LOCUS       KTU09810               15532 bp    DNA     circular INV 26-JUL-2016
DEFINITION  Katharina tunicata mitochondrion, complete genome.
ACCESSION   U09810
VERSION     U09810.1
KEYWORDS    .
SOURCE      mitochondrion Katharina tunicata (black chiton)
  ORGANISM  Katharina tunicata
            Eukaryota; Metazoa; Lophotrochozoa; Mollusca; Polyplacophora;
            Neoloricata; Chitonida; Acanthochitonina; Mopaliidae; Katharina.
REFERENCE   1  (bases 1 to 15532)
  AUTHORS   Boore,J.L. and Brown,W.M.
  TITLE     Complete DNA sequence of the mitochondrial genome of the black
            chiton, Katharina tunicata
  JOURNAL   Genetics 138 (2), 423-443 (1994)
   PUBMED   7828825
REFERENCE   2  (bases 1 to 15532)
  AUTHORS   Boore,J.L.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAY-1994) Jeffrey L. Boore, Cell Biology and
            Neuroanatomy, University of Minnesota, 321 Church St. SE,
            Minneapolis, MN 55455, USA
FEATURES             Location/Qualifiers
     source          1..15532
                     /organism="Katharina tunicata"
                     /organelle="mitochondrion"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:34587"
     CDS             1..1548
                     /note="followed by 'T' as an abbreviated stop codon"
                     /codon_start=1
                     /transl_table=5
                     /product="cytochrome oxidase subunit I"
                     /protein_id="AAC48362.1"
                     /translation="MRWIFSTNHKDIGTLYILFGIWAGLVGTALSLLIRAELGQPGAL
                     LGDDQLYNVIVTAHAFVMIFFLVMPMMIGGFGNWLVPLMLGVPDMAFPRLNNMSFWLL
                     PPALCLLLASGAVESGAGTGWTVYPPLAGNVGHAGGSVDLAIFSLHLAGVSSILGAVN
                     FITTIVNMRSEGMQLERLPLFVWSVKITAILLLLSLPVLAGGITMLLTDRNFNTSFFD
                     PAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIVMHYSSKKETFGTLGMIYAMLA
                     IGLLGFIVWAHHMFVVGMDVDTRAYFTAATMIIAVPTGIKIFSWLATIYGARIGSETP
                     MMWALGFIFLFTVGGLTGIVLSNSSLDIMLHDSYYVVAHFHYVLSMGAVFALFGAFNY
                     WYPLMTGLSLHERWTKSHFVVMFLGVNLTFFPQHFLGLSGMPRRYSDYPDCYIKWNVV
                     SSIGSLISFVAVLFFMFIVWESLVSQRGVIWSSHLSSALEWDNSIPLGFTDLMKGKLL
                     FVNLILL"
     tRNA            1619..1682
                     /product="tRNA-Asp"
                     /note="codon recognized: GAC"
                     /anticodon=(pos:1650..1652,aa:Asp,seq:gtc)
     CDS             2107..2796
                     /codon_start=1
                     /transl_table=5
                     /product="cytochrome oxidase subunit II"
                     /protein_id="AAC48365.1"
                     /translation="MAFWSQWGFQDGASPIMEQLIFFHDHAMLILIMIISLLSYGAVS
                     LMNNSFLSRSTLESQEIEIVWTILPAVVLIFLAFPSLQLLYLLDELEEPALTIKVVGH
                     QWYWSYEYSDFLNLEFDSYMISLEDLEEGDYRLLEVDHRSVVPMKTKVRVLVTAADVL
                     HSWTVPSLGVKADAVPGRLNQLSFFANYPGVFYGQCSEICGANHSFMPIVLEVVDSSS
                     FIKWIMFNGEA"
     CDS             2872..3033
                     /codon_start=1
                     /transl_except=(pos:3001..3003,aa:Trp)
                     /transl_table=5
                     /product="ATPase subunit 8"
                     /protein_id="AAC48364.1"
                     /translation="MPQLAPMNWIFLLLFFWSNVFCLGVCVWWVKSSSYSFLSKSVSW
                     PFYFKKWVW"
     CDS             3037..3729
                     /codon_start=1
                     /transl_table=5
                     /product="ATPase subunit 6"
                     /protein_id="AAC48363.1"
                     /translation="MMMDIFSSFDDNNFTLFSFSYLIWVLGLAPVLISQNMFWFSKSR
                     FYSMILFPKNFMGGQVMRATGKNISGFINMVISIFLLLILVNLSGLLPYVFSLSSHLS
                     FAFCFGLPFWLSLIFSGDLYVSEVVSHLLPSGAPGILNPFLVLVETVSISVRPITLSV
                     RLAANMSAGHIILGLIGSYLSVGLFCYPILVLGLLLFVQVFYFLFEIGVSLIQAYIFS
                     LLVSLYSDDHPY"
     tRNA            complement(3758..3822)
                     /product="tRNA-Phe"
                     /note="codon recognized: UUC"
                     /anticodon=(pos:complement(3789..3791),aa:Phe,seq:gaa)
     CDS             complement(3821..5536)
                     /note="Followed by 'T' as an abbreviated stop codon"
                     /codon_start=1
                     /transl_table=5
