LOCUS BC016788 1230 bp mRNA linear HUM 30-SEP-2003 DEFINITION Homo sapiens low density lipoprotein receptor-related protein 11, mRNA (cDNA clone IMAGE:4072521), partial cds. ACCESSION BC016788 VERSION BC016788.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1230) AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G., Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D., Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K., Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F., Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L., Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L., Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S., Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J., Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J., McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S., Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W., Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A., Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S., Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y., Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D., Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M., Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E., Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A. TITLE Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002) PUBMED 12477932 REFERENCE 2 (bases 1 to 1230) AUTHORS Strausberg,R. TITLE Direct Submission JOURNAL Submitted (05-NOV-2001) National Institutes of Health, Mammalian Gene Collection (MGC), Cancer Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590, USA REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov COMMENT Contact: MGC help desk Email: cgapbs-r@mail.nih.gov Tissue Procurement: ATCC cDNA Library Preparation: CLONTECH Laboratories, Inc. cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL) DNA Sequencing by: Institute for Systems Biology http://www.systemsbiology.org contact: amadan@systemsbiology.org Anup Madan, Jessica Fahey, Erin Helton, Mark Ketteman, Anuradha Madan, Stephanie Rodrigues, Amy Sanchez and Michelle Whiting Clone distribution: MGC clone distribution information can be found through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov Series: IRAL Plate: 32 Row: n Column: 2. FEATURES Location/Qualifiers source 1..1230 /db_xref="H-InvDB:HIT000050655" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="IMAGE:4072521" /tissue_type="Testis, embryonal carcinoma" /clone_lib="NIH_MGC_61" /lab_host="DH10B" /note="Vector: pDNR-LIB" gene <1..1230 /gene="LRP11" /gene_synonym="bA350J20.3" /gene_synonym="FLJ14735" /db_xref="GeneID:84918" CDS <1..440 /gene="LRP11" /gene_synonym="bA350J20.3" /gene_synonym="FLJ14735" /codon_start=3 /product="LRP11 protein" /protein_id="AAH16788.1" /db_xref="GeneID:84918" /translation="GLADVAAARRAVEEVAAEHGCRGRGAPGQLHHGHGAARLGAAGR HALPPAPHGRRRPQEAGTRRQGVLGADDGVRHCAVAAAAPARAVLLGAAARAQLQLQL LLRPLLLQLPAELLHARQLRVQFGQRRRGRQGRTAAWQPQAEQ" BASE COUNT 211 a 421 c 414 g 184 t ORIGIN 1 ggggacttgc agacgttgcg gccgcgcgcc gtgcagttga agaggtagca gccgagcacg 61 gctgccgggg gcgcggggcg ccggggcagc tccaccacgg ccacggagca gcgcggctcg 121 gagcagcagg ccgccacgca ttgccgccag ccccgcacgg ccgccggcgc ccgcaggaag 181 ctggcacccg ccgccaggga gtccttggtg cggatgatgg cgtcaggcat tgcgctgtag 241 ccgccgctgc cccggcccgg gcagtcctcc tgggggccgc cgcccgcgcg cagctccagc 301 tccagctcct cctgaggccg ctcctgctgc agttgccggc ggaactgctc cacgcccgac 361 agctgcgcgt gcagttcgga cagcggcgcc gcgggcggca aggccgcacg gccgcttggc 421 agccacaggc agagcagtag cagcccgcgc agcgccccgt gacgcggcgg tagccggcgc 481 tgcgagcccg cgctctcctg ggcgacggag gccatggcga cgagagccaa gggcagcgag 541 ccgaggcggg gctgagcgcg ggaggaaggc ggggacgcgg gcgagcgcgg gccctgggcc 601 cctcctgcgc ggccgcggct ggctctaggc cccggcctca cagcgcggcg cccccgaacc 661 cggctgctcc cccgaggtcg cgggcgccgg cgggaaccgc agtagcggga gacatagccg 721 gcccagccgg gcaccgctcc ttgccctcgc cggagactgc ccagcgccct gcgcctctcc 781 gccccggcct gcggcgcgct gggtggcgac gagtcggcct cggcgttgat cagcaccagg 841 tgtgtgcgaa cagtggccgc ggcggggagg agccttggat gaaccgttgt ccacattctg 901 ttttctgagt caaagaggag gaagatctgt ccatcgaaac tgagctgcca agatccactg 961 ccgtgtcctt cggctttctg ctcacaagac atcctggcct gcagggtgag gggttctgcc 1021 cccatcaaag agagatcagc tctggccttg acagatattg agcccccatc ctcttccact 1081 tgcaatttcc tggtcttact tgctctgcca catcctggcc ttgcctctag acgtcttgcg 1141 gggtgagatg accttcctat ttgtattttt acatgaaaac tataaatgcc tctaacctat 1201 aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa //