LOCUS       LK021129             1187342 bp    DNA     circular BCT 04-FEB-2016
DEFINITION  Vibrio anguillarum chromosome 2, strain NB10, complete sequence.
ACCESSION   LK021129
VERSION     LK021129.1
DBLINK      BioProject:PRJEB5701
            BioSample:SAMEA3865288
KEYWORDS    complete genome; complete replicon.
SOURCE      Vibrio anguillarum
  ORGANISM  Vibrio anguillarum
            Bacteria; Proteobacteria; Gammaproteobacteria; Vibrionales;
            Vibrionaceae; Vibrio.
REFERENCE   1  (bases 1 to 1187342)
  AUTHORS   Holm K.
  JOURNAL   Submitted (26-MAR-2014) to the INSDC. Norstruct, Dept of Chemistry,
            University of Tromso, Science Park 3, NO-9037 Tromso, NORWAY.
REFERENCE   2
  AUTHORS   Holm K.O., Nilsson K., Hjerde E., Willassen N.P., Milton D.L.
  TITLE     Complete genome sequence of Vibrio anguillarum strain NB10, a
            virulent isolate from the Gulf of Bothnia
  JOURNAL   Stand Genomic Sci 10, 60-60(2015).
   PUBMED   26380645
FEATURES             Location/Qualifiers
     source          1..1187342
                     /organism="Vibrio anguillarum"
                     /chromosome="2"
                     /host="Rainbow trout"
                     /strain="NB10"
                     /mol_type="genomic DNA"
                     /country="Sweden:Baltic Sea, Norrbyn Umeaa"
                     /isolation_source="clinical isolate, Rainbow trout"
                     /serovar="O1"
                     /db_xref="taxon:55601"
     rep_origin      1..366
                     /direction=RIGHT
                     /note="oriIIva; va:Vibrio anguillarum"
     misc_binding    complement(12..20)
                     /bound_moiety="DnaA"
                     /note="DnaA-box (TTATCCACA; the perfect Ecoli DnaA box)"
     regulatory      35..46
                     /note="GATC sequence; 12-mer consensus is
                     (A/T)TGATCATNN(A/T)T; (A/T)=W cfr Egan&Waldor in CELL
                     vol.114, 521-530 (2003)"
                     /regulatory_class="other"
     regulatory      58..69
                     /note="GATC sequence; 12-mer consensus is
                     (A/T)TGATCATNN(A/T)T; (A/T)=W cfr Egan&Waldor in CELL
                     vol.114, 521-530 (2003)"
                     /regulatory_class="other"
     regulatory      81..92
                     /note="GATC sequence; 12-mer consensus is
                     (A/T)TGATCATNN(A/T)T; (A/T)=W cfr Egan&Waldor in CELL
                     vol.114, 521-530 (2003)"
                     /regulatory_class="other"
     regulatory      103..114
                     /note="GATC sequence; 12-mer consensus is
                     (A/T)TGATCATNN(A/T)T; (A/T)=W cfr Egan&Waldor in CELL
                     vol.114, 521-530 (2003)"
                     /regulatory_class="other"
     regulatory      126..137
                     /note="GATC sequence; 12-mer consensus is
                     (A/T)TGATCATNN(A/T)T; (A/T)=W cfr Egan&Waldor in CELL
                     vol.114, 521-530 (2003)"
                     /regulatory_class="other"
     regulatory      148..159
                     /note="GATC sequence; 12-mer consensus is
                     (A/T)TGATCATNN(A/T)T; (A/T)=W cfr Egan&Waldor in CELL
                     vol.114, 521-530 (2003)"
                     /regulatory_class="other"
     regulatory      292..297
                     /note="gfindb/bprom run: pre rctB (98nt); seq TTTATT,
                     score 24"
                     /regulatory_class="minus_35_signal"
     regulatory      312..320
                     /note="gfindb/bprom run: pre rctB (98nt); seq
                     (CTT)TATTCT,score 58"
                     /regulatory_class="minus_10_signal"
     protein_bind    322..350
                     /function="part of OriCIIva; used by RctB for
                     autorepression; controls replication indirectly by
                     controlling transcription of the initiator gene (and
                     possibly directly by inhibiting origin function)."
                     /bound_moiety="RctB2"
                     /note="29-mer; cfr Vankova-Canova and Chattoraj in Plasmid
                     67 (2012), 102-110"
     regulatory      326..369
                     /gene="rctBp"
                     /note="The minimum rctB-promoter; starting base (+1 first
                     A): (ttgg)Aactat|agcg.... According to Pal, D., et al.
                     (2005). Multipartite regulation of rctB, the replication
                     initiator gene of Vibrio cholerae chromosome II. Journal
                     of Bacteriology 187(21): 7167-7175"
                     /regulatory_class="promoter"
     CDS             367..2343
                     /transl_table=11
                     /gene="rctB"
                     /locus_tag="VANGNB10_cII0001"
                     /old_locus_tag="TVA3114"
                     /product="OriCII binding protein, RctB"
                     /note="user locus_tag: VANGcII0001"
                     /note="Similar to Vibrio cholerae serotype O1 (strain ATCC
                     39541/Ogawa 395/O395) subname: full=putative
                     uncharacterized protein UniProt:A5F1N8 (EMBL:CP000626)
                     (658 aa) fasta scores: E()=0, 88.4% id in 657 aa, and to
                     Vibrio splendidus (strain LGP32) (Vibrio splendidus
                     (strain Mel32)) subname: full=rctb protein UniProt:B7VU59
                     (EMBL:FM954973) (659 aa) fasta scores: E()=0, 87.7% id in
                     659 aa, and to Aliivibrio salmonicida (strain LFI1238)
                     (Vibrio salmonicida (strai LFI1238)) rctb subname:
                     full=oricii binding protein rctb UniProt:B6EPZ4
                     (EMBL:FM178380) (661 aa) fasta scores: E()=2.5e-212, 76.2%
                     id in 650 aa"
                     /protein_id="CDQ47898.1"
                     /translation="MNADEKILIKAPRSHKDGHLFEVSETAVDWVDQYQHFKGVTKSI
                     VELLNLISLRGFRSQDGLVSTTELIEATDGQLTRAAIQQRLRAAVSIGLFKQIPVRFE
                     EGLAGKTMLHKFVNPNKLISVLGSTSLVTESVKQTEKRKRSKALAQTQVNKRLLTEHG
                     LNIPPAMKDEADQFVVSPTNWAGIIDQALAPPRTRKSYQKSMVSISGTRAIIETRSSK
                     NIMTVDDLMTLFALFTLTVQYHDHHQEDYQLNTKHTPNKTPLYITDILSLRGKKDSGP
                     ARDSIRDSIDRIEFTDFQLHELTGRWLSENMPEGFKSDRFRFLARTITASEEAPTEGA
                     DGEIRIKPNLYILVWEPSFYEELLTRDYFFLFPPEILKQHTLVFQLYSYFRSRMSRRH
                     TDSMLLSELNQKLARNIEWRRFSMDLVRELKRLSEGKGSDSLFVVNLWGYHLTVTTLV
                     DKEKVMDYQVDIKCDVEEVLRYSRARTTNAGKRNMAPTLPNPLRNEMVSKQKLEELSE
                     IIDGEFEPIQRKAPSPKGKLGRRVKQRKHLVEINADEITITLSKYTSPEALERSITAL
                     SAMTGHPPSSIKEECTELIDKLDWLRVGNEAISYETLSKLIELYNTKNENKHLSIERL
                     ISGLAVRRKVCKQVYEGHLDESVFRALDEVAIGI"
     CDS             complement(2522..2977)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0002c"
                     /old_locus_tag="TVA3113"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0002c"
                     /protein_id="CDQ47899.1"
                     /translation="MCKLHDWLTEIHQWHLNKRYDQVAQLQPLILNAPQEIWGPDLSD
                     DQSKAIACWLDACLRQYEYYKLIDGELAFQYLQLAYARFQRCVSEPSSELELKSWCIK
                     RMQQLMVLSLEHLNQQHVDEALSRSLIDAHVRFLAYYAWNDDQGIKRGY"
     regulatory      2543..2554
                     /note="putative GATC sequence; 12-mer consensus is
                     (A/T)TGATCATNN(A/T)T; (A/T)=W cfr Egan&Waldor in CELL
                     vol.114, 521-530 (2003)"
                     /regulatory_class="other"
     CDS             3333..3530
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0003"
                     /old_locus_tag="TVA3112b"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0003"
                     /note="Similar to Vibrio cholerae serotype O1 (strain ATCC
                     39541/Ogawa 395/O395) subname: full=putative
                     uncharacterized protein UniProt:uniprot_trembl_bacteria
                     (65 aa) fasta scores: E()=1.1e-18, 84.6% id in 65 aa"
                     /protein_id="CDQ47900.1"
                     /translation="MSINSIDHDEMTDIANKWDFTEEVETQKPVKNLKSAEARRRIEA
                     LREIRESGLTIEEAKELGILH"
     CDS             3690..3899
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0004"
                     /old_locus_tag="TVA3112"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0004"
                     /protein_id="CDQ47901.1"
                     /translation="MSFNLSLLATEEKNKVELDKQASFLVWKLKQGKAGPEAITQQQS
                     KIASEAEKEWFLQSVNKYKRVMGVA"
     CDS             3989..4705
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0005"
                     /old_locus_tag="TVA3111"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0005"
                     /protein_id="CDQ47902.1"
                     /translation="MGRSFEVRKASMAKTQGAKIKVYSKYGKEIYMCAKNGGSDPDMN
                     LSLRHLITKAKKDQVPGHVIDKALDKASGGGGEDYQPARYEGFGPGGASVIVDCLTDN
                     GNRTFQDVRQCFVKTGAKIGTPGTVSHMFDHQAVFQFKGDDEDSILEALMMDDVDVTD
                     VELEDGVITVFAPNTEFFKVKTSLNNQFPDLAIDVEEITFVPQTHTPVTGEEAEKFQK
                     FLDMLDDCDDVQQVYHNAEL"
     misc_feature    3995..4699
                     /note="HMMPfam hit to PF01709, DUF28, score 1.2e-112"
     CDS             4873..5736
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0006"
                     /old_locus_tag="TVA3110"
                     /product="6-phosphogluconate dehydrogenase"
                     /note="user locus_tag: VANGcII0006"
                     /protein_id="CDQ47903.1"
                     /translation="MKVSFIGLGVMGYPMAGHLKNAGFNVSVYNRTQAKAQQWAQRYH
                     GHAAQTVAECVQDADVVLTCVGNDDDVRSMTTSDGGAIRAMKRGAILVDHTTTSALLA
                     EELASAAHKAGIRFMDAPVSGGQAGAENGVLTIMCGGDAELFEQLQPVFHAYGKSSVL
                     MGKAGQGQRAKMVNQICIAGVLNGLSEGLILAEKSGLDIGVLVDCLKNGAAGSWQMEN
                     RAVNMSIGKFDYGFAIDWMIKDLGFCLDEAQRNDLKLPMTEKTYHAYQALSEQGEGRM
                     DTSILIKAVNS"
     misc_feature    4873..5361
                     /note="HMMPfam hit to PF03446, NAD_binding_2, score
                     5.7e-77"
     misc_feature    4885..4920
                     /note="PS00895 3-hydroxyisobutyrate dehydrogenase
                     signature."
     misc_binding    complement(5781..5795)
                     /gene="parS2-C"
                     /bound_moiety="parB2"
                     /note="parS2-C, ref: Yamaichi, Y., et al. (2007). Distinct
                     centromere-like parS sites on the two chromosomes of
                     Vibrio spp. Journal of Bacteriology 189(14): 5314-5324.
                     Search-seq: ATTTAsArTGyAAA(G/t) eg. NTTTACANTGTAAAN"
     CDS             6181..7434
                     /transl_table=11
                     /gene="sdaC-2"
                     /locus_tag="VANGNB10_cII0007"
                     /old_locus_tag="TVA3109"
                     /product="serine transporter"
                     /note="user locus_tag: VANGcII0007"
                     /protein_id="CDQ47904.1"
                     /translation="MKDTKEMAHFSHVQISNWTKHDTYWLLSLFGTAVGAGILFLPIN
                     IGLGGFWPLVLMVLLAFPMTYLSHRGLARFVLSSRRPNADFTDVVEEHFGQRAGRLIS
                     LLYFLSIFPILLIYGVGLTNTVDSFLVNQAQMVAPPRVLLSGGLVFALIAIMLGGEKI
                     MLRAFAVMVYPLAAILLFLSLYLIPYWSVPSLALPQTSDFLHTVWLAIPVVVFSFSHA
                     AAISSFANVQRRHYGALADKKSEQILRYTSLVLILFVLLFVFSCVLALSPEALQEAKV
                     QNISVLTYLANVTDNPFIATLGPLVAFIAITSSFLGHFLGARESLAGLLCKNFGLSLR
                     LAGRFTIAILFVTIWIVAILNPSILGMMEAFSGPVIAMILFIMPMIAVFKVPSLAKYQ
                     QQMSTLFVMAIGLLAVSALLYNLLN"
     misc_feature    6238..7431
                     /note="HMMPfam hit to PF01490, Aa_trans, score 0.00076"
     misc_feature    join(6250..6318,6328..6396,6481..6540,6583..6651,
                     6676..6744,6787..6855,6916..6984,7057..7125,7183..7242,
                     7270..7329,7366..7425)
                     /note="11 probable transmembrane helices predicted for
                     TVA3109 by TMHMM2.0 at aa 24-46, 50-72, 101-120,
                     135-157,166-188, 203-225, 246-268, 293-315, 335-354,
                     364-383 and 396-415"
     misc_feature    6934..6966
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
     CDS             complement(7470..8531)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0008c"
                     /old_locus_tag="TVA3108"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0008c"
                     /note="contains 1 TMHMM-helix; exp no AAs in TMH: >20; No
                     significant Pfam-A-matches."