                     /product="NADH dehydogenase subunit 5"
                     /protein_id="AAC48366.1"
                     /translation="MKMMFLSTSQATVILLSHSLLSFSTAMYTLTTNKIILLEFCFYN
                     FNSVTITLPILINWTTALFSAIVCYISASVMIFTKNYMSQDIFIKRFTWIVMLFVLSM
                     NLLIFIPSLATLLLGWDGLGLVSFCLVIYYQNYKSLGAGLMTAFMNRIGDVAILLAIS
                     VTFSQGHFNALFMWSTPTMTLTISMILLAGMTKSAQLPFCSWLPAAMAAPTPVSALVH
                     SSTLVTAGVFLLIQFYPFLSNSHLFSTSLMIISSMTMVMAGISANFETDLKKIIALST
                     LSQLGVMMLSVSLGLFSLALFHLFTHAMFKALLFLCAGNIIHSHNNNQDIRKMSHLWI
                     QMPFSSTCFNIANLALCGFPFMAGFYSKDVIIEMMMFNQNNFLISLNMFLATILTASY
                     SARLSLFIFWSKMTQSSVVSTSDEDNSIIAPLTMLAAGAITSGAVFSWLILTPSTLPL
                     ISMMNKLMATFATLTGAAITYKLFKLELKISHSIINNFFFNMWFMINLSNNMTSKSSL
                     YTGLYTFKSLDLGWMETIGGEGLLNKIMTLTTINQKNQSNLFNLFISLTLLSMLFISV
                     TMWFT"
     tRNA            complement(5537..5601)
                     /product="tRNA-His"
                     /note="codon recognized: CAC"
                     /anticodon=(pos:complement(5568..5570),aa:His,seq:gtg)
     CDS             complement(5597..6928)
                     /note="Followed by 'T' as an abbreviated stop codon"
                     /codon_start=1
                     /transl_except=(pos:complement(6788..6790),aa:Trp)
                     /transl_table=5
                     /product="NADH dehydogenase subunit 4"
                     /protein_id="AAC48367.1"
                     /translation="MSAFSTVMTKNSKMNWYKMSWISHFMFFMITLNFFSPMNIPKIN
                     YEWFSDNFSVPLMMLSCWITGLMIMSSYKILKNNNLVSFFLLNVMILNFIIIMVFTQK
                     SLFSLYIFFEASLIPTLILILMWGYQPERLQAGMYMMIYTILGALPFLINIFFIYSHN
                     AHLNLLIMMSLPIMPYQAMISFWWLFIILVFLVKLPIYSFHLWLPKAHVEAPVAGSMI
                     LAALLLKLGGYGINTINNNIFKYNFVLNYFIITLGLVGGVLSSLICLRQSDMKALIAY
                     SSVGHMGLMLAGLLSSFEFGLKMALLMMIAHGLSSSGLFSMSNMMYEKSGSRSLFITK
                     GFISLVPTFSMSFFLMCSINMAAPPSINLLSEAGLMISTVSISKFLMILLALMAFVSA
                     VYTLFLFTNTQHGKISSFVNPFNNFKPLYYNVIFLHWIPAQLLILLSTTIC"
     CDS             complement(6940..7242)
                     /codon_start=1
                     /transl_table=5
                     /product="NADH dehydogenase subunit 4L"
                     /protein_id="AAC48368.1"
                     /translation="MMNFFNPLFTLGALSSISALMTICLQRKHLLNTLLALEILMVSI
                     FLLLVSLSNLMSNEGLMIFVLLTLAASEASIGLAMLVILIRAHGNDYVSSISIHKC"
     tRNA            7247..7312
                     /product="tRNA-Thr"
                     /note="codon recognized: ACA"
                     /anticodon=(pos:7275..7277,aa:Thr,seq:tgt)
     tRNA            complement(7312..7378)
                     /product="tRNA-Ser"
                     /note="codon recognized: UCA"
                     /anticodon=(pos:complement(7348..7350),aa:Ser,seq:tga)
     CDS             complement(7381..8520)
                     /codon_start=1
                     /transl_except=(pos:complement(8176..8178),aa:Trp)
                     /transl_table=5
                     /product="cytochrome b"
                     /protein_id="AAC48371.1"
                     /translation="MLKPIRSSHPVFKIINGSLIDLPSPSNLSIWWNFGSLLGLCLII
                     QILTGLFLAMHYATNIELAFSSVAHICRDVNYGWLIRAAHANGGSLFFICLYFHIGRG
                     MYYGSFVNIHTWWVGVILLFLTMGTAFIGYVLPWGQMSFWGATVITNLMSAIPYIGTT
                     MVQWIWGGFAVDNATLTRFFSFHYLAPFIIAAASVLHILFLHETGSNNPLGINSDSEK
                     VTIHSFYTLKDLVGFVVMVIFLLLLVFLDPNLLAHPDNFIPANPLVTPTHIQPEWYFL
                     FAYAILRSIPNKLGGVVGLLMSIVILFFVPLINLGKFRTISFYPVTQILYWSLVSVFL
                     LLTWIGAQPVEDPFILIGQILTFVYFLLFLMIPLTKKMWDWTINF"
     CDS             complement(8513..9019)
                     /note="Followed by 'T' as an abbreviated stop codon"
                     /codon_start=1
                     /transl_table=5
                     /product="NADH dehydrogenase subunit 6"
                     /protein_id="AAC48369.1"
                     /translation="MTFLLTMSLIFSCAFSLPLLTQPISLGLLLLFMSLFISILIFFG
                     SSTWFSFILFLIYIGGLLVMFAYVTALMPNLMFKKNLIQVFFPVSTVFWLLMLYLSDF
                     IGTLLEEQTKMMFLWNSFFNHLGISLFSPFNLLIIVSLALILFFVLICVVKICYFSNG
                     PLRPYKYA"
