LOCUS       BC016788                1230 bp    mRNA    linear   HUM 30-SEP-2003
DEFINITION  Homo sapiens low density lipoprotein receptor-related protein 11,
            mRNA (cDNA clone IMAGE:4072521), partial cds.
ACCESSION   BC016788
VERSION     BC016788.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1230)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 1230)
  AUTHORS   Strausberg,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-NOV-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Cancer Genomics Office, National Cancer
            Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590,
            USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: CLONTECH Laboratories, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Institute for Systems Biology
            http://www.systemsbiology.org
            contact: amadan@systemsbiology.org
            Anup Madan, Jessica Fahey, Erin Helton, Mark Ketteman, Anuradha
            Madan, Stephanie Rodrigues, Amy Sanchez and Michelle Whiting
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 32 Row: n Column: 2.
FEATURES             Location/Qualifiers
     source          1..1230
                     /db_xref="H-InvDB:HIT000050655"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="IMAGE:4072521"
                     /tissue_type="Testis, embryonal carcinoma"
                     /clone_lib="NIH_MGC_61"
                     /lab_host="DH10B"
                     /note="Vector: pDNR-LIB"
     gene            <1..1230
                     /gene="LRP11"
                     /gene_synonym="bA350J20.3"
                     /gene_synonym="FLJ14735"
                     /db_xref="GeneID:84918"
     CDS             <1..440
                     /gene="LRP11"
                     /gene_synonym="bA350J20.3"
                     /gene_synonym="FLJ14735"
                     /codon_start=3
                     /product="LRP11 protein"
                     /protein_id="AAH16788.1"
                     /db_xref="GeneID:84918"
                     /translation="GLADVAAARRAVEEVAAEHGCRGRGAPGQLHHGHGAARLGAAGR
                     HALPPAPHGRRRPQEAGTRRQGVLGADDGVRHCAVAAAAPARAVLLGAAARAQLQLQL
                     LLRPLLLQLPAELLHARQLRVQFGQRRRGRQGRTAAWQPQAEQ"
BASE COUNT          211 a          421 c          414 g          184 t
ORIGIN      
        1 ggggacttgc agacgttgcg gccgcgcgcc gtgcagttga agaggtagca gccgagcacg
       61 gctgccgggg gcgcggggcg ccggggcagc tccaccacgg ccacggagca gcgcggctcg
      121 gagcagcagg ccgccacgca ttgccgccag ccccgcacgg ccgccggcgc ccgcaggaag
      181 ctggcacccg ccgccaggga gtccttggtg cggatgatgg cgtcaggcat tgcgctgtag
      241 ccgccgctgc cccggcccgg gcagtcctcc tgggggccgc cgcccgcgcg cagctccagc
      301 tccagctcct cctgaggccg ctcctgctgc agttgccggc ggaactgctc cacgcccgac
      361 agctgcgcgt gcagttcgga cagcggcgcc gcgggcggca aggccgcacg gccgcttggc
      421 agccacaggc agagcagtag cagcccgcgc agcgccccgt gacgcggcgg tagccggcgc
      481 tgcgagcccg cgctctcctg ggcgacggag gccatggcga cgagagccaa gggcagcgag
      541 ccgaggcggg gctgagcgcg ggaggaaggc ggggacgcgg gcgagcgcgg gccctgggcc
      601 cctcctgcgc ggccgcggct ggctctaggc cccggcctca cagcgcggcg cccccgaacc
      661 cggctgctcc cccgaggtcg cgggcgccgg cgggaaccgc agtagcggga gacatagccg
      721 gcccagccgg gcaccgctcc ttgccctcgc cggagactgc ccagcgccct gcgcctctcc
      781 gccccggcct gcggcgcgct gggtggcgac gagtcggcct cggcgttgat cagcaccagg
      841 tgtgtgcgaa cagtggccgc ggcggggagg agccttggat gaaccgttgt ccacattctg
      901 ttttctgagt caaagaggag gaagatctgt ccatcgaaac tgagctgcca agatccactg
      961 ccgtgtcctt cggctttctg ctcacaagac atcctggcct gcagggtgag gggttctgcc
     1021 cccatcaaag agagatcagc tctggccttg acagatattg agcccccatc ctcttccact
     1081 tgcaatttcc tggtcttact tgctctgcca catcctggcc ttgcctctag acgtcttgcg
     1141 gggtgagatg accttcctat ttgtattttt acatgaaaac tataaatgcc tctaacctat
     1201 aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa
//