                     /protein_id="CDQ47905.1"
                     /translation="MNQSASEQLQTDIPASISAMVLLNSACQGVVETYIDQGNAEHWY
                     AQVEQNLNAVQKLVRQWRLSGNLYFSNDIMDSVLSIANTFKDSNVQILTLFKALETRF
                     DTAQLQQLTSLILTLQNPIQSLTSNIKRYDEGLNAWARQVEDAHNTLQQTIAQIQQEE
                     VSIQAEIIATNAQIDLMKQQIAAFKTAIANAQSQRKKGIFETIFGVVLAPFTLGGSLI
                     LAGFGVSSIVEAQSEISSLQSDIQSSLNTINHDQQTLSQDQQQIASLNALLLSVDQVN
                     NDCAAISRSLDTLQTTVLSLYNETNNVVSNLTKAQDSQAVILEQVWYQSAYNEWQDIL
                     EVASTLNNAQPQITKAQIK"
     misc_feature    complement(7860..7928)
                     /note="1 probable transmembrane helix predicted for
                     TVA3108 by TMHMM2.0 at aa 202-224"
     CDS             complement(8582..9691)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0009c"
                     /old_locus_tag="TVA3107"
                     /product="putative (membrane related) uncharacterized
                     protein"
                     /note="user locus_tag: VANGcII0009c"
                     /protein_id="CDQ47906.1"
                     /translation="MSQQVTQLNPTQQTTQSAFLATTVITAQCHAILNTQFTPPTVKP
                     DWFDDLSKKLDSAKLVAKQWIDDLGPQVSASIPSSVINFDATFQASIDAIHELYKADP
                     TASGKDNTTVQQASQIMTALSSQVSGIEATVKGMNKELSDWGVKMQAAHDDLVNGATN
                     IQKTIIDLQTDIESMNNAIDNNRAAIEKLNKDLVYAQVAVGVGIFMLVAGVALTVATA
                     GTAAVVSGGVAAVGAASIIAGGVTWGVLQNQIDDDYDSIAQEQKQKAEDQQQIIALQG
                     LSNASSAVVSAIETSTSVLSDFETTWTVFGNELDDVVTKLNSGASMQSIIMEKVMSDA
                     AKNEWDDAVELAKQLASAKIAIETKELAPAVKQAA"
     misc_feature    complement(join(8960..9028,9047..9115))
                     /note="2 probable transmembrane helices predicted for
                     TVA3107 by TMHMM2.0 at aa 193-215 and 222-244"
     CDS             complement(9704..10768)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0010c"
                     /old_locus_tag="TVA3106"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0010c"
                     /protein_id="CDQ47907.1"
                     /translation="MLSPNVDTALNMLTDVYTDFLGISNYDATCNSLFIGHVAKDPNW
                     LVEVRSRTEILRAVMNEFMQQKPKIFAQIITSFINYQTTFDACAQNSKAITSTKQWIE
                     CLQLLQKTLKQNITLTNEAQQVFTKSYSQAKNAEELLASSIQDGWNELASEEQAMVRI
                     ATEIGSLSQSIASLGANVTAAQLRAGKAYIQSMVTISYGVVMGATTSVPFLSFAGALF
                     TVGYSAYSTISSAKEVQQDLDKLTQLQTLASEEAQAAAITKAIIQTLSNMSEEFLKID
                     DSLPALSLLWQDELDKVNELINALQSGSDPALLTDLQTIKIASASWKTISEFVQLISL
                     PPNVGKPVLVNTLNNTIQEQ"
     CDS             complement(10780..11175)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0011c"
                     /old_locus_tag="TVA3105"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0011c"
                     /protein_id="CDQ47908.1"
                     /translation="MKKVEILMVVDAAAALASRDLQSNIYLIDTNKYMGSGNEGQAEL
                     KTACKDGQLLCWRVVAISPDNEVDIVEFNGQMINDRVCIPTKQGLSGDEFWEGRVEAQ
                     GQASTQQYNATLSIDGARLTFDPFLVISL"
     CDS             complement(11200..11580)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0012c"
                     /old_locus_tag="TVA3104"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0012c"
                     /protein_id="CDQ47909.1"
                     /translation="MKKIEILIVVDCAGALATTSLMDNVYLIDSNQWLGSWDEGTCQL
                     HTVSQDGQFICWRSCAISPDDEVNITGFSGDMIDQKACLPSPVNDAWEGRVQTRGDTG
                     RYLYTISLSINGITMNFSPYLEVQ"
     CDS             complement(12205..13092)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0013c"
                     /old_locus_tag="TVA3103"
                     /product="Transcriptional regulator, LysR family"
                     /note="user locus_tag: VANGcII0013c"
                     /protein_id="CDQ47910.1"
                     /translation="MDRLTAMRSFIEVANTASFTKAADNLSLSRLQVSRHVQEVEDWL
                     KQRLLHRTTRKVSLTTAGEEALIRCEQILHQTAELETRALEQSQLLNGTIRIAAPIGL
                     AQNMLLAVVEDFTQRHPNVLIDIVASDRLSQLVDERVDIALRFTQQPDDTLIARRLMS
                     VGTVICASPSYLNQHPPINTPNDLTQHNCFVHMSNNKWDVVKDNEQLSVTVNGNIRAN
                     DMEILCRAALHHKGIVRLPCDLANVFIASGTLVRVLPEFHSPSSALWAVYLSRSYQTP
                     LVRQFIDFIAQSWKNDLIA"
     misc_feature    complement(12223..12834)
                     /note="HMMPfam hit to PF03466, LysR_substrate, score
                     4.1e-48"
     misc_feature    complement(12904..13083)
                     /note="HMMPfam hit to PF00126, HTH_1, score 5.8e-14"
     misc_feature    complement(12979..13044)
                     /note="Predicted helix-turn-helix motif with score
                     1436.000, SD 4.08 at aa 17-38, sequence
                     ASFTKAADNLSLSRLQVSRHVQ"
     CDS             13218..13856
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0014"
                     /old_locus_tag="TVA3102"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0014"
                     /protein_id="CDQ47911.1"
                     /translation="MKIAVLGASGWIGSHIVNEAKARGHEVIALVRDSSKVDAEGVSV
                     QLFDLQQPLSKISAALAGVDVVIASIGGRAAGNHDIVAATAQKLLSDLPQVGVDRLLW
                     VGGAGSLEVAPGIKLVTVEGFPEEYKGEALAQGEALDLFRASTSKVNWTFVSPAAEIF
                     PGEKQGAYRVGGDALLSDAEGNSKISVSDYALALIDELESAAHPRQRIGVAY"
     misc_feature    13224..13454
                     /note="HMMPfam hit to PF05368, NmrA, score 1.2e-08"
     CDS             13972..14694
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0015"
                     /old_locus_tag="TVA3101"
                     /product="membrane protein"
                     /note="user locus_tag: VANGcII0015"
                     /note="Predicted TransMembrane Helixes=8; Predicted by
                     Neural Nets: Inner Membrane with score 2.9; Integral
                     Prediction of protein location: membrane bound Periplasmic
                     with score 7.6"
                     /protein_id="CDQ47912.1"
                     /translation="MEMFSSTALIAMFLIFLGSFVQTAIGFGLAIVAAPLLFLISADY
                     VPAPICIVALFISILNALKHRSNIELGGLKMALIGRVPGSIAGGILLVLVSTDVLALW
                     LGLLVLFAVAVSLLPYRIEPTPIKMGIAGFFSGFFGTSSAIGGPPMALILQHQEANQL
                     RGNLSAFFVFSSIISLIIQIPAGFLTLHHLWITIPLIPSAWLGYKLAMMTTQSLPKDN
                     IRFAALLLCTISGVTAVWHGLA"
     misc_feature    13972..14040
                     /note="Signal peptide predicted for TVA3101 by SignalP 2.0
                     HMM (Signal peptide probability 0.990) with cleavage site
                     probability 0.337 between residues 23 and 24"
     misc_feature    13996..14676
                     /note="HMMPfam hit to PF01925, DUF81, score 1.8e-44"
     misc_feature    join(13999..14067,14086..14154,14197..14250,14263..14331,
                     14359..14427,14461..14529,14542..14595,14632..14688)
                     /note="8 probable transmembrane helices predicted for
                     TVA3101 by TMHMM2.0 at aa 10-32, 39-61, 76-93,
                     98-120,130-152, 164-186, 191-208 and 221-239"
     CDS             14768..15199
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0016"
                     /old_locus_tag="TVA3100"
                     /product="membrane protein"
                     /note="user locus_tag: VANGcII0016"
                     /note="Predicted TransMembrane Helixes=4, exp no AAs in
                     TMHs: >72; Predicted by Neural Nets: Inner Membrane with
                     score 3,0; Integral Prediction of protein location:
                     membrane bound Periplasmic with score 7,6"
                     /protein_id="CDQ47913.1"
                     /translation="MRTIGNIIWFLLGGVFMGLAWWFFGLLAFISIIGIPWGRACFVI
                     GNFSFFPFGQEAISRDELTNQQDIGTSPFGLIGNVIWFVFAGFWLAVGHILSAVACFI
                     TIIGIPFALQHLKLAVISLAPIGKTIVPKEEAARARYSSYR"
     misc_feature    14768..14851
                     /note="Signal peptide predicted for TVA3100 by SignalP 2.0
                     HMM (Signal peptide probability 0.765) with cleavage site
                     probability 0.731 between residues 28 and 29"
     misc_feature    14774..14944
                     /note="HMMPfam hit to PF03733, DUF307, score 2e-23"
     misc_feature    join(14786..14839,14849..14917,14978..15037,15047..15100)
                     /note="4 probable transmembrane helices predicted for
                     TVA3100 by TMHMM2.0 at aa 7-24, 28-50, 71-90 and 94-111"
     misc_feature    14990..15160
                     /note="HMMPfam hit to PF03733, DUF307, score 2.2e-31"
     misc_feature    15035..15067
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
     CDS             complement(15278..16144)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0017c"
                     /old_locus_tag="TVA3099"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0017c"
                     /protein_id="CDQ47914.1"
                     /translation="MAEKLSTSALAKLRNTDAKQLFSNLQKAGYINRFDNKWVLTELG
                     AKFGGEYAQHTQYGQFIVWPENLLVDTQATSGKTLSATQLGDHFRLNPKKINQLLSEL
                     GWISKTEKGWQVTEAGLRAGAQQREDKSSEQFFVVWHDTVTRHKRLKQSIVEFLGQEA
                     NNQSTDKSLSHFRQKFEAKHRTLDGHYVRSTGELLIDNWLYLAGVVHAYERQLPIEAD
                     VMCDFYLPTGKVYLQYWGSDNGATDEKTRLHTQAIYHDHGFALINIHPQDITHLDEIL
                     PRKLREFGIKAY"
     repeat_region   complement(16207..17718)
                     /rpt_family="IS91"
                     /note="ntCAAG + NB10_ISVa3 (complete: 1.508 bp); Accession
                     Number:AY255699"
     CDS             complement(16363..17610)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0018c"
                     /product="transposase ISVa3"
                     /note="user locus_tag: VANGcII0018c"
                     /note="IS91-family, transposase"
                     /protein_id="CDQ47915.1"
                     /translation="MVQYSGRRRRHHTLKEFVPRATKLLFEKDNAWEKVLWKHAQTFS
                     LWQITCVERMLACGTNMMGAKHYDCGTSNCPHTKVVCQSCKTKACSSCGTKSTEQWIH
                     TQLDVMPDCEHQHITFTMPSELWPIFEANPTLLNDLFSLAADTLLEWAKKHGLEVGIF
                     GALHTYGRALNWHPHIHLSVTRGGLDKHNTWKPIYFKKKHVEYHWRRTLIRLLRQKYD
                     DLNLSTSTTHHIQYYRQWNFFLERHYQRYWNIHFAKKTKVLKQTVNYLGRYLKRPPIS
                     ASRLRHYSGGTVVFKYLDHRDGTHKTKTLTQEEMILRYVSHIPQHHFKMVRYYGFLSN
                     RKRGRLLPLVYLALEKKSLEQAEPLTYAKQYKGFTGNDPYQCVLCGGRMEFTGFMKGP
                     KNDELLDSRRMSMREARRLSVAA"
     CDS             complement(17841..18248)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0019c"
                     /old_locus_tag="TVA2795"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0019c"
                     /protein_id="CDQ47916.1"
                     /translation="MIRSTAKSISILVLTATLQGCFQDDLERWLNRETYEFKGTYDNQ
                     FNDDLLIFEEGVVRAESETQHWSRAYSVDGNQLTIQLRNNSKEKREDIVLVIHGKGEV
                     LTCSVCAMYKLSNVWVKTGNVEAKPSGVENASQ"
     misc_feature    complement(18180..18248)
                     /note="Signal peptide predicted for TVA2795 by SignalP 2.0
                     HMM (Signal peptide probability 0.610) with cleavage site
                     probability 0.563 between residues 23 and 24"
     misc_feature    complement(18186..18218)
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
     CDS             complement(18245..18736)
                     /transl_table=11
                     /gene="ogt"
                     /locus_tag="VANGNB10_cII0020c"
                     /old_locus_tag="TVA2794"
                     /product="methylguanine-DNA-protein-cysteine
                     methyltransferase"
                     /note="user locus_tag: VANGcII0020c"
                     /protein_id="CDQ47917.1"
                     /translation="MNRFTHYHSPLGIMTLQACEQGLQGAWFETETTMPTELGVKSEQ
                     CTILINTIKQLDEYFSGKRTIFTLPLAAKGTEFQQSVWQALCKIPYGETWNYQQIAEA
                     IGNPKAVRAVGLANGRNPISIIVPCHRVIGKSGKLTGYAGGLNRKASLLELERTTTEV
                     AAT"
     misc_feature    complement(18260..18517)
                     /note="HMMPfam hit to PF01035, DNA_binding_1, score
                     4.7e-55"
     misc_feature    complement(18344..18364)
                     /note="PS00374 Methylated-DNA--protein-cysteine
                     methyltransferase active site."