     tRNA            9024..9089
                     /product="tRNA-Pro"
                     /note="codon recognized: CCA"
                     /anticodon=(pos:9054..9056,aa:Pro,seq:tgg)
     CDS             complement(9082..10032)
                     /codon_start=1
                     /transl_table=5
                     /product="NADH dehydogenase subunit 1"
                     /protein_id="AAC48370.1"
                     /translation="MFLSFSWMVIAYISILLAVAFFTLLERKGLGYIQFRKGPNKVSI
                     FGLAQPLADALKLFLKEENNLYNSNKLPYYTAPVLSLILSLCLWSLYWSDFTLWYFNF
                     GVLFFLCTSALSVYGTMIAGWASNSKYALLGALRAVAQTISYEVTLFLVLLSSAALSS
                     SLNLNQISSHQLLYWNSILMTPLLLMWIVVCLAETNRAPFDFAEGESELVSGFNIEYG
                     SGSFALLFLAEYASILFMSMMTTILFLGAGDSWILTNFLFWVKVTFIAFVFIWVRGTF
                     PRLRYDLLMKLTWLSFLPVSLMILMWNLSAKFMVTTLLLS"
     tRNA            complement(10033..10101)
                     /product="tRNA-Leu"
                     /note="codon recognized: UUA"
                     /anticodon=(pos:complement(10068..10070),aa:Leu,seq:taa)
     tRNA            complement(10101..10165)
                     /product="tRNA-Leu"
                     /note="codon recognized: CUA"
                     /anticodon=(pos:complement(10132..10134),aa:Leu,seq:tag)
     rRNA            complement(10166..11440)
                     /product="large ribosomal RNA"
                     /note="The exact endpoints are uncertain"
     tRNA            complement(11441..11505)
                     /product="tRNA-Val"
                     /note="codon recognized: GUA"
                     /anticodon=(pos:complement(11473..11475),aa:Val,seq:tac)
     rRNA            complement(11506..12331)
                     /product="small ribosomal RNA"
                     /note="The exact endpoints are uncertain"
     tRNA            complement(12332..12396)
                     /product="tRNA-Met"
                     /note="codon recognized: AUG"
                     /anticodon=(pos:complement(12363..12365),aa:Met,seq:cat)
     tRNA            complement(12403..12464)
                     /product="tRNA-Cys"
                     /note="codon recognized: UGC"
                     /anticodon=(pos:complement(12434..12436),aa:Cys,seq:gca)
     tRNA            complement(12464..12527)
                     /product="tRNA-Tyr"
                     /note="codon recognized: UAC"
                     /anticodon=(pos:complement(12495..12497),aa:Tyr,seq:gta)
     tRNA            complement(12528..12592)
                     /product="tRNA-Trp"
                     /note="codon recognized: UGA"
                     /anticodon=(pos:complement(12560..12562),aa:Trp,seq:tca)
     tRNA            complement(12591..12660)
                     /product="tRNA-Gln"
                     /note="codon recognized: CAA"
                     /anticodon=(pos:complement(12627..12629),aa:Gln,seq:ttg)
     tRNA            complement(12662..12725)
                     /product="tRNA-Gly"
                     /note="codon recognized: GGA"
                     /anticodon=(pos:complement(12693..12695),aa:Gly,seq:tcc)
     tRNA            complement(12744..12809)
                     /product="tRNA-Glu"
                     /note="codon recognized: GAA"
                     /anticodon=(pos:complement(12776..12778),aa:Glu,seq:ttc)
     CDS             12951..13730
                     /codon_start=1
                     /transl_table=5
                     /product="cytochrome oxidase subunit III"
                     /protein_id="AAC48373.1"
                     /translation="MIRNPFHLVEFSPWPLVGSMGAFCLTVGLAAWFHGFSLFLVWVG
                     VILILLTMVQWWRDVIREGTFQGYHTLRVSRGLRWGMILFITSEVLFFFAFFWAYFHS
                     SLAPCLEIGSCWPPQGVAPLNPFQVPLLNTAVLLASGVSVTWAHHSLIDGDQGGANIS
                     LLTTVILGAYFTFLQAGEYLETSFTIADSCYGSTFFVATGFHGFHVLVGSLFLLVTLW
                     RNFSCHFSSSHHFGFEAAAWYWHFVDVVWLFLYISIYWWGS"
     tRNA            13738..13804
                     /product="tRNA-Lys"
                     /note="codon recognized: AAA"
                     /anticodon=(pos:13770..13772,aa:Lys,seq:ttt)
     tRNA            13801..13865
                     /product="tRNA-Ala"
                     /note="codon recognized: GCA"
                     /anticodon=(pos:13831..13833,aa:Ala,seq:tgc)
     tRNA            13866..13933
                     /product="tRNA-Arg"
                     /note="codon recognized: CGA"
                     /anticodon=(pos:13895..13897,aa:Arg,seq:tcg)
     tRNA            13949..14015
                     /product="tRNA-Asn"
                     /note="codon recognized: AAC"
                     /anticodon=(pos:13979..13981,aa:Asn,seq:gtt)
     tRNA            14014..14078
                     /product="tRNA-Ile"
                     /note="codon recognized: AUC"
                     /anticodon=(pos:14043..14045,aa:Ile,seq:gat)
     CDS             14080..14442
                     /codon_start=1
                     /transl_table=5
                     /product="NADH dehydrogenase subunit 3"
                     /protein_id="AAC48372.1"
                     /translation="MFFVLSLVLFTFLLSLVLLSVSLSLTKKKMMNREKSSPFECGFD
                     PKSSARLPFSMRFFLITVVFLVFDVEIVLLLPYLFSSGWSIDVFSLVGSMMILVILII
                     GVLHEWSEGSLEWFSSSN"
     tRNA            14447..14512
                     /product="tRNA-Ser"
                     /note="codon recognized: AGC"
                     /anticodon=(pos:14473..14475,aa:Ser,seq:gct)
     CDS             14514..15530
                     /codon_start=1
                     /transl_table=5
                     /product="NADH dehydogenase subunit 2"
                     /protein_id="AAC48374.1"
                     /translation="MLNFPFVGLFIFILFFGTLFSLSSIHWFGVWLGLELNLMGFIPV
                     MVQKSTSEETESGVKYFLVQAVGSALFLFGLMLMNWNFCCWELNFFSGFSXSGLIFFG
                     LLMKLGAAPFHFWVPSVVAGLSWMSNFLLLTVQKIAPLFMVCWYLNLSSFLLLILVFL
                     SSLFGGVGGVNQTSVRALIAYSSILHMGWMLXGASAGWSSIFFYFFFYCFILGFIAYL
                     MGLDESFNMSCFSSVYVWNSYSRNFLVFMLLSLGGLPPLLGFFGKWLVLVSLLSLGNL
                     VLSIILVCGSMISLYYYLVLSFSLLLSKGSWSSGALVSKNLMWFGGAMNLSGLGVLLW
                     LSTF"
BASE COUNT         4876 a         1847 c         2891 g         5905 t
ORIGIN      
        1 atgcgatgaa ttttttctac aaatcataaa gatattggta ctttgtatat cttgtttggt
       61 atttgagctg ggttagtagg gactgcttta agattactaa ttcgtgcaga gctaggtcaa
      121 ccaggggctt tattggggga tgaccaactg tataatgtta ttgtcacagc tcatgctttt
      181 gttataattt tttttttggt tatgcctata ataattgggg ggtttggtaa ctggctagtg
      241 cctttaatgt taggggtgcc ggacatggct ttcccccggt taaataatat aagtttttga
      301 cttttgcctc cggcattatg tcttttgtta gcttcagggg cggttgagag gggggctggg
      361 actgggtgaa ctgtgtatcc tcctttggcg gggaatgtgg ggcatgctgg tggatctgtt
      421 gacttagcta ttttttcttt acatttagct ggagtatcgt ctattttagg ggctgttaat
      481 tttattacta caattgtaaa tatacgaaga gaagggatac aattagagcg attacctttg
      541 tttgtttggt ctgtaaaaat tactgctatt ttgttattgc tttccttgcc tgttttagct
      601 ggaggaatta caatattgtt aactgatcgt aattttaata cttctttttt tgatcctgcn
      661 ggaggggggg atcctatttt ataccaacat ttgttttggt tttttggtca tcctgaagtg
      721 tatatcttaa ttttacctgg gttcgggata atttctcata ttgtaataca ttacagatct
      781 aaaaaagaga cgtttggaac tttaggaata atttatgcga tattagctat tggtctttta
      841 ggatttattg tttgagcaca tcatatgttt gtagtaggga tggatgttga tactcgggct
      901 tattttactg cggctactat gattattgct gttcctactg gaattaagat ttttaggtgg
      961 ttggctacaa tttatggagc tcggattggt agggagactc ctataatgtg ggctttagga
     1021 tttatttttt tatttactgt tggggggctt actggtattg tgctatcaaa ttcttcttta
     1081 gatattatgt tacatgatag gtattacgta gttgctcatt ttcattatgt tttatcgata
     1141 ggagcggttt ttgctttgtt tggtgcattt aattattggt accctttaat gactgggcta
     1201 agtcttcatg aacgatgaac aaaaagacat tttgtagtga tatttttagg ggttaattta
     1261 actttttttc ctcaacactt tttggggtta agagggatgc ctcgacgtta ttctgactat
     1321 cctgattgtt atattaaatg aaatgttgtt tcttctattg gttctttaat ttcttttgtg
     1381 gcggttttgt tttttatatt tatcgtttgg gagaggttag tttctcagcg gggggtgatt
     1441 tggagaagcc atttaaggag ggctttagaa tgagataata gaattccttt aggtttcacg
     1501 gatctgatga aggggaagtt attgtttgtt aatttaattt tactgtagtt tataaaaact
     1561 tatgtccatt taaaagtagc ggggttaatt gtattgttgg gattataaat taatttagga
     1621 gaaattagtt aaaaaaataa tgaaggtttg tcaaatctta gttacttaaa aagtatttct
     1681 ttggtattag gttaatagat ttattttatt tattattgta gtgaattatg tgtttaatta
     1741 tttgatagct ataaaatttt tttggttgtt aagttaaaaa ttataaaatt ttaaaatatc
     1801 tttttttagc ttggaattgt attttgttat aagaaaataa aaaaagttac tttttttatt
