggccc aggcgactgc ggcggctggg gaaggagaca
      361 atgggccggg cctgcagggc ccatctcggg agccaccgct ggccgacaac ttgtacgacg
      421 aagacgacga cgacgagggc gaggaggagg aagaggcggc ggcggcggcg attgggtacc
      481 gagataacct tctgttcggt gatgaaatta tcactaatgg ttttcattcc tgtgaaagtg
      541 atgaggagga tagagcctca catgcaagct ctagtgactg gactccaagg ccacggatag
      601 gtccatatac ttttgttcag caacatctta tgattggcac agatcctcga acaattctta
      661 aagatttatt gccggaaaca atacctccac ctgagttgga tgatatgaca ctgtggcaga
      721 ttgttattaa tatcctttca gaaccaccaa aaaggaaaaa aagaaaagat attaatacaa
      781 ttgaagatgc tgtgaaatta ctgcaagagt gcaaaaaaat tatagttcta actggagctg
      841 gggtgtctgt ttcatgtgga atacctgact tcaggtcaag ggatggtatt tatgctcgcc
      901 ttgctgtaga cttcccagat cttccagatc ctcaagcgat gtttgatatt gaatatttca
      961 gaaaagatcc aagaccattc ttcaagtttg caaaggaaat atatcctgga caattccagc
     1021 catctctctg tcacaaattc atagccttgt cagataagga aggaaaacta cttcgcaact
     1081 atacccagaa catagacacg ctggaacagg ttgcgggaat ccaaaggata attcagtgtc
     1141 atggttcctt tgcaacagca tcttgcctga tttgtaaata caaagttgac tgtgaagctg
     1201 tacgaggaga tatttttaat caggtagttc ctcgatgtcc taggtgccca gctgatgaac
     1261 cgcttgctat catgaaacca gagattgtgt tttttggtga aaatttacca gaacagtttc
     1321 atagagccat gaagtatgac aaagatgaag ttgacctcct cattgttatt gggtcttccc
     1381 tcaaagtaag accagtagca ctaattccaa gttccatacc ccatgaagtg cctcagatat
     1441 taattaatag agaacctttg cctcatctgc attttgatgt agagcttctt ggagactgtg
     1501 atgtcataat taatgaattg tgtcataggt taggtggtga atatgccaaa ctttgctgta
     1561 accctgtaaa gctttcagaa attactgaaa aacctccacg aacacaaaaa gaattggctt
     1621 atttgtcaga gttgccaccc acacctcttc atgtttcaga agactcaagt tcaccagaaa
     1681 gaacttcacc accagattct tcagtgattg tcacactttt agaccaagca gctaagagta
     1741 atgatgattt agatgtgtct gaatcaaaag gttgtatgga agaaaaacca caggaagtac
     1801 aaacttctag gaatgttgaa agtattgctg aacagatgga aaatccggat ttgaagaatg
     1861 ttggttctag tactggggag aaaaatgaaa gaacttcagt ggctggaaca gtgagaaaat
     1921 gctggcctaa tagagtggca aaggagcaga ttagtaggcg gcttgatggt aatcagtatc
     1981 tgtttttgcc accaaatcgt tacattttcc atggcgctga ggtatattca gactctgaag
     2041 atgacgtctt atcctctagt tcttgtggca gtaacagtga tagtgggaca tgccagagtc
     2101 caagtttaga agaacccatg gaggatgaaa gtgaaattga agaattctac aatggcttag
     2161 aagatgagcc tgatgttcca gagagagctg gaggagctgg atttgggact gatggagatg
     2221 atcaagaggc aattaatgaa gctatatctg tgaaacagga agtaacagac atgaactatc
     2281 catcaaacaa atcatagtgt aataattgtg caggtacagg aattgttcca ccagcattag
     2341 gaactttagc atgtcaaaat gaatgtttac ttgtgaactc gatagagcaa ggaaaccaga
     2401 aaggtgtaat atttataggt tggtaaaata gattgttttt catggataat ttttaacttc
     2461 attatttctg tacttgtaca aactcaacac taactttttt ttttttaaaa aaaaaaaggt
     2521 actaagtatc ttcaatcagc tgttgggtca agactaactt tcttttaaag gttcatttgt
     2581 atgataaatt catatgtgta tatataattt tttttgtttt gtctagtgag tttcaacatt
     2641 tttaaagttt tcaaaaagcc atcggaatgt taaattaatg taaagggaca gctaatctag
     2701 accaaagaat ggtattttca cttttctttg taacattgaa tggtttgaag tactcaaaat
     2761 ctgttacgct aaacttttga ttctttaaca caattatttt taaacactgg cattttccaa
     2821 aactgtggca gctaactttt taaaatctca aatgacatgc agtgtgagta gaaggaagtc
     2881 aacaatatgt ggggagagca ctcggttgtc tttactttta aaagtaatac ttggtgctaa
     2941 gaatttcagg attattgtat ttacgttcaa atgaagatgg cttttgtact tcctgtggac
     3001 atgtagtaat gtctatattg gctcataaaa ctaacctgaa aaacaaataa atgctttgga
     3061 aatgtttcag ttgctttaga aacattagtg cctgcctgga tccccttagt tttgaaatat
     3121 ttgccattgt tgtttaaata cctatcactg tggtagagct tgcattgatc ttttccacaa
     3181 gtattaaact gccaaaatgt gaatatgcaa agcctttctg aatctataat aatggtactt
     3241 ctactgggga gagtgtaata ttttggactg ctgttttcca ttaatgagga gagcaacagg
     3301 cccctgatta tacagttcca aagtaataag atgttaattg taattcagcc agaaagtaca
     3361 tgtctcccat tgggaggatt tggtgttaaa taccaaactg ctagccctag tattatggag
     3421 atgaacatga tgatgtaact tgtaatagca gaatagttaa tgaatgaaac tagttcttat
     3481 aatttatctt tatttaaaag cttagcctgc cttaaaacta gagatcaact ttctcagctg
     3541 caaaagcttc tagtctttca agaagttcat actttatgaa attgcacagt aagcatttat
     3601 ttttcagacc atttttgaac atcactccta aattaataaa gtattcctct gttgctttag
     3661 tatttattac aataaaaagg gtttgaaata tagctgttct ttatgcataa aacacccagc
     3721 taggaccatt actgccagag aaaaaaatcg tattgaatgg ccatttccct acttataaga
     3781 tgtctcaatc tgaatttatt tggctacact aaagaatgca gtatatttag ttttccattt
     3841 gcatgatgtt tgtgtgctat agatgatatt ttaaattgaa aagtttgttt taaattattt
     3901 ttacagtgaa gactgttttc agctcttttt atattgtaca tagtctttta tgtaatttac
     3961 tggcatatgt tttgtagact gtttaatgac tggatatctt ccttcaactt ttgaaataca
     4021 aaaccagtgt tttttacttg tacactgttt taaagtctat taaaattgtc atttgacttt
     4081 tttctg
//