     misc_feature    complement(18521..18736)
                     /note="HMMPfam hit to PF02870, Methyltransf_1N, score
                     0.00049"
     misc_feature    complement(18680..18712)
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
     CDS             complement(18738..20090)
                     /transl_table=11
                     /gene="ada"
                     /locus_tag="VANGNB10_cII0021c"
                     /old_locus_tag="TVA2793"
                     /product="Transcriptional regulator, Ada
                     family/DNA-3-methyladenine glycosylase II"
                     /EC_number="2.1.1.63"
                     /note="user locus_tag: VANGcII0021c"
                     /protein_id="CDQ47918.1"
                     /translation="MELDKEQCQQARTSRDPRFDGRFFVAVKTTNIFCRPICPAILPK
                     EKNVEYFANSALALQAGYRPCLRCRPDSAPHSWAWKGVETTFLRAIKLIEQGELQSSN
                     LAQFAERLGISDRYLRQLFQTHLGVSPKQYAQYHQLMFAKQLLHSSALSITDIGFACG
                     FNSTRRFNDAFIKTLQLTPSQVRQSKTALMTKNLLTLSFRGPFDWQHMLDFYRLRAVN
                     AIEQVGNNHYQRTFNIHNTTGWFRASLTSEAHLEVEFELQDITKLRYLVAKLRRLFDL
                     EADISHIEAYLEDCAPGLVTRSGIRIPGVWNCWEAGVRAILGQQVSIKAAIGQLNLLV
                     DAVNPAQNTNSYFPSPEQVAQLDLHFLKMPHSRKETLTRFAQFMCQHPEADVDAWLSL
                     KGIGPWTVNYAKLRGQSDSDCFLDTDLVVKKALSHFPELNADKVSPWGSYATFHCWNY
                     "
     misc_feature    complement(19020..19154)
                     /note="HMMPfam hit to PF00730, HhH-GPD, score 4.4e-05"
     misc_feature    complement(19170..19511)
                     /note="HMMPfam hit to PF06029, AlkA_N, score 1.5e-45"
     misc_feature    complement(19539..19673)
                     /note="HMMPfam hit to PF00165, HTH_AraC, score 2.1e-08"
     misc_feature    complement(19554..19682)
                     /note="PS00041 Bacterial regulatory proteins, araC family
                     signature."
     misc_feature    complement(19689..19829)
                     /note="HMMPfam hit to PF00165, HTH_AraC, score 4.7e-10"
     misc_feature    complement(19725..19790)
                     /note="Predicted helix-turn-helix motif with score
                     1769.000, SD 5.21 at aa 101-122, sequence
                     SNLAQFAERLGISDRYLRQLFQ"
     misc_feature    complement(19878..20075)
                     /note="HMMPfam hit to PF02805, Ada_Zn_binding, score
                     1.1e-39"
     CDS             complement(20269..21159)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0022c"
                     /old_locus_tag="TVA2792"
                     /product="transcriptional regulator, LysR family protein"
                     /note="user locus_tag: VANGcII0022c"
                     /protein_id="CDQ47919.1"
                     /translation="MDVKVFRTFLELAKVRHFGRAAENLYLTQAAVSARIKQLENYFD
                     AQLFTRDRNNIKLTSAGERLVGYAEVMVATLQQAKFELSLENGRALQLTLGGTPNVWD
                     AHLQNCLSVVTDAFSGYGFMAEVMGREQLNRSLLERTLDMAFAFDPIKAEELNCKKVA
                     DLVLVLVSTRPDTLETAFDNKYVYVDWGSRFASEHAERHPKTPTPYLRTSTARIALDF
                     ILEKGGSAYLPTSLVEPFIHSGQLYRIDNVEDWQRPIFLSYRKNSSSIEAIMQVEKLV
                     KNINPSSAYSLQQAGEVILD"
     misc_feature    complement(20317..20907)
                     /note="HMMPfam hit to PF03466, LysR_substrate, score
                     1.6e-05"
     misc_feature    complement(20974..21153)
                     /note="HMMPfam hit to PF00126, HTH_1, score 3.4e-17"
     misc_feature    complement(21019..21111)
                     /note="PS00044 Bacterial regulatory proteins, lysR family
                     signature."
     misc_feature    complement(21049..21114)
                     /note="Predicted helix-turn-helix motif with score
                     1128.000, SD 3.03 at aa 16-37, sequence
                     RHFGRAAENLYLTQAAVSARIK"
     CDS             21308..21667
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0023"
                     /old_locus_tag="TVA2791"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0023"
                     /protein_id="CDQ47920.1"
                     /translation="MSETEFRHGKKRFYDNTKFPRGFAKSGDFTLAEEELLAIYGGTM
                     LGLESGELTPENAEEAHFVKAIENPGKAKSKLERVWLKYTQLARGRKRFHTLNGRNKP
                     ESGDDYNDEEVSLTEED"
     misc_feature    21308..21640
                     /note="HMMPfam hit to PF04219, DUF413, score 1.4e-60"
     CDS             complement(21934..22185)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0024c"
                     /old_locus_tag="TVA2790"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0024c"
                     /protein_id="CDQ47921.1"
                     /translation="MKNELEPAKILHAYETVMAHGTPTEFGKIYEGIEAFSDYDGYNI
                     YMRGNGVELKVGFHNTYHLDYDQEHLRDSFLKKVAILAK"
     CDS             22497..23297
                     /transl_table=11
                     /gene="nagB"
                     /locus_tag="VANGNB10_cII0025"
                     /old_locus_tag="TVA2789"
                     /product="Glucosamine-6-phosphate
                     isomerases/6-phosphogluconolactonase (GlcNAC)"
                     /note="user locus_tag: VANGcII0025"
                     /note="Similar to Escherichia coli (strain K12) nagb
                     recname: full=glucosamine-6-phosphate deaminase
                     ec=3.5.99.6 altname: full=glucosamine-6-phosphate
                     isomerase altname: full=glcn6p deaminase short=gnpda
                     UniProt:P0A759 (EMBL:AF052007) (266 aa) fasta scores:
                     E()=5.8e-95, 80.1% id in 266 aa"
                     /protein_id="CDQ47922.1"
                     /translation="MRLIPLKQAAQVGKWAAAHIVKRINAFNPTADRPFVLGLPTGGT
                     PLTTYNALIEMHKAGEVSFKHVVTFNMDEYIGIPENHPESYRSFMYNNFFNHVDIQEE
                     NINLLNGNAPDVDAECKRYEDKIKSYGRINLFMGGVGNDGHIAFNEPASSLSSRTRIK
                     TLTEDTRIANSRFFDGDINQVPKYALTIGVGTLLDSEEIMILVTGHNKALALQAAVEG
                     SVNHLWTVSALQLHAKSVIVCDEPSTQELKVKTVKYFAELEAKNIEGF"
     misc_feature    22539..23246
                     /note="HMMPfam hit to PF01182, Glucosamine_iso, score
                     5.6e-185"
     misc_feature    22869..22925
                     /note="PS01161 Glucosamine/galactosamine-6-phosphate
                     isomerases signature."
     CDS             complement(23425..23691)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0026c"
                     /old_locus_tag="TVA2788"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0026c"
                     /protein_id="CDQ47923.1"
                     /translation="MHVDKTIVISETGTVNGELYAGHIIINGEFQGTCHATKIEILSK
                     GSVTGSIYSDDLSIEQGGRFNGVTYPAPEKQVVELKEAKIAAEG"
     misc_feature    complement(23470..23691)
                     /note="HMMPfam hit to PF04519, DUF583, score 2e-07"
     CDS             complement(23730..24677)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0027c"
                     /old_locus_tag="TVA2787"
                     /product="Putative peptidase, M23/M37-family"
                     /note="user locus_tag: VANGcII0027c"
                     /protein_id="CDQ47924.1"
                     /translation="MKERVVVSVSSIHGTKHFHLGKWFRHFLKGFGYVLVASILATGG
                     VIYYLLDEVDFAKLKQQELESQSMSLTEEVTSLKELKNSLENDLLEREEKMQVVSDRL
                     GDLEKVLGMDESGAELESRLDTAAITSSVRMVMLTQIPSGAPVHNARISSGYGERIHP
                     VTGNVKIHRGQDFAVNIGTPIYAPADGVAEVTRASDKGSGNFLRLQHSYGFTSSYSHL
                     QKFAVKGGDFVQKGDLIAYSGNSGLSSGPHLHYEIRFVGRSLDPRPFVDWGVNDFETI
                     FSKVRGIRWESLVNKVELRVSTQLQLSSQKAVPLVGNSG"
     misc_feature    complement(23892..24182)
                     /note="HMMPfam hit to PF01551, Peptidase_M23, score
                     5.2e-48"
     CDS             25317..27266
                     /transl_table=11
                     /gene="mtlA"
                     /locus_tag="VANGNB10_cII0028"
                     /old_locus_tag="TVA2786"
                     /product="PTS system, mannitol-specific EIICBA component"
                     /EC_number="2.7.1.-"
                     /note="user locus_tag: VANGcII0028"
                     /protein_id="CDQ47925.1"
                     /translation="MISPDAKIKIQNFGRFLSNMVMPNIGAFIAWGFITALFIPTGWL
                     PNETLASMVGPMITYLLPLLIGYTGGKLVGGERGAVVGAITTMGVIVGTDIPMFMGAM
                     MVGPMGGWAIKTFDQRVEGKVKSGFEMLVNNFSAGIIGMLGAILAFYLIGPFVKVLSG
                     GLAAGVNFLVSAHLLPLTSIFVEPAKILFLNNAINHGIFSPLGIQQASEMGQSIFFLI
                     EANPGPGLGILLAYMVFGKGTARQTAGGASIIHFFGGIHEIYFPYILMNPRLILAAIA
                     GGMTGVFILTLFNAGIVSPASPGSIFAVLLMTQKGSIVGVLCSIFGAAGVSFTVASLL
                     MKAQSSTEEEGDEAALEKATSQMKEMKSSAKGNVTTASQKSNIDLANVKSIIVACDAG
                     MGSSAMGASMLRKKIKDAGLAIHVTNLAINSLPENAEIVITHKDLTGRARTHAPSAQH
                     ISLSNFLDSEMYNQLVTKLLAAQRPKAANDSDVIKVSILAANDDSFEIQKPSVFQIQK
                     ENIHLGLNAANKEEAIRFAGNKLVELGYAEPEYVDAMFEREKMVSTYLGESIAVPHGT
                     VAAKDRVIKTGIVICQYPAGVQFTDDQDGVAKLVIGIAAKNDEHIQVITTITNALDEP
                     DAIEKLTSTRDVSDILAILSGNQAA"
     misc_feature    25368..26150
                     /note="HMMPfam hit to PF02378, PTS_EIIC, score 9.9e-23"
     misc_feature    join(25377..25445,25473..25541,25578..25646,25704..25772,
                     25791..25859,25956..26024,26043..26111,26124..26192,
                     26253..26321)
                     /note="9 probable transmembrane helices predicted for
                     TVA2786 by TMHMM2.0 at aa 21-43, 53-75, 88-110,
                     130-152,159-181, 214-236, 243-265, 270-292 and 313-335"
     misc_feature    26466..26729
                     /note="HMMPfam hit to PF02302, PTS_IIB, score 6.7e-22"
     misc_feature    26826..27254
                     /note="HMMPfam hit to PF00359, PTS_EIIA_2, score 3.5e-62"
     misc_feature    26961..27011
                     /note="PS00372 PTS EIIA domains phosphorylation site
                     signature 2."
     CDS             27383..28531
                     /transl_table=11
                     /gene="mtlD"
                     /locus_tag="VANGNB10_cII0029"
                     /old_locus_tag="TVA2785"
                     /product="mannitol-1-phosphate 5-dehydrogenase"
                     /EC_number="1.1.1.17"
                     /note="user locus_tag: VANGcII0029"
                     /note="Similar to Escherichia coli (strain K12) mtld
                     recname: full=mannitol-1-phosphate 5-dehydrogenase
                     ec=1.1.1.17 UniProt:P09424 (382 aa) fasta scores:
                     E()=1.9e-91, 63.4% id in 382 aa"
                     /protein_id="CDQ47926.1"
                     /translation="MKNAVHFGAGNIGRGFIGKLLADADIEVTFADVNEPLVDQLSHR
                     QEYKVKVVGSECKIDTVTHVTAVNSASNDVIDRIVKTDLVTTAVGPAVLDIIAKTIAK
                     GITKRFETGNEQPLNVIACENMVRGTTHLKGEVYKYLDPSLHAKTDELIGFVDSAVDR
                     IVPPVEAANDDPLAVTVESFSEWIVDEQQFKGEIPNIEGMEKTNNLMAFVERKLFTLN
                     TGHCITAYLGCLSGHKTIREAIEDPAIRQQVKQAMHESGEVLIRRYGFDRELHAAYIE
                     KILSRFANPYLVDEVDRVGRQPIRKLGPNDRLIKPLLGTIEYGVENKMLLKGIAAALK
                     YTNDSDPQAVELQTSLNQYGVCKTLAHYTGLDEQSEQVKQIEAIYKQL"
     misc_feature    27386..27754
                     /note="HMMPfam hit to PF01232, Mannitol_dh, score 3.3e-40"
     misc_feature    27827..28507
                     /note="HMMPfam hit to PF08125, Mannitol_dh_C, score
                     1.7e-89"
     misc_feature    27833..27871
                     /note="PS00974 Mannitol dehydrogenases signature."
     CDS             28593..29123
                     /transl_table=11
                     /gene="mtlR"
                     /locus_tag="VANGNB10_cII0030"
                     /old_locus_tag="TVA2784"
                     /product="Mannitol operon repressor (mannitol repressor
                     protein)"
                     /note="user locus_tag: VANGcII0030"
                     /protein_id="CDQ47927.1"
                     /translation="MADRINESDIIERLNSAHSVRGFFITTVEVFNEAIDALMQRIFR
                     KDNFAVQSVVGPLLQDSGPLGNLSVRLKLLFGLGVLPDDVYHDIEDIIKLRNQLNSDG
                     AEYEFTDPKILVPIKKLHLVAKMGMVQLEVLEPDGDIELDFYQLQLQRQQQIIKSGLS
                     LAIVEICNELNKESPF"
     misc_feature    28593..29108
                     /note="HMMPfam hit to PF05068, MtlR, score 8e-95"
     CDS             29226..30158
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0031"
                     /old_locus_tag="TVA2783"
                     /product="Oxidoreductase Gfo/Idh/MocA family protein"
                     /note="user locus_tag: VANGcII0031"
                     /protein_id="CDQ47928.1"
                     /translation="MMKIGIIGLGDIAQKAYLPVITQRPDLELVFCTRNPALVTQLAQ
                     RYRISENCTDYRELLGYNVDAVMIHAATSAHPQIAQFFLEHGIPTFVDKPLADSASAC
                     EMLYELAEKHRQPLYVGFNRRHIPLYNQHLNAVQTGNRNDLRSLRWEKHRYDLPGDVR
                     TFIFDDFIHPLDSVNVNAKATLDDAYITYQQHQGQLSRLDVQWQHGESLLHASMNRQF
                     GITAERVSASFVNEGFEFDSFTQGKRWHQGQEQALSLKDWTPMLTSKGFSAMIDDWIG
                     VINSGKLASEVVARNLASHQLAEALCHYIAKQIR"
     misc_feature    29229..29585
                     /note="HMMPfam hit to PF01408, GFO_IDH_MocA, score
                     1.1e-23"
     CDS             complement(30155..31594)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0032c"
                     /old_locus_tag="TVA2782"
                     /product="Na+/H+ antiporter NhaD-like; divalent ion
                     symporter"
                     /note="user locus_tag: VANGcII0032c"
                     /protein_id="CDQ47929.1"
                     /translation="MIPRRTWLLLFCTLLFPSVALASSNDIDSLDLTHSTIGYASLVI
                     FTLAYTLVMMEEYLKLRKSKPVLLAAGLIWAMIGYVYQQYELTEIAKNALEHNLLEYA
                     ELLLFLLVAMTYISAMEERRLFDALQAWMVGKGFDFRALFWITGLLAFFISPIADNLT
                     TALLMCAVVLKVAGNNPRFINIACINIVVAANAGGAFSPFGDITTLMVWQAGHVPFSQ
                     FLFLFLPSVSNYLVPALLMSFFLPKEKPTTLHEHVELKRGARRIVVLFMLTIATAVAF
                     HAVVRFPPVIGMMMGLAYLQFFGYFLRKTLPTSLAKKTVIAIANNDEAALKRIGSVVP
                     FDVFKRVSHAEWDTLLFFYGVVMCVGGLSLLGYLGLISEVMYSQWNPIWANVMIGFLS
                     AIVDNIPVMFAVLTMEPDMSTGNWLLVTLTAGVGGSLLSIGSAAGVALMGAAHGKYTF
                     VGHLKWTPIIATGYAASIGVHLLLNHALF"
     misc_feature    complement(join(30161..30220,30278..30346,30380..30439,
                     30482..30550,30689..30742,30755..30811,30872..30940,
                     30968..31036,31055..31114,31127..31183,31244..31303,
                     31346..31399,31436..31495,31523..31576))
                     /note="14 probable transmembrane helices predicted for
                     TVA2782 by TMHMM2.0 at aa 7-24, 34-53, 66-83,
                     98-117,138-156, 161-180, 187-209, 219-241, 262-280,
                     285-302,349-371, 386-405, 417-439 and 459-478"
     misc_feature    complement(30314..31462)
                     /note="HMMPfam hit to PF03600, CitMHS, score 5.8e-25"
     misc_feature    complement(31529..31594)
                     /note="Signal peptide predicted for TVA2782 by SignalP 2.0
                     HMM (Signal peptide probability 1.000) with cleavage site
                     probability 0.998 between residues 22 and 23"
     CDS             complement(31773..33077)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0033c"
                     /old_locus_tag="TVA2781"
                     /product="sodium/dicarboxylate symporter"
                     /note="user locus_tag: VANGcII0033c"
                     /protein_id="CDQ47930.1"
                     /translation="MNTKKPMSLTGRVILGMVAGILTGFAIRALFAENGFVDAYIVNG
                     LFDVGGKIFIASLKMLVVPLVFVSLVCGTSSLKDLTTLGRMGGKTLAFYIATTAIAIT
                     LALTMGTVFQPGSGADLTAASSFQSAQAPSLGQVFIDMFPTNPISAMAEGKTLQVIVF
                     AVLFGIAISAAGKPGERIAGVFNDLNEVIMKLVALLMNLAPYGVFFLMAKLFTSLGLS
                     AILNLAEYFVVLTVTLLLHGFVTYSLMLKGFTGLSPITFFRKMEDAIMFAFSTASSNA
                     TIPVTMETAKNRLGVDNKIASFTIPLGATVNMDGTAIMQGVATAFIAQAFNIDLTMGD
                     YVMVILTATLASVGTAGVPGVGLVMLAMVLNQVGLPLEGIALIMGVDRLLDMIRTAVN
                     ITGDSCVTLIVAKTEGALDEARFNDPQAGVKEEEVHLAKAQA"
     misc_feature    complement(31860..33053)
                     /note="HMMPfam hit to PF00375, SDF, score 2.5e-121"
     misc_feature    complement(join(32007..32075,32340..32408,32451..32504,
                     32565..32618,32742..32810,32868..32924,32982..33041))
                     /note="7 probable transmembrane helices predicted for
                     TVA2781 by TMHMM2.0 at aa 13-32, 52-70, 90-112,
                     154-171,192-209, 224-246 and 335-357"
     misc_feature    complement(32982..33077)
                     /note="Signal peptide predicted for TVA2781 by SignalP 2.0
                     HMM (Signal peptide probability 0.990) with cleavage site
                     probability 0.982 between residues 32 and 33"
     CDS             complement(33560..34003)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0034c"
                     /old_locus_tag="TVA2780"
                     /product="Putative uncharacterized DoxX family protein"
                     /note="user locus_tag: VANGcII0034c"
                     /protein_id="CDQ47931.1"
                     /translation="MKALLKQLTTSTSGFSALALRFPIGIIFMAHGAQKLFGWFGGYG
                     LEGTGQWMASIGLNPGVLMAFLAGSGEFFGGLFILLGLLTRPAALLLSITMIVAIASV
                     HLGNGLFMANNGYEFGLALLAASVSLVFSGAGKLALDNWLNKKLA"
     misc_feature    complement(join(33590..33658,33671..33739,33758..33826,
                     33902..33970))
                     /note="4 probable transmembrane helices predicted for
                     TVA2780 by TMHMM2.0 at aa 12-34, 60-82, 89-111 and
                     116-138"
     misc_feature    complement(33692..33958)
                     /note="HMMPfam hit to PF07681, DoxX, score 1.3e-36"
     misc_feature    complement(33908..34003)
                     /note="Signal peptide predicted for TVA2780 by SignalP 2.0
                     HMM (Signal peptide probability 0.972) with cleavage site
                     probability 0.958 between residues 32 and 33"
     CDS             35182..35838
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0035"
                     /old_locus_tag="TVA2779"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0035"
                     /note="Similar to Vibrio vulnificus (strain YJ016)
                     subname: full=putative uncharacterized protein vva0518
                     UniProt:Q7MF02 (EMBL:BA000038) (222 aa) fasta scores:
                     E()=4.6e-31, 39.4% id in 216 aa, and to Vibrio cholerae
                     serotype O1 (strain ATCC 39541/Ogawa 395/O395) subname:
                     full=putative uncharacterized protein UniProt:A5F1F4
                     (EMBL:CP000626) (232 aa) fasta scores: E()=1.4e-28, 37.0%
                     id in 219 aa"
                     /protein_id="CDQ47932.1"
                     /translation="MTILLLVIFGLIVGKYYISHSSLTLVPAPKAPNNNEDTDFKAAT
                     VADERQLMKPPREDASSAGDARSALNSEPITEERMLAAQTVDEVWHDINPSPALQAIR
                     PKSDAVTEIKAIEIENIEQFRVLATGDAVTVTMPDNQPVNIQVTSSEIQNEGVRTWSG
                     QFELDGEVYPATFTFGKTAILGFIGHPSGQVKLEGNGSEAWVYRVPPNHGYDETSTSH
                     "
     misc_feature    35692..35715
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
     CDS             35894..37129
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0036"
                     /old_locus_tag="TVA2778"
                     /product="P-proprotein convertase-/galactose-binding
                     domain-like protein"
                     /note="user locus_tag: VANGcII0036"
                     /protein_id="CDQ47933.1"
                     /translation="MKIASLALAVVLATHALPSSATTEIDILGVYTPGTAEWFQQDHV
                     AQIQHRFNVGNEILRQSGLDIKVNLIGTKEVKYDTQRGLKKSQEQALDAITPGNKQDP
                     AFADIEQYRKQVGADMVALFRNLDIKNSPDYEDKGNGTYMLSCGLAWIIPAAYWNNSA
                     RYAQSRMYSHSYLNECGDDTFIHELGHNLGLNHAHEQYNGEPHLSNGTEQDAYGYGVQ
                     GQFATTMAYGFLFGIHSRSYTFSNPSKVCKGQACGVTDYANSVRAIGLSAPHIAAIYA
                     RPDGSNDGGTSPTEPTSPQQAIYDLQGPFAIPDHAQGELALPINVTYQGNAETATIQL
                     DIEHPFVGDVSVKLYAPDGGYWNLKSYNQYDRNTAYRVRFTLSGMQQMNVQGQWRLVV
                     ADHYQGLTGVLNSARLSFE"
     misc_feature    35894..35956
                     /note="Signal peptide predicted for TVA2778 by SignalP 2.0
                     HMM (Signal peptide probability 1.000) with cleavage site
                     probability 0.974 between residues 21 and 22"
     misc_feature    36431..36460
                     /note="PS00142 Neutral zinc metallopeptidases,
                     zinc-binding region signature."
     misc_feature    36872..37126
                     /note="HMMPfam hit to PF01483, P_proprotein, score
                     2.4e-13"
     misc_feature    37025..37066
                     /note="PS00213 Lipocalin signature."
     CDS             complement(37176..38210)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0037c"
                     /old_locus_tag="TVA2777"
                     /product="Uncharacterized membrane protein"
                     /note="user locus_tag: VANGcII0037c"
                     /protein_id="CDQ47934.1"
                     /translation="MRLWDHPLSENDFRQCVRIATGATLGFTFCKLLGWNYGVFFTVT
                     PMLLLGMVPVMNAHAAKQLLASAVVCGLEVAILGGLFGAHPALMTMIAFVLFLYKFAC
                     MSKGSLFLFGANSVLSLSIMLHFASYPTTDLNDLITSNFIANLLSVMVAYLVTFCIPD
                     AQKRQPPAHASVAKESHRMRHEALMGATIATLSFVVFQIFDLQDSMSAQATTLLLLFP
                     MHWNGALGYARKRAMGTLLGVTFGITVQLLLYDWSGQLLFVIPLLWIGAMLFSYWHVK
                     ESSGSGVGFGSLTTLGILFGQYLTPGNDLIFSALYRVGSILFAIVATLLTTYVIHRLL
                     NQFKATQFGQ"
     misc_feature    complement(join(37218..37286,37314..37373,37392..37451,
                     37461..37514,37527..37595,37605..37664,37737..37805,
                     37833..37901,37920..37988,38046..38114))
                     /note="10 probable transmembrane helices predicted for
                     TVA2777 by TMHMM2.0 at aa 33-55, 75-97, 104-126,
                     136-158,183-202, 206-228, 233-250, 254-273, 280-299 and
                     309-331"
     CDS             complement(38223..39278)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0038c"
                     /old_locus_tag="TVA2776"
                     /product="Secretion protein, HlyD family"
                     /note="user locus_tag: VANGcII0038c"
                     /protein_id="CDQ47935.1"
                     /translation="MTPDQKFALWIKYSIVAFVALFAYFLVADLAMPLTPQAMATRTV
                     TKISPRVNGQISDVFVTNNQTVHKGEVLFTIDPQPYQLAVEQAQLNYERAVQGNAQLD
                     ASIAAAEANVTASRIVADQKLREANRLNTLFARNGTSQQLKDDAQSGATAAKANLVAA
                     QAHLQELHVSRGNSDESNVSIRAALNQLAQAKLNLAYTQTLAEQDGVITNLQLETGTY
                     AAAGMPLVALVATDVDVIADFREKSLRHLPDNSLALVAFDSKPGEVFTARIRSLDAGV
                     STGQFDANGRLATPTESNRWVRDAQRMRVHLSLDETMPTLPSGARATVQLLPESGPFA
                     WLAKMQIQFLSTLHYIY"
     misc_feature    complement(38538..39152)
                     /note="HMMPfam hit to PF00529, HlyD, score 5.7e-15"
     misc_feature    complement(39192..39260)
                     /note="1 probable transmembrane helix predicted for
                     TVA2776 by TMHMM2.0 at aa 7-29"
     CDS             complement(39285..39767)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0039c"
                     /old_locus_tag="TVA2775"
                     /product="putative transcription regulator, MarR family"
                     /note="user locus_tag: VANGcII0039c"
                     /protein_id="CDQ47936.1"
                     /translation="MIENTHTLKELSLAEQFARLSRLWKMVADRELSPLGLTHPRWTA
                     LWKLQRLGDNVSQKTLAEALEIELASLMRTLKQLEEQSLIERHCCHNDKRARIVNLTS
                     NGRALIKQMETRILQVRQNLLGNIDDQQLYQLTLTLEQISHNALDTLSKPIATPSKEQ
                     "
     misc_feature    complement(39447..39659)
                     /note="HMMPfam hit to PF01047, MarR, score 3.1e-16"
     misc_feature    complement(39456..39560)
                     /note="PS01117 Bacterial regulatory proteins, marR family
                     signature."
     CDS             39920..40909
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0040"
                     /old_locus_tag="TVA2774"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0040"
                     /protein_id="CDQ47937.1"
                     /translation="MFEAVLAAEILVHIMIIENKLDYLFSLSELSETIYPNTKGWSKI
                     RKNIRFCLWGVTNAYALKSMLRLFSCSELAEVLKQCPQFLEKPLKPYLCVNWSAKERT
                     WHINQHFIYLVEQFGFNAAKFFSESGFSIFDFYDKNGASYSLSLCSGEIREGSLGLQL
                     TDEKGQKIYSISFNVSDQGRSIYIGSLQGPSSGVTDRNQIIKDLTRTTHGLRTKALMV
                     EMIMTLARILGVENLYAISNRGHMYQALRYIGSKRKSVSFDYDELWTEYEAEKMSKYL
                     YRLPTTPNRKGVETLNRNKRRLYTKRYEWLAEVETAMSGRIEQLKLMPKHFVV"
     misc_feature    40019..40870
                     /note="HMMPfam hit to PF04393, DUF535, score 8e-75"
     CDS             complement(40943..41701)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0041c"
                     /old_locus_tag="TVA2773"
                     /product="Putative signalling protein, diguanylate
                     phosphodiesterase (EAL)"
                     /note="user locus_tag: VANGcII0041c"
                     /protein_id="CDQ47938.1"
                     /translation="MQQQQVHMDQRICQQCSEKQSLPFDFTMAFQPIVNVADNTIFGY
                     EALVRGLNNESAYSIIEQVSDDNRYRFDQLCRIKAIKLAAKLKLSGILSINFLPNAVY
                     QPERCIRTTLEAAKQFGFPTERIMFEFTEVEKIVDTAHIKRIVAYYSNLGFTTAIDDF
                     GAGYAGLGLLVNFQTKIVKLDMSLLRNIDQDITKQAIVRHTVAMLIELGIRPLAEGIE
                     TQQEMLWLKRLGIELMQGYYFAKPEFEALPTVTF"
     misc_feature    complement(40976..41428)
                     /note="HMMPfam hit to PF00563, EAL, score 3.2e-42"
     CDS             complement(41800..43353)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0042c"
                     /old_locus_tag="TVA2772"
                     /product="DNA photolyase (Deoxyribodipyrimidine
                     photolyase-related protein)"
                     /note="user locus_tag: VANGcII0042c"
                     /protein_id="CDQ47939.1"
                     /translation="MQTYKTLRLILGDQLNIKHSWFNKTDDSVLYVIAELKQETGYVK
                     HHIQKICAFFAAMEAFAELLQSEGHQVLYLTLDETADYLQLPPLISDLCHQINAEYFH
                     YQRPDEYRVWQQLQELNLSHTQVTCFDTEHFLLPFNEITQHFNTNKTTIMEPFYRKMR
                     KRFGILLQDDHQTPLGGRWNFDHQNRNKLSVQDIENLPKPLSFQNDVSAIYNRLQHHN
                     IHVFGLYTPSLLWPINRSQALSLLAHFCQYGLPLFGRFQDAMTAKSPHRWSLYHSRLS
                     FALNCKLLSPAEVIQSALMRFENDNTMDLAQIEGFIRQILGWREYIRGIYWANMPQYA
                     KHNALDAQRPLPHYYWTGDTRMHCVKQAVTQSLEFSYAHHIQRLMITGNFALLSGCEP
                     DEVDDWYLGIYIDALQWVEMPNTRGMALFADGGIVATKPYAASGSYINKMSDYCKDCH
                     YQVKSRSGLNSCPFNSLYWQFMLTHRERLAKNPRIGMIYKNWDNTENATQQAILDQAQ
                     YYLHHIEEL"
     misc_feature    complement(42184..42216)
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
     misc_feature    complement(42661..43347)
                     /note="HMMPfam hit to PF04244, DPRP, score 4.6e-74"
     CDS             complement(43509..43883)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0043c"
                     /old_locus_tag="TVA2771"
                     /product="Putative rhodanese-related sulfurtransferase"
                     /note="user locus_tag: VANGcII0043c"
                     /protein_id="CDQ47940.1"
                     /translation="MLKSLMTKALLCVGLISNTSDALASERSTIAWQWIENGALLVDV
                     RTAAEFAAGHIEGALNYPLDTVSSAFSHIDKQQPIVVYCRSGNRSGQAMAYLLDQGFT
                     QVHNGGGLEEMIIHPSAIKPLN"
     misc_feature    complement(43536..43802)
                     /note="HMMPfam hit to PF00581, Rhodanese, score 3e-09"
     misc_feature    complement(43812..43883)
                     /note="Signal peptide predicted for TVA2771 by SignalP 2.0
                     HMM (Signal peptide probability 0.986) with cleavage site
                     probability 0.934 between residues 24 and 25"
     CDS             complement(43934..45031)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0044c"
                     /old_locus_tag="TVA2770"
                     /product="ABC-2 type transporter"
                     /note="user locus_tag: VANGcII0044c"
                     /protein_id="CDQ47941.1"
                     /translation="MKALFRMKAVMVKEIRQLSRDRITFGMVVMIPLIQLLLFGFAIN
                     TDVRNIPIAIVDQSESTLGRLIVESVKATQVVSVKHTFATAEQAEHAIEQGNVRAALI
                     LPKDLTQRAVQKRVLGQWIVDGSDTMISASILGLQSMPLTDFDFDIRPATVKTFEVTL
                     FYNPTRRSAVNIVPGLLGVILTMTMILFTSAAIVREKERGNLELLITTPIHSIELMVA
                     KIVPYIFVGLIQVFIILGLGHFIFDVPINGAISQILFGTLLFIAASLTLGLVISTIAS
                     TQLQAMQMTVFILLPSILLSGFMFPYEGMPVAAQWISEALPATHFMRMIRGIVLRGAN
                     LMDLWRDALWMLSFTVGGIIVASLRFKKSLD"
     misc_feature    complement(join(43952..44008,44108..44176,44210..44278,
                     44306..44374,44450..44518,44903..44971))
                     /note="6 probable transmembrane helices predicted for
                     TVA2770 by TMHMM2.0 at aa 21-43, 172-194, 220-242,
                     252-274,286-308 and 342-360"
     misc_feature    complement(44042..44548)
                     /note="HMMPfam hit to PF01061, ABC2_membrane, score
                     1.3e-36"
     CDS             complement(45028..45954)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0045c"
                     /old_locus_tag="TVA2769"
                     /product="Putative ATP-binding component of a transport
                     system"
                     /note="user locus_tag: VANGcII0045c"
                     /protein_id="CDQ47942.1"
                     /translation="MTELAIHARNVVKRFGDFTAIEGINLSVPKGTIYGFLGPNGCGK
                     STTIRVLTGLLSPTSGSVDVLGLAIPKQSEQLRLKIGYMTQKFSLYDDLTVEENLQFI
                     GQIFGMPRKALAQRLNEQLCTYGLDQRRKQRVSGMSGGQKQRLSLAAATMHKPELLFL
                     DEPTSAVDPENRREFWEQLFDLSDQGTTILITTHYMDEAERCHRLAIMESGLIRADGE
                     PETLMNTMGVNIVEVRAHNLRQLKEKVMARAEVRSAAQLGIRLRILIHQQVTQPIAWL
                     KTTFPELAEAEMNLARPSLEDVFVTVTGKGRQ"
     misc_feature    complement(45322..45864)
                     /note="HMMPfam hit to PF00005, ABC_tran, score 6.4e-59"
     misc_feature    complement(45502..45546)
                     /note="PS00211 ABC transporters family signature."
     misc_feature    complement(45601..45666)
                     /note="Predicted helix-turn-helix motif with score
                     1081.000, SD 2.87 at aa 97-118, sequence
                     ENLQFIGQIFGMPRKALAQRLN"
     misc_feature    complement(45820..45843)
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
     CDS             complement(45954..46916)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0046c"
                     /old_locus_tag="TVA2768"
                     /product="putative HlyD family secretion protein"
                     /note="user locus_tag: VANGcII0046c"
                     /protein_id="CDQ47943.1"
                     /translation="MSMKHRIAFISLLLSTLNACSPENSAQALGTLERDRITFSATAN
                     EIIRALPVAEGSAVHAGEVLVRLDTRNQQAVLAHALAEAAKAQAYLLKLSNGERQEDT
                     AAAQAKVNRAQAKLTEALQNFKRVEELVGKKLLSQSEKDSATATRDAARAELDSAKEE
                     FAKLTAGTRPEDIEQAQAALTAAKADVSLQQQKLDELTIVATRDGILDNLPYNLGERV
                     PNNGIVAIIQASRIPYARVYVPAPHRLAVVPGAQFPVHIDGIKEPLQGTVRWVATEPS
                     FTPYYALTENERARLMYLAEVDLPESAQSLPSGIPAQVDLARQK"
     misc_feature    complement(46302..46814)
                     /note="HMMPfam hit to PF00529, HlyD, score 6.6e-05"
     misc_feature    complement(46842..46916)
                     /note="Signal peptide predicted for TVA2768 by SignalP 2.0
                     HMM (Signal peptide probability 0.992) with cleavage site
                     probability 0.620 between residues 25 and 26"
     CDS             complement(47008..47607)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0047c"
                     /old_locus_tag="TVA2767"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0047c"
                     /protein_id="CDQ47944.1"
                     /translation="MIWSEYLADKGIASDPDFVAQDRLIMSRYASGEMDMEDYLDFAM
                     QPLLTLPTEQVQRLADDCVATRIVPRLFPQAKALIKQLTDERIQMLIISASVSFLVKA
                     VARKIGVAEAMGIDMVIENNHYTTHILGTPTYRDGKVTRLNEWLAKRPQYVGQVHFFT
                     DSINDLPLCLHADFTYLVNPCTRLIQYAQPQQWPILKWG"
     CDS             complement(47672..48721)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0048c"
                     /old_locus_tag="TVA2766"
                     /product="ABC transport system, ATP-binding protein"
                     /note="user locus_tag: VANGcII0048c"
                     /protein_id="CDQ47945.1"
                     /translation="MNSTTHTTSRSDYVHVANLTKRFGNNTVFEGIEFSIEQGEFVTL
                     LGPSGCGKSTLLRSLAGLNPVDDGEIWVNGENITNQTPQQRGIGMVFQSYALFPNMTV
                     AENIAFGLKMQGQDRAYIAREVQKVVELVSLIGKEKHYPNQLSGGQRQRVALARALVV
                     KPRILLLDEPLSALDVKIRKHLRQQIRDIQKELNLTTVFVTHDQEEAMILSDRIFLMH
                     QGEIVQQGSPESIYTQPANEFVAGFMGHYNLVEAATAKQLFNIDTAWKVAIRPESIYV
                     KEAGRSYGAHVSAPQHGTIKHHQLLGNVIRYHVDVRGCELTVDLLNRSSERLFATGSQ
                     LELLFNLNEIQPVRA"
     misc_feature    complement(47681..47923)
                     /note="HMMPfam hit to PF08402, TOBE_2, score 8.3e-06"
     misc_feature    complement(48062..48607)
                     /note="HMMPfam hit to PF00005, ABC_tran, score 3.9e-67"
     misc_feature    complement(48248..48292)
                     /note="PS00211 ABC transporters family signature."
     misc_feature    complement(48563..48586)
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
     CDS             complement(48718..49521)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0049c"
                     /old_locus_tag="TVA2765"
                     /product="binding-protein-dependent transport system,
                     inner membrane component"
                     /note="user locus_tag: VANGcII0049c"
                     /protein_id="CDQ47946.1"
                     /translation="MQNANPTLDKITFHKSVVYSIVGVMLLPILATLVYSFSSRWGAT
                     ILPDGFTFDWYLKLLTDPRFLDAFGRSLLIGIASLILSAVLIIPAIFVVFYYFPRLDK
                     VMNLLILIPFAVPPVVSSVGLLQLYADSQFPIVGTPWILIGTYFTIALPFMYRAIANS
                     FEAIHLHDLMDAAHLLGASTSRAFLLIVLPNIRKGLMASLFLSFSFLLGEFVFANILV
                     GTRYETLQIYLYNMRQTSGHFTSALVMTYFLFIFLLTWLASRFSRGSTQ"
     misc_feature    complement(48721..49320)
                     /note="HMMPfam hit to PF00528, BPD_transp_1, score
                     4.1e-11"
     misc_feature    complement(join(48745..48813,48856..48924,49060..49128,
                     49138..49206,49240..49308,49405..49473))
                     /note="6 probable transmembrane helices predicted for
                     TVA2765 by TMHMM2.0 at aa 17-39, 72-94, 106-128,
                     132-154,200-222 and 237-259"
     CDS             complement(49508..50410)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0050c"
                     /old_locus_tag="TVA2764"
                     /product="Binding-protein-dependent transport system,
                     inner membrane component"
                     /note="user locus_tag: VANGcII0050c"
                     /protein_id="CDQ47947.1"
                     /translation="MISSQVISKPSAVLSQSTHWARKLKPALWLTPFALFFYLFQLAP
                     MLWVLFNSFISDDQWSLDHYREIFSSSFILQGLGNSLWLAIWSSVAGLAIAAILVASL
                     RRVDGKLRDGVIAFTNMSSNFAGVPLAFAFIIILGVNGALTLLLKQYGLIEEFNLYGK
                     WGLLAMYIYFQIPLGVLLLYPAFDALSDDWQAAASTLGANGWQYWQKIALPVLSPALL
                     GTLIILIANAMGAYASVYALTSGNYNVITVRIASLVAGDLFLEPNLAAAISVVLMLIL
                     AFITVINQWLIAKSYSARNTHAKR"
     misc_feature    complement(49535..50182)
                     /note="HMMPfam hit to PF00528, BPD_transp_1, score 0.0089"
     misc_feature    complement(join(49550..49618,49721..49789,49850..49918,
                     49976..50044,50105..50173,50261..50329))
                     /note="6 probable transmembrane helices predicted for
                     TVA2764 by TMHMM2.0 at aa 28-50, 80-102, 123-145,
                     165-187,208-230 and 265-287"
     CDS             complement(50407..51210)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0051c"
                     /old_locus_tag="TVA2763"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0051c"
                     /protein_id="CDQ47948.1"
                     /translation="MNNKVILVVLDGLNYSVARDCMGYLNGLIEQQRATLYSLQCELP
                     SLSRPLYECLLTGVKPVESGIVHNHIVRLSHHQSIFSLAKEQGLTTAAAAYHWVSELY
                     NRAPFDATRDRFTCDKTLNIQHGCFYHWDHYPDEALFLDAEHLRRTHQPDFLLIHPMN
                     IDDAGHKFGLDSGQYRNSARMADALLSHFLESWLNDGYQVMVTSDHGMNNDKSHGGIL
                     TEERNVPLFVLGDQFSHQACEIKQTELCGLCCQLLNLDHNKPFSAECLA"
     misc_feature    complement(50587..50760)
                     /note="HMMPfam hit to PF01663, Phosphodiest, score
                     1.2e-07"
     CDS             complement(51220..52281)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0052c"
                     /old_locus_tag="TVA2762"
                     /product="putative exported protein"
                     /note="user locus_tag: VANGcII0052c"
                     /protein_id="CDQ47949.1"
                     /translation="MKILFTRATTATALALTLSTSAFAKEADLQSLINAAKQEGQVYS
                     IGMPGSWANWQDTWSDLGKIYGLKHQDTDMSSAQEIAKFEAEKKNATADIGDVGFAFA
                     RVAVKKGVTQAYKPSTWNDIPDWAKDKDGHWALAYTGTISFISNNNLVKNAPKTWNDL
                     LKGDYKISIGNVGVAAQANNAVLAAAFAHGGSEKNLDPAIEFFAKLAKQGRLSFTDPS
                     IANLEKGEVEVAVLWDFNALSYRDQIDRNRFTVNIPQDGSVISGYTTIINKYAKNPNA
                     AKLAREYIFSDQGQINLAQGYARPIRSNVALPAAVQSKLIANDQYQNVSPISDFNAWE
                     KSARQLPRQWQENVIIHQQ"
     misc_feature    complement(52210..52281)
                     /note="Signal peptide predicted for TVA2762 by SignalP 2.0
                     HMM (Signal peptide probability 1.000) with cleavage site
                     probability 0.999 between residues 24 and 25"
     CDS             52494..53246
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0053"
                     /old_locus_tag="TVA2761"
                     /product="putative transcriptional regulator, GntR family"
                     /note="user locus_tag: VANGcII0053"
                     /protein_id="CDQ47950.1"
                     /translation="MRFRSPLPVANASLEKTQLGNIKGTLREQICSGMLSDRQKLPSE
                     RELSELFNTTRITIKDALVSLETEGLIYREERRGWFVSPARIHYNPLSRCHFHQMIRE
                     QHRIAETKLVAVRSVMASREYARAMDIDRITPIHIIERLRSIDGRAVLFVENCLIAQW
                     FPKILEENLTASLTHLYQQKYGYITTRSRFEVIPTAAPLHVAKALNLAAGQSVMKICR
                     VNYKQDGEIMDCEFEYWRPDSVLIRIDSCDGE"
     misc_feature    52545..52736
                     /note="HMMPfam hit to PF00392, GntR, score 7.3e-16"
     misc_feature    52614..52688
                     /note="PS00043 Bacterial regulatory proteins, gntR family
                     signature."
     misc_feature    52797..53216
                     /note="HMMPfam hit to PF07702, UTRA, score 4.5e-32"
     CDS             53292..54518
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0054"
                     /old_locus_tag="TVA2760"
                     /product="ATP-dependent RNA helicase, DEAD box family"
                     /note="user locus_tag: VANGcII0054"
                     /protein_id="CDQ47951.1"
                     /translation="MNFSKLNLSAPLMAALPASRHTATKIQQLAIPAVLSGQDVLAFA
                     QTGSGKTLAYGLPLLQRIEVNTLEIQSVVIVPTRELAQQVSQELSTVASKMGISLCTL
                     CGGVAQEEQLAQLAKLPHLIVATPGRLLDLLTQQLISLESMHCVVLDEADRLLEMGFW
                     PDVQRLLSFMPQTKQTLLFSATLAADLEQVALAVLNNPVKIEANQANQVVEEIEEQLY
                     LVNKGSKAQALIALIKQRAGQQVLVFISARDSADAVAKKLLKAGIRAAALHGEKDQVI
                     REKTLADFKANQVDVLVATDLLARGIHIDALPVVINFDLPPSAPVYIHRVGRTARAGQ
                     GGVAISLVCHGESQALEAIRSLTQRALPLQALTDFPVTDQPTSGEPKRKPRDKQANRR
                     SAQKRSVKQFQQKTSH"
     misc_feature    53292..53357
                     /note="Signal peptide predicted for TVA2760 by SignalP 2.0
                     HMM (Signal peptide probability 0.997) with cleavage site
                     probability 0.983 between residues 22 and 23"
     misc_feature    53361..53861
                     /note="HMMPfam hit to PF00270, DEAD, score 2e-60"
     misc_feature    53421..53444
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
     misc_feature    53730..53756
                     /note="PS00039 DEAD-box subfamily ATP-dependent helicases
                     signature."
     misc_feature    54060..54290
                     /note="HMMPfam hit to PF00271, Helicase_C, score 4.6e-31"
     CDS             54965..56200
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0055"
                     /old_locus_tag="TVA2759"
                     /product="endoribonuclease l-psp"
                     /note="user locus_tag: VANGcII0055"
                     /protein_id="CDQ47952.1"
                     /translation="MAADIVKVSRNTENAPICAVSTQTVAFSHYNNISAQLPIDPKTG
                     EIVIGCINDQTKQCLNNIQSIVESIGHVMDDVVKMNIFVKNISDIDAIKKVYPTFFQG
                     PLPTVTIAAVAALPVSDALVQIDALISNGEGTAPQAPCELIKVSRNTEHAPQGLYSQT
                     AAFSHYNNLSAQLPIEPKTGEIVQGGIKEQSQQCLNNINAILESIGHTMADIVKTTIF
                     LKNISDAEAINEVCGQFFPSYVPARSLVSVADLPMNALVQIDVVVSHGDGTPPQLPED
                     ARLLVIEANNTVNAPEVDYSHSVAFSHYNHISGQLPLSPKNNEVVAGGIKEQVKQCLE
                     NIKNIVESVEHVMDDIVKVNIQIKNMDDINIVNDVYTTFFNHELPARTVIGVSELPMD
                     ALIQIDAVVSNCEGTPPKH"
     misc_feature    54998..55354
                     /note="HMMPfam hit to PF01042, Ribonuc_L-PSP, score
                     3.4e-19"
     misc_feature    55409..55759
                     /note="HMMPfam hit to PF01042, Ribonuc_L-PSP, score
                     4.7e-32"
     misc_feature    55823..56173
                     /note="HMMPfam hit to PF01042, Ribonuc_L-PSP, score
                     4.1e-32"
     CDS             complement(56330..56986)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0056c"
                     /old_locus_tag="TVA2758"
                     /product="Putative haloacid dehalogenase/epoxide hydrolase
                     family protein"
                     /note="user locus_tag: VANGcII0056c"
                     /protein_id="CDQ47953.1"
                     /translation="MKFQAAIFDMDGLLLDTERVCLTIFEQACHVVGVPFLKEVYLSA
                     IGRNAAGIEQALRAGYGPELDYPVLHTEWRKRYDAVVKHQAIPVKEGVIELLQWLKAN
                     RIPTAVATSTQKDVAQIKLRLSGLEQYFDSFTTGCEVTHGKPDPEIYLLAAQRLGAEP
                     TQCLAFEDSNNGVRSAVSANMITYQIPDLVEPSEEVLALGHQVVPSLHHVLTALKNSN
                     "
     misc_feature    complement(56420..56980)
                     /note="HMMPfam hit to PF00702, Hydrolase, score 3e-35"
     CDS             57176..58939
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0057"
                     /old_locus_tag="TVA2757"
                     /product="sulphate transporter family protein"
                     /note="user locus_tag: VANGcII0057"
                     /protein_id="CDQ47954.1"
                     /translation="MNSAFVQQWMPGLHQLKDYETRWLMDDVRAALSVVAVALPVAIA
                     YAQLTGVSAIVGLYSCVLPMLVYAIFGTSRQLILGPDAATCAVIAAVVTPLAMGDPLK
                     HWQLVMTMTAMTGMWCLLASRFKLGILADFLSRPILLGLLNGVALTIIVGQFAKVFGL
                     KYEQQYLLERIVEAPSLLIDLHWQTLLISALTVVVYFLCKRVRPNWPAAMLAIIAAAF
                     WVWFFGAEHLGVKVVGLIQGGLPIFQTPLFDLGVSRELVMPALNLAMVSFVSMMLTAR
                     SFAAKNGYDIDADKEFRALGLANIASAFSQGFAISGADSRTAVNDANGGKSQLVSIIA
                     AIVIGFVAIVAYQPLQYIPIAALGVVLIIASISLLDLKGIWSLHKRDKDAFYLASLTF
                     IAVLVIGVIPGITLAVLLGLFQFLRTVMRPSDQTLGLDDKGTIRTIDTSAKAKPIPGL
                     VIYRFNSPLTYFNAPYFKRRILFHTESAGMSVGCVIIDAVSSFTHLDLSVMAMLSDVQ
                     SILKKRGIRLVLAGRKRSLRKWCEIAGISTGDGGVVIRADMYLAIKLSGCYQHAVEEG
                     QVPPVQKEPQKDIEGEIAAAI"
     misc_feature    join(57257..57310,57320..57388,57401..57469,57482..57535,
                     57569..57637,57716..57772,57791..57850,57944..58012,
                     58049..58117,58160..58213,58232..58300,58343..58411)
                     /note="12 probable transmembrane helices predicted for
                     TVA2757 by TMHMM2.0 at aa 28-45, 49-71, 76-98,
                     103-120,132-154, 181-199, 206-225, 257-279, 292-314,
                     329-346,353-375 and 390-412"
     misc_feature    57323..57355
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
     misc_feature    57536..58432
                     /note="HMMPfam hit to PF00916, Sulfate_transp, score
                     4.2e-56"
     misc_feature    58496..58786
                     /note="HMMPfam hit to PF01740, STAS, score 2.4e-12"
     CDS             complement(59191..60072)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0058c"
                     /old_locus_tag="TVA2756"
                     /product="Putative uncharacterized (4Fe-4S ferredoxin)
                     iron-sulfur binding protein"
                     /note="user locus_tag: VANGcII0058c"
                     /protein_id="CDQ47955.1"
                     /translation="MVSGKQPLRAKVSRVLTFSCVDGPGNRLVIFMQGCNFNCLSCHN
                     PHTIRHCHHCGDCVTTCPSQALRLNADQQVEWLAEKCTHCDRCIEHCMHQSNPKIHHY
                     SVEQLVELIRRNHYFLAGITISGGEATLQIPFIIALFKAIKHDEELKHLSCFIDSNGS
                     LSESGWDKISPYLDGAMIDLKAWQEETHRWLTERSNHRVIRTIFHLAKRNKLHEVRLL
                     HIPDKSDLETEITEVAHLINQLPANVSIRLNAFQHHGVVGKALTWQPCSEGAMLQFHR
                     KLAAQVQRTVYLPTRYA"
     misc_feature    complement(59326..59391)
                     /note="Predicted helix-turn-helix motif with score
                     1029.000, SD 2.69 at aa 228-249, sequence
                     TEITEVAHLINQLPANVSIRLN"
     misc_feature    complement(59362..59988)
                     /note="HMMPfam hit to PF04055, Radical_SAM, score 4.7e-13"
     misc_feature    complement(59872..59943)
                     /note="HMMPfam hit to PF00037, Fer4, score 0.0019"
     misc_feature    complement(59887..59922)
                     /note="PS00198 4Fe-4S ferredoxins, iron-sulfur binding
                     region signature."
     misc_feature    complement(59941..60006)
                     /note="PS01087 Radical activating enzymes signature."