     1861 tttagtgcaa caaatttgtt tcttgttgga atttgtattt aaactaaatt ttgttggttt
     1921 ttttagtggt tagcactgta gctgggcttt gtttgtgagt gtatagcttt ctcctcgatg
     1981 ggggtctctc cctaaaatag ggggtttaat tagaaattac tactaaattt agttgtataa
     2041 atgtgattta taaattttgg tgtgtattta aaatatttat gtatcaccgg aggggggtaa
     2101 aagaaaatgg ctttttgaag acagtgagga tttcaggatg gggcttctcc tattatagaa
     2161 cagttaattt tttttcatga tcatgcaata ttaattttaa ttataattat tagtttattg
     2221 tcttatggtg cggtttcttt aataaataat tcttttcttt cgcgttctac attagaaagg
     2281 caagaaattg agattgtatg gactatcttg cctgcggtag ttttaatttt tttggcattt
     2341 ccttctttac aattattgta tttgttagat gaattggaag agcctgcttt aactattaag
     2401 gtggtggggc atcaatgata ctggaggtat gagtattctg attttttaaa tttagaattt
     2461 gattcttata tgatttctct tgaagactta gaagagggag attaccggct attagaagtg
     2521 gatcaccgga gggtggtgcc tatgaagact aaagttcgtg ttttagttac tgctgcggat
     2581 gtacttcatt cttggactgt tccttctttg ggggtaaaag cggatgcggt tcctggacgg
     2641 ttaaatcagt taagattttt tgctaattac cctggagttt tttatgggca gtgctctgaa
     2701 atttgtgggg caaaccattc ttttatacca attgtgttag aggtagttga tagaagttct
     2761 tttattaaat ggattatatt taatggggaa gcctagttga taaatttata agaaattagt
     2821 tagatataac agagatttat ttaaatctta agaattatgg agtatttctt tatgccacaa
     2881 ttagctccta taaattgaat ttttttgttg ttattttttt gatctaatgt tttttgtttg
     2941 ggtgtgtgtg tttggtgggt aaagtctaga agttactctt ttttgagtaa gtctgtaagt
     3001 nccccttttt attttaagaa atgagtttga tagaaaatga taatagatat tttttctagt
     3061 tttgatgata ataattttac tttgttttcg ttttcttatt tgatttgggt tttagggtta
     3121 gctcctgtgc taattagtca gaatatgttt tggtttagaa agtctcgttt ttatagaatg
     3181 attttatttc ctaaaaattt tatgggtggg caggttatgc gagctacagg taaaaatatt
     3241 agagggttta ttaatatggt gattagaatt tttttacttt taattttagt taatttatca
     3301 gggcttcttc cttatgtctt tagtttaaga agacatttaa ggtttgcttt ttgttttggg
     3361 ttgccttttt ggctctcttt aatcttttcg ggggatttat atgtttctga ggttgtgagt
     3421 catttattgc ctaggggggc tcctggaatt ttgaaccctt ttttagtttt agtagaaact
     3481 gttagaatta gagttcgacc tattacttta tctgttcgac ttgctgctaa tataagggct
     3541 ggacatatta ttttagggtt aattggtagt tatttgagtg tggggttatt ttgttatcct
     3601 attcttgttt taggtttgtt attatttgtt caagtgtttt attttttatt tgaaattggt
     3661 gttaggttaa ttcaagcata tattttttct ttattagtta ggttatactc agatgatcac
     3721 ccttattaat taaattttaa ttatttttat tctatagtaa ctacggctcc ggggagctcc
     3781 attgcagctt caatgcagtg ctctgatata agctacttag ttaagtaaat catatagtaa
     3841 cggaaataaa taatatagat agaagggtaa gactaataaa aaggttaaat aaatttcttt
     3901 gatttttttg attaattgtt gtaagtgtta taattttatt tagtaggcct tcccctccga
     3961 tagtttccat tcaaccaagg tctaaccttt tgaaagtgta gagtcctgta taaagagatc
     4021 tctttctggt tatattattt cttaggttaa ttataaatca tatattgaaa aaaaaattat
     4081 taataattga atgtctaatt ttaagttcaa gtttaaaaag tttgtatgta attgctgcgc
     4141 ctgttaacgt ggcaaatgtt gctattaatt tatttattat tgaaattaaa ggtaaagttg
     4201 agggggttaa aataagtcaa gaaaatactg ctcctctggt aattgcccca gctgcgagta
     4261 tggtaagtgg agcaataatg ctgttatctt cgtcagaagt tctgactact cttgattgtg
     4321 ttatttttga tcagaaaata aataaagata ggcgagcaga gtatctggct gttaagattg
     4381 ttgctaaaaa tatattaaga gaaattagaa aattattttg gttaaatatt attatttcaa
     4441 taattacatc tttagagtaa aatcctgcta taaatggaaa tccacaaagt gctaaatttg
     4501 caatgttgaa gcatgttctt gagaatggta tttgaattca taagtgtctt attttccgga
     4561 tatcttggtt gttattatgg gagtgaataa tattacctgc gcaaaggaat aggagggctt
     4621 taaatattgc atgagtgaat aaatgaaata gcgctagtga aaatagtcct aatcttactc
     4681 ttaatattat aactcctagt tggcttaaag tggataaggc aatgattttt tttaaatctg
     4741 tttcaaaatt tgctgaaatg ccggctatta ctatagttat tcttgaaata attattaatc
     4801 ttgtgctaaa taaatgggaa tttctaagaa aaggataaaa ttggattaat aaaaaaactc
     4861 cagcagttac taaagtagaa gagtggacta aggctgaaac aggggtaggg gcggctattg
     4921 cagctgggag tcatctgcaa aatggtagtt gagctctttt agttattcct gctaatagga
     4981 ttattctgat agttaatgtt attgttgggg ttcttcatat aaaaagggca ttgaagtgcc
     5041 cttgggaaaa ggttactcta atagctagca agatagctac atcaccaatt cgatttataa
     5101 atgctgttat tagcccggct cctaaagatt tatagttttg ataatagatt actaagcaaa
     5161 aggatactag cccgagccca tctcagccta gtagtaaggt tgctaagctt ggaataaaaa
     5221 ttagtagatt tattgagagt acaaagagta ttacgattca ggtaaatcgt ttgataaaga