     CDS             complement(60072..61625)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0059c"
                     /old_locus_tag="TVA2755"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0059c"
                     /protein_id="CDQ47956.1"
                     /translation="MSHSLDTQQRFQAIVTDAHLSPKQKSHFLALEAEASLPYLKLSP
                     ESARAMEQGIICDMFEGHAPFKPRYVLPDYAKFLAQGSEYLELSPASNFDEALNMLTI
                     LYHHVPSVTSIPVYLGQLDSVLLPYVGELSEASIYQKLKLFWIMLDRTLPDAFMHANI
                     GPSDNIICRTILRVDAELKQIAPNLTFMYDPSITPDDLLRQATNNICQCSKPHIANYP
                     IHTTAYGEQGFGIVSCYNSLPLAGGCNTLVRMNLKEAAKKASDRQTFLDQILPTYSQY
                     MIELMDVRAAHLHQQSHFFEGFLTQEGLIEESRFAPMFGIYGMAEAVNLLLEKEQSNA
                     RYGHDDIANQLGIAISAKLADIVQNSPVKYGFNGRALLHAQGGISLDLDVTPGVRIPY
                     GTEPNPIEYVQATAGHHQYYTSGISDILTLDETIKANPEAMFNLCKGALHSGYREFTA
                     NVASNDLVRITGYMVKLSEIAQFEQRGSRTNTTFLGAEAAKNTAVLKRKARVVSHEMQ
                     SAYQPNSVN"
     misc_feature    complement(60894..60926)
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
     CDS             complement(61771..62385)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0060c"
                     /old_locus_tag="TVA2754"
                     /product="putative glutathione S-transferase"
                     /note="user locus_tag: VANGcII0060c"
                     /protein_id="CDQ47957.1"
                     /translation="MIKLHHLNKSRSKRIIWLLEELGVEYQVVPYQRDSVTFLAPPEL
                     KSVHPLGKSPVIEDNGLVIAESGAITDYLIEKYGQHFAPQRGSVEYVQYQQWLHFAES
                     SAILPLLLKMFVAKDGCQTNFLGGYAESETAKVMSYFDQCLAGKRYLVADQLTGADFM
                     MSFIAEILLTNGAITHFPNIERYLKQLATHPAYLKSNQIEAQYA"
     misc_feature    complement(61813..62004)
                     /note="HMMPfam hit to PF00043, GST_C, score 7e-08"
     misc_feature    complement(62161..62385)
                     /note="HMMPfam hit to PF02798, GST_N, score 1.1e-12"
     CDS             complement(62399..63430)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0061c"
                     /old_locus_tag="TVA2753"
                     /product="Putative alcohol dehydrogenase superfamily
                     protein, zinc-containing"
                     /note="user locus_tag: VANGcII0061c"
                     /protein_id="CDQ47958.1"
                     /translation="MTEQTNRRIVLASRPVGAPTPDNFRLEHAPKPTPAAGEVLLRSV
                     YLSLDPYMRGRMSDAKSYADPVAIDDVMVGGTVCQVEVSNHPKFEQGEWVLAYTGWQD
                     YAISNGEGLLKLGKNPTSPSYALGIMGMPGFTAYMGLLDIGQPKQGETVVVAAATGPV
                     GATVGQIAKIKGCRVVGIAGGEEKCRYAKEVLGFDECIDHKADDFAEQLAKTCAQGID
                     VYYENVGGKVFDAVLPLLNTAARVPLCGLISQYNATSLPEGPDRLSMLMGTLLTKRIR
                     MQGFIIFDDYGHRYNEFATDMTQWLSEGKMKYREQLIDGLENAPQAFIGLLEGKNFGK
                     LVIQINQPL"
     misc_feature    complement(62534..62992)
                     /note="HMMPfam hit to PF00107, ADH_zinc_N, score 1.4e-27"
     CDS             complement(63515..64111)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0062c"
                     /old_locus_tag="TVA2752"
                     /product="putative transcriptional regulator, TetR-like"
                     /note="user locus_tag: VANGcII0062c"
                     /protein_id="CDQ47959.1"
                     /translation="MNTKTHDTRQHILEVGYQLVVTKGFTSVGLSELLKTADVPKGSF
                     YHYFKSKEQFGEALITDYFQHYLVRINALFDQEEGNAYQHLMHYWQCWYEQSNGLCNA
                     QRCLVVKLSAEVSDLSDAMRIALLKGADSIIEAVGKCIQQGIDDGSIHVQHSQQTAEL
                     LYNLWLGASLLSKLRQDNQGLAQALTSTAHILQGQCPS"
     misc_feature    complement(63938..64078)
                     /note="HMMPfam hit to PF00440, TetR_N, score 4.7e-13"
     CDS             complement(64285..66582)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0063c"
                     /old_locus_tag="TVA2751"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0063c"
                     /protein_id="CDQ47960.1"
                     /translation="MYKPLCSLLITCTPLLALASQSQPASITLHNQNQTVQIEPQNFA
                     IDWQQNAQLTINQGQLTVNGQPQQVSQLQQDNQHHASWLLVPSQLKVEANLQQTLKLS
                     ITASAESKISRAKPLTVQWFELPGQQSKTLILPFSEGMRIPTDNPQWVNYLIAERSAS
                     NTTQDLKMPFWSVEAGNEQYVSYQLNTATNNKLNFSAKQNKLDMQATHAFTVLNKDEP
                     FEVEISLGNSPLDGAKRYRQWRKENGLSQTLEQKAQQNPAIKQLIGASHVYLFGQDLV
                     STQDVTDFWALKEWYFKQPQWVASNEALKELKPLVKGKDFFNNYNKRLLIDEVNRSLN
                     AWIKEQPSTQEAGIASQYQAAQARKAWLAEQKLPFLRDASTWGQGLSTSMIDALSSAG
                     LQHLWLGLDNWMPAFYQPQVVDQAKQAGYLVGVYDSYNTAIAKGINDGWLTAQLPDAM
                     RKQCAIENADGKKQKGFRGNGFYLNPACQLGFVQQRIEAILKYGRFNSLFLDVDGTGM
                     AREDYSYQEGQGMKESAMLEAFNQRMRWIANEQNVVLGSEDGNSLTTQGLSFAHGLET
                     VGFGWTDPDMKTNRQSPYFLGAWFPTTSPDFFFKPAQVKEPYKTLLFAPQYRIPLYQT
                     VFHDEVINSHHWHNDSVKFSNVQAERDLIAMLYNTPAMIHLSRDEATPNSARVNALRR
                     YQQGFAPIHEVVWNQPLVDFKWLDEQGMVQQTTFGDGSKITANFSTQPYKKEDKEIVP
                     ALSIQAELSNGQNLIWASDTLKTEK"
     misc_feature    complement(66526..66582)
                     /note="Signal peptide predicted for TVA2751 by SignalP 2.0
                     HMM (Signal peptide probability 1.000) with cleavage site
                     probability 0.656 between residues 19 and 20"
     CDS             complement(66658..67485)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0064c"
                     /old_locus_tag="TVA2750"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0064c"
                     /protein_id="CDQ47961.1"
                     /translation="MRNLWLFALFVVSPSHAVSDDWFMATPLQSTYHALANHQPQLAW
                     QELVLALNNQTIATPHWASVKHAIIEQTQCGQQLLSDVVPNAALIKVSIQKKTNVMQQ
                     GYQFKLSMEGAELPSQVELLGPDNSLLISQSQVTSSAPYIELESPELLFAPQDGVYRL
                     TLDKQHYWLVLTMPFGSTWLQSASPNGGYPLAIESPIALTNCPPTSLAWQWFDDQFQL
                     IKQQDMVAISNTQQLLDKPSSSPSSAKWLSTLIKTIEYQGAIKVEYVQRLTLPNQAQ"
     misc_feature    complement(67435..67485)
                     /note="Signal peptide predicted for TVA2750 by SignalP 2.0
                     HMM (Signal peptide probability 0.997) with cleavage site
                     probability 0.813 between residues 17 and 18"
     CDS             complement(67478..68131)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0065c"
                     /old_locus_tag="TVA2749"
                     /product="Putative transcriptional regulator, response
                     regulator"
                     /note="user locus_tag: VANGcII0065c"
                     /protein_id="CDQ47962.1"
                     /translation="MNTLLLVEDDPLLGQGLHDYLLQQGFDCLWVQQLSQVKKAWFRA
                     DLVILDRQLAQGDSLDHLPQWLMAKAVPVIILTAKIEVEQKIAGLMAGAKDYVTKPFS
                     QQELLARIQAQLRPLGESLLSYADIAIDLSKRSVTLGEQLMTLKPKQFQLLLLLVQNQ
                     GRVFHRDELLNKVWGYQAFPSTRTVDNHVLQLRQQLPSLNIETVRGVGYRLVEVSNA"
     misc_feature    complement(67499..67717)
                     /note="HMMPfam hit to PF00486, Trans_reg_C, score 4.9e-21"
     misc_feature    complement(67799..68128)
                     /note="HMMPfam hit to PF00072, Response_reg, score
                     1.1e-18"
     CDS             complement(68128..69549)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0066c"
                     /old_locus_tag="TVA2748"
                     /product="Putative signal transduction histidine
                     kinase,membrane associated"
                     /note="user locus_tag: VANGcII0066c"
                     /protein_id="CDQ47963.1"
                     /translation="MITLTAVLGQSNLAHGQEQTLQDRWQHFLRQAESLSAARALPLQ
                     SINSYPIDLLLSASAYPDFSRYSWQTITELKAIASQCALSPGLSKTLASRPELQKAAS
                     FELALCQGDELPIRWFKTAPFLHPAGGSYAERYLAFSTHNITAEQNAELQPYTTLSNP
                     QHPLYTFFTDLETAGRDALVSGYRAYIDRQQRLWISGDFGIRVLSALQWKKVALDQQL
                     ALSAITAATQSCQLRYSNLCVSSQEKTNISLWLSVILLLLLAATLSRTLWLRRQQAKE
                     KRFILQLLTHELRTPITSLGLTVEQFRQQFDTLPELAQDTFGRLLADHQRLAQLAQTS
                     KGFLSSDPNEPFQCQTAYLSDWLDHCVAKHELSYELTQDIELTLPYYWLGICLDNLIR
                     NAKQHGQGTISITASVTDTQLRLCVSDEGEFPSRLKRLFSRSRTASNMGIGLRLVSHL
                     MLKMGGKLTCKAHPTRCQLELPL"
     misc_feature    complement(68158..68418)
                     /note="HMMPfam hit to PF02518, HATPase_c, score 4.3e-10"
     misc_feature    complement(68521..68724)
                     /note="HMMPfam hit to PF00512, HisKA, score 0.00094"
     misc_feature    complement(68743..68811)
                     /note="1 probable transmembrane helix predicted for
                     TVA2748 by TMHMM2.0 at aa 247-269"
     misc_feature    complement(68860..68892)
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
     CDS             complement(69667..71364)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0067c"
                     /old_locus_tag="TVA2747"
                     /product="Putative RNA pseudouridylate synthase"
                     /note="user locus_tag: VANGcII0067c"
                     /protein_id="CDQ47964.1"
                     /translation="MPTPAPCFTAFKKPIEGYSLPERFTFPFCYEPHPLCELAASQLQ
                     QHLLNQQNWQHNFGLDNHGVLNQHPEAIGKMFGVLVVRKQSGELGYLSAFSGKLAEQN
                     LLPHFVPPIFDMLTNDGFFLEGSVPINQINQQVEQLECDPQRALLQQQWTTAHQQAQD
                     ELEAHRQLMIQGREQRKQQRILAEQSNDAQQLRETLDCLAKQSVAEKASLKQLKRKWD
                     VNLNELQAQIDAFQEQIDALKEQRKNLSNALQQRLFSHYRFLNQYGTEKSLEEIFRLT
                     ANPVPPAGSGECAAPKLLHYAFQHQMTPISLAEFWWGASPKSEIRQHKKFYPACQNKC
                     QPILAHMLDGLKLDDNPLLHNPAQGKEIDIIYQDEAIIVVNKPAEFLSVPGVNIQDSV
                     YTRLQQMFSSDEGLFVIHRLDMSTSGLLVFALTRRANKSLQKQFITRGVEKRYLALLA
                     GELQQSHGDIRLPLRGDLDDRPRQLVCFEHGKPADTHWQLIECRDGFSKVYLYPKTGR
                     THQLRVHCAHVEGLNLPIVGDDLYGTKGARLHLHAESLSFDHPYTKQRMTFTVDAEF"
     misc_feature    complement(69811..70257)
                     /note="HMMPfam hit to PF00849, PseudoU_synth_2, score
                     5.6e-42"
     misc_feature    complement(70096..70140)
                     /note="PS01129 Rlu family of pseudouridine synthase
                     signature."