     5281 tatcttgtct tatgtaattt ttagtaaaaa ttattactct tgcggagata taacatacaa
     5341 tagcactaaa taaggctgtt gtccagttga ttaaaatggg gagtgtaata gttacagagt
     5401 taaagttgta gaaacaaaat tctagtaaaa taatcttgtt tgttgttaat gtatatattg
     5461 ctgtggagaa tcttaataga ctgtgggata gtaaaattac tgttgcttgt gaagtactta
     5521 aaaatattat tttcattgtt agataagttt gtacttactt ttaagaccac aacttaatat
     5581 tcttttataa attaatctaa caaattgttg ttcttaatag aattaaaagt tgtgctggaa
     5641 ttcaatgtaa aaagattaca ttgtaatata agggtttgaa attattgaag gggttaacaa
     5701 atgaagaaat ttttccatgt tgtgtattgg taaataagaa tagagtataa actgccgaaa
     5761 cgaatgctat aagtgcgaga agaattatca gaaattttga gatagaaact gtactaatta
     5821 ttaagcctgc ttctcttagg aggttgattg aggggggagc tgctatgttg attgaacata
     5881 ttaagaaaaa agatatccta aaagttggaa ctaatgagat aaaccctttt gtaataaaaa
     5941 gtcttcggct tccagacttt tcatatatta tgtttcttat tgaaaatagt cctgaagagg
     6001 aaagaccgtg agcaattatt attaataaag ctatttttaa accaaattca aatctgctga
     6061 ggagtcctgc tagtatgagt cctatatgac caactgagga ataagcgatt aatgctttta
     6121 tgtctctttg gcgtagacaa attagacttc ttaatactcc tcctactaag ccaagtgtga
     6181 taataaagta gtttaatacg aaattgtatt tgaaaatatt attattaatc gtattaatac
     6241 catagccacc tagttttagg agaagcgctg ctagaattat agagccggct acaggggctt
     6301 ctacatgagc tttagggagt catagatgaa aagagtaaat tgggagttta actaaaaata
     6361 ctagaataat gaataaccat cagaagctaa ttatggcttg ataaggtata attggtaggc
     6421 ttattataat tagtaagtta agatgagcat tatgtgaata aataaaaaag atgttaatta
     6481 agaaaggaag tgctcctaaa atagtgtaga ttattatata tatcccagct tgaaggcgtt
     6541 ctggttgata ccctcatatt aaaattaaga ttaatgtagg gattaaggat gcttcaaaaa
     6601 aaatatataa tgaaaatagt cttttttgag taaatactat aataataatg aaatttaaaa
     6661 ttattacatt tagtaaaaaa aatcttacta gattattatt ttttagaatt ttatatctgc
     6721 ttataattat taaaccagta attcaacatc ttaatattat taaaggtacg gaaaaattgt
     6781 cactgaaamm ttcgtaatta attttaggga tgtttattgg tgagaaaaaa tttaatgtaa
     6841 ttataaaaaa tataaaatga gaaattcagc ttattttgta tcaatttatt ttgctgtttt
     6901 ttgttataac ggtcgaaaat gctgatataa taaaaaaagc tagcacttat gaatggagat
     6961 tgatgatacg taatcatttc cgtgtgcacg aattaaaatt actaatattg cgagcccgat
     7021 gctagcttct gaagctgcta gagtaagtaa gacgaaaatt attaaccctt catttcttat
     7081 aaggtttgat agggatacta ataataaaaa aattcttact attaagattt ctaaggctaa
     7141 taaggtgtta agaagatgtt ttcgttgtag gcaaattgtt attagtgctc taatcctact
     7201 taaagctcca agcgtgaata atgggttaaa aaaatttatc atgtctgcta aaaaagcttt
     7261 tatagccttg gtcttgtaaa ccaaagatag aaataattaa tttcttttag tatgccgtta
     7321 agtgaattga acacttcttt attgttttca agacaatggg ttcccagaat aagcggcaag
     7381 ttaaaagttg attgttcagt ctcatatttt ttttgttaga gggattatta gaaataacag
     7441 aaaatataca aatgttaaaa tttgtccaat tagaataaaa gggtcttcta ctggctgagc
     7501 accaattcaa gttaaaagta aaaagacgga cactaggctt cagtataaaa tttgagttac
     7561 agggtaaaaa gaaatagttc ggaattttcc taagttaatt aatgggacaa aaaataaaat
     7621 tacgatagat attaatagtc caactactcc gcctaattta ttaggaattg atcgcaaaat
     7681 tgcataggcg aatagaaaat accattctgg ctggatatgt gttggggtaa ctagagggtt
     7741 agctgggata aaattatctg gatgtgctag gagatttggg tctaaaaata ctaataaaag
     7801 taaaaaaatt actattacta caaacccgac tagatctttt agtgtgtaga atgagtggat
     7861 agtaactttt tctctatctc tattgattcc taaggggttg ttagaccctg tttcatgaag
     7921 gaagagaatg tgtagaacag atgctgcagc aataataaaa ggggcaagat aatgaaatga
     7981 aaaaaatcgt gttaaagtgg cgttatctac tgcaaatcct cctcagattc attgaactat
     8041 tgttgtgccg atataaggaa tcgctgatat taagtttgta ataacagtag cacctcaaaa
     8101 agatatctgt cctcagggta gtacgtaacc gataaaagct gtccctattg ttaaaaataa
     8161 taaaataacc cctacnntyc aagtgtgaat gttgacgaat gagccataat atatcccgcg
     8221 gccaatatgg aaataaaggc aaataaaaaa taaagaaccc ccgttagcat gggcagctcg
     8281 gattaatcaa ccatagttta cgtctcgaca gatatgtgca acagaagaaa aagcaagttc
     8341 gatattggtg gcatagtgta ttgctagaaa gaggccagtt aaaatttgga taataaggca
     8401 taggccaaga agtgacccaa aatttcatca aattgataaa tttctagggc tagggaggtc
     8461 aattaatgac ccgttaataa ttttaaagac agggtgggaa gatcgaattg gtttaagcat
     8521 atttgtaggg gcggagaggc ccatttctaa agtagcagat ttttactacg caaattaata
     8581 caaaaaatag aattaaagct aatcttacaa taattaaaag attaaagggg gaaaataaag
     8641 aaattcctaa gtggttaaaa aaagaatttc ataggaatat tatctttgtt tgttcctcta
     8701 ataaagttcc aatgaagtct cttaaataaa gtattaataa ccagaatact gttcttacag
     8761 ggaaaaagac ttgaattagg ttttttttaa atattaaatt tggtattaag gctgtaacgt
     8821 aagcgaatat tactaaaagt cctccaatat aaattaaaaa cagaataaat ctaaatcaag
     8881 tgcttcttcc aaagaaaatt aagatactaa taaatagcct tataaataag agtaaaagtc
     8941 ctaggctaat tggttgagtt aaaagaggta atgaaaaagc acaagaaaaa attagggata
     9001 ttgttaataa gaatgtcata tttcagatag tagtttaaga aaaatattag cattggaagc
     9061 taaagattaa attttaattt gttatctgag taataaggtt gttactataa attttgctga
     9121 taggtttcat attaaaatta ttagtgatac tgggagaaat cttagtcaag ttaattttat
     9181 taatagatcg tatcgaaggc gaggaaaggt acctcgaact caaataaaaa caaaggcgat
     9241 aaaagtaact tttactcaaa ataaaaagtt agttaaaatt caagaatcgc ctgctcctaa
     9301 aaagagaatt gtcgttatta ttctcatgaa taaaattctt gcgtattctg ctaagaataa
     9361 tagagcaaaa gagcctcttc catactcgat gttaaaacct gatactagtt cagattctcc
     9421 ttctgcaaag tcaaaagggg ctcggtttgt ctctgctaag cagactacaa ttcatattag
     9481 taacaatgga gttattagaa ttctgtttca gtatagtaat tgatgggaag aaatttgatt
     9541 taaatttagg gatgaactta gagcagctct agaaaggaga actaaaaata acgttacttc
     9601 gtaagaaatg gtttgagcaa ctgcacggag ggcacctaga agagcatatt tagagttaga
     9661 agctcagcct gcgattattg tgccataaac tctgagggca gatgtgcata gaaaaaaaag
     9721 tactccaaaa ttaaaatatc ataaggtaaa atctcttcaa tatagagatc aaaggcaaag
     9781 tcttaaaatt aatcttaaga ctggtgctgt gtaataagga agtttgtttg aattataaag
     9841 attgttttct tcttttaaga agagttttaa ggcgtctgct aagggttggg ctaggccaaa
     9901 aattcttact ttgtttggtc cttttcgaaa ctgaatatat ccgaggcctt tccgttctaa
     9961 taaagtgaaa aatgctactg ctaataagat agaaatatag gcaattacta ttcaagaaaa
    10021 agataagaac ataactaaaa aaaatattat aattttattt gtagagctta attctactgc
    10081 acttttttct gccattttag tattaggtga gatttttctc gtataataat tctaaattat
    10141 ttgcacttaa ctttgctaac ctaatatagt gggcaaatta tttgttatgt ttggtccttt
    10201 cgtactaaaa cataaataat tagctcaaag atagaaacca acctggctta cgccggtctg
    10261 aactcagatc atgtaaaggt ttaagggtcg aacagaccca cttattttaa gcttctgcac
    10321 ttaaaagtta ctttaatcca acatcgaggt cgcaaacttt ttcttcgatt aggactctct
    10381 gaaaaaataa ctgctgttat ccctacggta gctttttctt ttaatcataa ttatggctct
    10441 ataaatttat aaatttacat aataaaaaga agctttattt gttcttttgt cgccccaact
    10501 aaaaatggat ataaattttg tttttctaaa agattttatt tatacataaa tttaaagctc
    10561 gatagggtct tttcgtcttt tgagattatt taagcttctt cacttaaaaa ttaattttta
    10621 tttaatgtaa tagagacagt cttgcccacg tcaagccatt catacaagct ttcaattaaa
    10681 aaacaagtta ttatgctacc ttagcacagt cagggtactg cggccgttta aaatttcact
    10741 gggcaggcac gactctttat taataatttt caaagagcga tgtttttgat aaacaggcgg
    10801 ggctagaatt tgccgagttc cttttttaca tttataatat ttttttgttt aaaagttttt
    10861 attcttgggc tttataaact atatttgatt ttaatactca ttttaacata aactaattta
    10921 agtttttaaa ttttaaataa gaaaagatat taaaaagaaa ttaggtataa tttttgattt
    10981 tatttgttaa agaactatta atatgatagc tactattaag cttacattaa ttaaaggtta
    11041 acaattttct tttaaatttt attagcttag cctaataaaa ttgtaattta aattacggta
    11101 tattaaaaaa taatttttag taatttaaat tagtacttat atacttttct cttttaacta
    11161 gctatcaaaa aagacggcat gcatttaact tctataaata aatcattaat ttaattttgc
    11221 tacattaata aagtttatat atagctcctt ttttttctag tgatattata atataaaata
    11281 atctcgttaa accataatgc aaaaggtact agtgttaatc tatactttac tgtacttcat
    11341 ttattccttt acagtactgt tgtttaaatt aaagtttttt ttggatacta atttatataa
    11401 gggttttgaa ttaaaaaatt tgtaattgtt attggaaggt ttaaaatggt ctttttagac
    11461 taacttttta gtgtaaataa aatgcaagat ttttgcttca ttttaaggaa cagcttcagc
    11521 tactcctact atgttacgac ttatctcttt ttaaaaagag agtgacgggc gatatgtaca
    11581 cgtcttagag ctttttcaaa ataatgttca taatttattt ttacttctaa gtccgccttg
    11641 attaaatata attgcaatag atttccgtat tttaaattta aattgtaacc ctaatattat
    11701 ctttactata actggcgttt tgacctgtca taatagagag ttgtcttgag tagttaactt
    11761 atgacggaag tatacaaact agtaaaattt aagtaaagtg aggtaaagcg cgggttgtcg
    11821 agttaaaata caggttcccc tagaaaggaa taagacaccg ccaagttctt taagttttaa
    11881 acaatattta ttcgtaatac tctggtgtaa tgatttaatt ttttaatagt ggggtatcta
    11941 atcccagttt tagttaaaat ttttgtagcg tcttttttag taagaagaag gtgataaaaa
    12001 aatgtaaatt ttactttttc attttttata atctgacatc tttataaaaa taactacctt
    12061 ttaccgttta gattaacttg aaccttttgt ataaccgcag ttgctggcac aaatttaact
    12121 agttctgaaa tctatttcta aacctaaatr tcttttgttt ttaatcttta acactgaagt
    12181 ggtaagcgat gtcttgaaat aattgatatc ttaaaaataa atatttttta taatttatac
    12241 aaataaagtt tatttttatc tttacagctt cggcaaaact atcatgtgtt tctaaaagaa
    12301 ttaattaatt ataaactaga accaaattta tttgtaaaag agaataaatc tcatagttgg
    12361 gtatgaaccc aatagcttaa cttagcttat tttacaatgt gtaaactcta acaatcagat
    12421 gtaactttaa atttgcaatt taatattttt taaactatag agttaataga gaaggatatc
    12481 ctcataaata aatttacagt ttaccacctt ttatcggcca ctctattcaa aacacgaaca
    12541 ttttattcat agaaagcttt gaaggctatt agttttttta acttagtgtt ttaaaaagaa
    12601 aaagagttac ttttttcttt aggattcaaa ttcctacgtg ctttggtaca ctacttttta
    12661 ttatttcttt taaatgatta aactttttac ttggaaggta agtgtactaa ttatactaaa
    12721 gaaacatagt tgaatacttt tatcagatag atatttatat ttattctttc taaatgaaaa
    12781 ttagatgtgc tatttaacac tacttatctg atagcattta tatatatata tatatatata
    12841 tatatatata tatatatata tatatatata tatatatata tatatatata taatagaata
    12901 tgaccatata tttatatatc ttaaagtgct agcaaaaaaa aaaaaaaaaa atgattcgaa
    12961 atccgttcca tttagtagaa tttagtcctt ggcctttagt ggggtctata ggcgcttttt
    13021 gtttaactgt gggcttagca gcttgatttc atgggttttc tttattttta gtatgagtgg
    13081 gcgttatttt aattttatta acaatggttc aatggtggcg agatgtaatt cgtgaaggga
    13141 ctttccaagg gtaccatact ttgcgggtta gccgcgggtt acgttgaggt ataattttat
    13201 ttattacttc tgaagtacta tttttttttg catttttttg agcttatttc cattctagat
    13261 tggccccttg tttggaaatt ggatcttgct gacctccaca aggagttgct cctttaaatc
    13321 cttttcaagt gcctttattg aatacagcgg tgttattagc gtctggggtt agtgttactt
    13381 gagcgcacca tagtttaatt gatggggatc aaggaggtgc taacatttct ttacttacta
    13441 cagttatttt aggagcgtac tttacgtttt tacaggctgg agaatattta gaaactagct
    13501 ttactattgc cgacagttgt tatggatcaa cattttttgt agctacaggg tttcatggct
    13561 ttcatgtgtt agtaggtaga ctttttttat tagttacttt gtgacgaaat tttagttgtc
    13621 atttttctag gagccaccat tttggctttg aagcagctgc ttggtactgg cattttgttg
    13681 atgtagtttg attgttttta tatatttcta tttactggtg ggggtcataa gtttatatcc
    13741 taagtaacct aggttacagg tactaaattt ttaatttagt tacgataaat tatatcctta
    13801 ggaactatac tttaagtaaa aggtttaatt tgcatttaaa aaatagggcc aagccctttg
    13861 ttccagtctt aaaagtgatt attcattttt ggtttcggcc cattaggtag cagagaagtt
    13921 ctgttttaag acttctgaat ttaaagtgtg aatataagct ctgcttgagc ttttggttgt
    13981 taaccataca ggaataaata aatttatata ttcagtgtta cgccgggtga acgggctaca
    14041 ttgatgttgt agataataag agtaattctt taacacttaa tgttttttgt attaagtttg
    14101 gtcttgttta cttttttatt aagattagtt ttattaagtg taaggcttag tttaacaaaa
    14161 aaaaagatga taaatcgaga aaaaaggtct ccttttgagt gtgggtttga tcctaaaagt
    14221 tccgctcggt tacccttttc tatgcggttt ttcttaatca ctgtagtttt cttagtgttt
    14281 gatgttgaga ttgttttgct tttgccctat ttattttcta gtggctgaag aatcgatgtt
    14341 ttttctttgg taggaagaat aataatttta gttattttaa ttattggggt tcttcatgag
    14401 tggtctgaag ggaggttgga gtgattctct agaagcaatt aagttaaaag tagtttggga
    14461 caaattttgg ctgctaacta aaatttaagc ggttcgattc cgtttttctt tttgtgttaa
    14521 attttccttt tgttggctta tttattttta ttttattttt tggtacttta ttttctttat
    14581 cctctattca ttgattcggg gtttggcttg gcttagaatt aaatttaata ggttttatcc
    14641 ctgttatagt ccaaaaaagt actagtgaag aaactgagtc tggtgttaag tattttttgg
    14701 ttcaagctgt tggctcagct ttgtttttgt ttggattgat gttgataaat tgaaactttt
    14761 gttgttgaga gttaaatttt tttagaggtt tttcgnncag aggtttaatt ttttttggtt
    14821 tgctgataaa acttggggca gcaccatttc atttttgggt tcctagggtt gtagctgggc
    14881 tatcatgaat atctaatttt ttgttattaa cagttcaaaa aattgctcca ttgtttatgg
    14941 tttgttggta tttaaattta tctagatttt tgttgttaat cttagtattt ttatcttctt
    15001 tatttggagg agtcggaggg gttaatcaga cttcagtacg ggcattaatt gcttactcgt
    15061 ctattttgca cataggatgg atgcttnnng gggctagagc gggatggagc agtatttttt
    15121 tttacttttt tttttactgt tttattttag gttttattgc ttatttaatg gggctagatg
    15181 agagatttaa tatgagttgt tttagaagag tgtatgtgtg aaattcttat tcgcgtaatt
    15241 ttttagtttt tatattattg tctttagggg gcttgccccc tttacttggc ttttttggta
    15301 agtggttagt gttagttaga ttgttatctt tagggaattt agttttaaga attattttag
    15361 tttgtgggtc tataattaga ttatattatt atttagtgct tagtttttca ttacttttaa
    15421 gcaaagggag gtgaagaagc ggagcattgg tatctaagaa tttaatgtgg tttggcggag
    15481 ctataaattt gagggggtta ggtgttttat tgtggttaag tactttttag at
//