     CDS             71938..73026
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0068"
                     /old_locus_tag="TVA2746"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0068"
                     /protein_id="CDQ47965.1"
                     /translation="MMDFCQRLSLCVPQASSLEVASMWINKTYAILALSLFPSMVLHA
                     EQETSAAEVYEVGNMSPEKAFATGRLLRAQYKNMESRPYLQYAADNDNSDAAFLYAME
                     LSNYKTTIRTPPEAREYLLKAAELGNRRAMKHLYTDAKWLRDRDVQYWKSQYYDSLIR
                     LGRDDPAQATYELAQFYKGMDNEMYSYYLDKAVSFNHPRALMDKAKQVQEGGGLFLMP
                     GERETKVRELYLAAAKTNYIPAMRRYIGILESKGRFEDAYQWRLMALEQGDITSLATV
                     VKILLGDSASYYFVTPDRIKAQAYLDLYLSAAGTERMQSLYSILELEEESLAGKMSEE
                     EKAQANGIFVNYKNSLNFYYHDVFWDIN"
     CDS             join(73416..73445,74509..74988)
                     /pseudo
                     /transl_table=11
                     /gene="vipA"
                     /locus_tag="VANGNB10_cII0069"
                     /old_locus_tag="TVA2744"
                     /product="Putative type VI secretion-associated
                     protein,VipA (pseudogene). tssB-like (ortholog)"
                     /note="user locus_tag: VANGcII0069"
                     /db_xref="PSEUDO:CDQ47966.1"
     repeat_region   complement(73447..74500)
                     /rpt_family="IS5"
                     /note="NB10_ISVa2 (complete: 1.054 bp); Accession
                     Number:L40498"
     CDS             complement(73501..74421)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0070c"
                     /old_locus_tag="TVA2745"
                     /product="Transposase, ISVa2 (IS5 family)"
                     /note="user locus_tag: VANGcII0070c"
                     /protein_id="CDQ47967.1"
                     /translation="MPKPRYKTTNWKQYNKALINRGSLTFWIDEETIAEWKQNKQGKR
                     GRPRRFSDLAITTALMVKRVFSMPLRALQGFLDSVFKLANIPLVCPHYTCISRRAKEV
                     EVSFKTKTRGAIQHLAIDATGLKVYGEGEWKVKKHGTDGKRRVWRKLHIAVDTSTHEI
                     VAAELSLSNVTDAEVLPNLLKQTRRKIIEISGDGAYDTRNCHDAIRIKQAVALIPPRE
                     GAAFWEQGHPRNLAVGCQKLYGSNKKWKKRYGYHKRSLSETAMYRVKQLLGGKLSLRN
                     YNAQVGETYAMIKALNKLTGLGMPETQYIA"
     misc_feature    complement(73543..74076)
                     /note="HMMPfam hit to PF01609, Transposase_11, score
                     2e-21"
     misc_feature    74584..74958
                     /note="HMMPfam hit to PF05591, DUF770, score 7.5e-51"
     CDS             75038..76513
                     /transl_table=11
                     /operon="vts"
                     /gene="vipB"
                     /gene_synonym="tssC"
                     /gene_synonym="evpB"
                     /locus_tag="VANGNB10_cII0071"
                     /old_locus_tag="TVA2743"
                     /product="Type VI secretion protein, VipB"
                     /note="user locus_tag: VANGcII0071"
                     /protein_id="CDQ47968.1"
                     /translation="MSTTEAVLERQSATQGSLLDEIMAQTRIAPTEEGYDVAKKGVAA
                     FIENLIGSNQTEEPVNKSLVDQMLVELDKKISAQMDEILHEERFQQMESSWRGLKLFI
                     DRTDFRENNKVDLLHVTKGELLEDFEFAPETTQSGLYKHVYSSGYGQFGGEPTGAIIG
                     NFAFTPSTPDMKLLQYMGALGAMAHAPFISSVGPEFFGIDSFEELPNIKDLKSTFESP
                     KYTKWRSLRESEDARYLGLTAPRFLLRVPYDPTENPIKSFNYVESVSASHEHYLWGNT
                     AFAFATRLTDSFAKYRWCPNIIGPQSGGAVEDLPVHVFESMGALQSKIPTEVLVTDRK
                     EFELAEEGFIALTMRKGSDNAAFFSANSIQKPKIFPNTKEGKEAETNYKLGTQLPYMM
                     IINRLAHYVKVLQREQIGAWKERQDLERELNGWIKQYVADQENPPADVRSRRPLRAAK
                     IEVMDVEGEPGWYQVSLSVRPHFKYMGANFELSLVGRLDQA"
     operon          75038..93622
                     /operon="vts"
     misc_feature    75095..76507
                     /note="HMMPfam hit to PF05943, DUF877, score 0"
     CDS             76516..76953
                     /transl_table=11
                     /operon="vts"
                     /gene="gp25-vc"
                     /locus_tag="VANGNB10_cII0072"
                     /old_locus_tag="TVA2742"
                     /product="Type VI secretion-associated protein, gp25
                     (T4-related)"
                     /note="user locus_tag: VANGcII0072"
                     /note="ID(nucl)=80,47; mismatches=42; Evalue=3e-20 vs gp25
                     VCA0109 [Vchol O1 El Tor str. N16961]_NP_232510
                     gi|15600771:chrII. TssE (C.jejuni; ortholog)"
                     /protein_id="CDQ47969.1"
                     /translation="MTYIAPEESAFGVGFFERLEAGTKPMSLTQGPNAWDVLQSIKRN
                     VSNILNTRMGEAQSAPTLGLVDFNDATLETLDLSLRIKLAIQSCLDVYEPRLRNIVIR
                     SESDVFSPLMLRFHIVAEINSDALHEKVQFNLLLDQNRKYRVY"
     misc_feature    76609..76911
                     /note="HMMPfam hit to PF04965, GPW_gp25, score 3e-24"
     CDS             76960..78729
                     /transl_table=11
                     /operon="vts"
                     /gene="vtsA"
                     /gene_synonym="lanA"
                     /gene_synonym="vasA"
                     /gene_synonym="tssF"
                     /locus_tag="VANGNB10_cII0073"
                     /old_locus_tag="TVA2740+TVA2741"
                     /product="Type VI secretion-associated protein, VtsA"
                     /note="user locus_tag: VANGcII0073"
                     /note="cfr CDS=tva1465, also type VI secretion protein?"
                     /protein_id="CDQ47970.1"
                     /translation="MAQDKYFREELAFLKEQGKHFTEIHPQLSRFLHGKTTDPDVERL
                     LEGFAFLTARLREKVEDEFPELTHSIINMLWPNYLRPVPSMSIVSFTPDKSVSDKQQI
                     ARGTQLDSKPVFGTKCHFRTCRDVQIYPLKCTDVTAQHTREATIIEVSLNMLGEISVG
                     DAHLDDLRFYLGGDKYSSQMLYLWLNHYLDKISVEVAGVEFTLPRNSFQTVGFDSEQS
                     LLPYPSNVYEGYRVLQEYLSFPEAFHFVDITRLASVVPKSVHGAFKLKISFSKTLPAD
                     VRVRQDNFQLYCTPVINLFEHDADPIDLTGKRSEYRIIPSSRYPSHYEVFSVDGVFGW
                     QDKTQASQRIRGEKRVYSAFESFQHEVERVRNREALYYRTRVRDSIRGDGFDNFISFI
                     RGDETQSMHVDEAISLKLTCTNRLLPLELGVGDICEPTDSSPPFATFSNITVPSQSLR
                     PVLDGSLLWVLISNLSLNYLSLLSKDALSSVLRAYDFRALVDRQAERVARLRLEGIQK
                     IESQPVDKILRGLPVRGLQSTIHIDQNCFGSEGELYLFGTVLSHFFALYASINSFHEL
                     IVINASNQEKYTWGTQTGMQPLI"
     misc_feature    76960..77347
                     /note="HMMPfam hit to PF05947, DUF879, score 2.9e-62"
     misc_feature    77416..78726
                     /note="HMMPfam hit to PF05947, DUF879, score 6.6e-125"
     CDS             78732..79715
                     /transl_table=11
                     /operon="vts"
                     /gene="vtsB"
                     /gene_synonym="lanB"
                     /locus_tag="VANGNB10_cII0074"
                     /old_locus_tag="TVA2739"
                     /product="Type VI secretion-associated protein, vtsB"
                     /note="user locus_tag: VANGcII0074"
                     /protein_id="CDQ47971.1"
                     /translation="MAAAAVPEPLLGLPSDVRTYNFYQLVELLQKLNAFNPESEDWER
                     TCQLVFSANPSLGFAPADVTDLREFADERLILQTNFFGLTGAQSPLPGFILQQLVEED
                     PGGFKRPFLDFFNNRLINLVYRVWRKYRYYVRFQAGAQDQFSSQLFALVGLGDADLRG
                     ETPINWCKMLAYAGTLAGRSRSPQVVSGIIAHCFDLQEVSIRQWVRRKVRIEPYQQFC
                     LGKQNGELGINSMLGESVMDCNGKFVICIKNLTRERFADFLPSGKEHQPLCKLVEFIL
                     REQMAYDLELTMHESEAPVMSLCHDSGVALGWSSFLGRDLADKSVLIQVRQ"
     misc_feature    78771..79673
                     /note="HMMPfam hit to PF06996, DUF1305, score 2.2e-127"
     CDS             79720..81192
                     /transl_table=11
                     /operon="vts"
                     /gene="vtsC"
                     /gene_synonym="lanC"
                     /gene_synonym="vasC"
                     /gene_synonym="tagH"
                     /locus_tag="VANGNB10_cII0075"
                     /old_locus_tag="TVA2738"
                     /product="Type VI secretion-associated protein, vtsC"
                     /note="user locus_tag: VANGcII0075"
                     /protein_id="CDQ47972.1"
                     /translation="MQKKQTLSMVVTNVQLLESGLSAQAMFNVQGGVIGSASDAHWQL
                     RDGKGKIQNHHCAIRVIDGAFCIQDLVGNTYVNGSHKPLGQGASAKLEHKDEVAIGPY
                     QIRVIFGQVGEDDSLINGSLDQLFAKEGLDLLKDGPLDDISRDEDEPEPSSMDPIAAL
                     DDLLQGIKQEESLLEETEKPLAQAQHSLVPEYDSQQSQLQFTPQADSEYEMTSSIRLK
                     KILGFGKTSTDLPPIPAVEHHETAQPPTHLNINNSIYNVPEGLAMDDKVLDLLEEEVA
                     RSYHPHSEQHNSSSNNASHLLTGPMLTGLGVDVGNSHDMAKMHMLSEELGQSLQACVQ
                     GLLELHQQVSEGRFGMMNRNLQPIEDNPLRLGLSYEETIRTLYDADKSVVHLSAPAAI
                     AESLKNVRDHNEAMQHATSEALNQILNAFSPQVLLRRFQHYKRNSDAQSNSSDAWAWE
                     MYCHYYQELTSNRQKGFEKLFWEIFEQSYDKKIREKQLEL"
     misc_feature    79813..80019
                     /note="HMMPfam hit to PF00498, FHA, score 5.7e-06"
     CDS             81222..81674
                     /transl_table=11
                     /operon="vts"
                     /gene="vtsD"
                     /gene_synonym="lanD"
                     /locus_tag="VANGNB10_cII0076"
                     /old_locus_tag="TVA2737"
                     /product="Type VI secretion-associated protein, vtsD"
                     /note="user locus_tag: VANGcII0076"
                     /protein_id="CDQ47973.1"
                     /translation="MLLTVLTACSSSEKYEPATQPTKVTFSLVSDEGTNPNIWGEASP
                     IEVQVFELKDDSMFMSADYDQVKADYKKALRSNFIANYDYVMTPGQFKFVNAFEIDEG
                     TNYIGVMAHFAEPELSEWKKAVKVLNKGREYHLLMYFKDYDVKLERVE"
     CDS             81679..83013
                     /transl_table=11
                     /operon="vts"
                     /gene="vtsE"
                     /gene_synonym="lanE"
                     /gene_synonym="vasE"
                     /gene_synonym="tssK"
                     /locus_tag="VANGNB10_cII0077"
                     /old_locus_tag="TVA2736"
                     /product="Type VI secretion-associated protein, vtsE"
                     /note="user locus_tag: VANGcII0077"
                     /protein_id="CDQ47974.1"
                     /translation="MFARNRVIWNEGLFIKPQHFQQQQRYFEYHIDERISSVSGYLYG
                     VSELSLNPEYLSFGRIAIERAVGIMPDGTVFRIPQEDVLPDALEIADASLANQLVYLA
                     VPLRSESLMEINWPEERGTGRYLSNRLEVRDVHTVRGDTTTLDVSPVRVQLMLEKEDR
                     SSYASIAIARILEKRPDGSVVLDPDFIPCHLNVASNAALHRFINEISGLMRERAKNIA
                     QRISSPSQGGVADVSDFMLLQALNRLQPQMQHLAELRSLHPERLFECLSCVCGELATF
                     TDESRLPPSIPSYNHEMPTHSFGPLIRNLRQSLSIVLEPRAVSIQLDKRKYGLMVAPI
                     HDPQLVESAEFIIAVKARMPLDELRRLFTQQTKVSSVEKIRELISLQLPGIPITPLPV
                     APRQLPYHAGYTYYQLDKTSSAWSMLGRSSGFAFHVAGAFEDLDLQFWAIRS"
     misc_feature    81691..83010
                     /note="HMMPfam hit to PF05936, DUF876, score 5.5e-195"
     CDS             83016..83789
                     /transl_table=11
                     /operon="vts"
                     /gene="vtsF"
                     /gene_synonym="lanF"
                     /gene_synonym="tssL"
                     /locus_tag="VANGNB10_cII0078"
                     /old_locus_tag="TVA2735"
                     /product="Type IV/VI secretion system, DotU/vtsF"
                     /note="user locus_tag: VANGcII0078"
                     /protein_id="CDQ47975.1"
                     /translation="MAIDKKNTQYSGLLFDSVEQINHDQDYWFQLRGDNPNVLIDAAT
                     PLFGLSLRVRSLSECENIEQIYKQTVEEIKAIEIELAEQGFEHAILMAYRYILCAFLD
                     EAVMGTEWGASSVWAEHSMLSRFHSETWGGEKVFTILSRLEGEPKRYRALLEFIYQCL
                     VLGFEGKYRVMESGHNEREKVISRLHDTVSSLDENEPKELTSATDHVVKSKYKLSRQL
                     PVWSVLLGFVIIWVGVFLGYSYLLHSQSADVLNQLNQIL"
     misc_feature    83673..83741
                     /note="1 probable transmembrane helix predicted for
                     TVA2735 by TMHMM2.0 at aa 220-242"
     CDS             83813..86431
                     /transl_table=11
                     /gene="vtsG"
                     /gene_synonym="lanG"
                     /locus_tag="VANGNB10_cII0079"
                     /old_locus_tag="TVA2734"
                     /product="ATPase, type VI secretion system, ClpV1/LanG"
                     /note="user locus_tag: VANGcII0079"
                     /protein_id="CDQ47976.1"
                     /translation="MIRIELPTLISKLNEQSKLALEQAASLCIERQHPEVTYEHFLHV
                     LLENPLSDVRVIAKHANLDVETVKQAISASYAREQVLDTYPAFSPLLVELLQEAWLLS
                     TTELNQNQLRSGVVFLAALMRADRYLPLKLIRLFEHINKESLNKGFDTLLQDSSESAV
                     EKSKAGSQAPAALDAASSSPLHKYCTNVTAQARNGELDPVLCRENELNLMIDILCRRR
                     KNNPIVVGDAGVGKSAMIEGLALRVVAGNVPTQLQNVELCSLDLGLLQAGASVKGEFE
                     KRLKGVIDAIKTSPKPIILFIDEAHTLIGSGNQEGGSDAANLLKPALARGELSTVAAT
                     TWKEYKKYFEKDPALTRRFQLVKLEEPSISQAVDILRGLNRVYEKAHNVLITDDALKA
                     AAELSARYISGRQLPDKAIDVLDTACARIAINITTPPKRLAQLETACHQRQLEIDMLE
                     RAQYLGQVVDSHRLDELCSQEVADEAEKATLTQSWQEQKAIIERIITLRDQLLDGAED
                     HGEQTQVERDELLVQLQEQYRALEEIPHNDRLMHPQVDAQQIAEVIADWTGVPVDQMN
                     SDELHKITHLTAILGEAIKGQDTAIERVHRNLLTARADLRRPGRPKGSFLLVGPSGVG
                     KTETVVQLAQQLYGGKQFLTTINMSEYQEKHTVSRLIGSPPGYVGYGEGGILTEAIRK
                     MPYSVVLLDEVEKAHPEVLNIFYQAFDKGELADGEGRVIDCQNIVFFLTSNLGYQTIV
                     DYAQQPQLLDEQLYPELAAFFKPALLARMEIIPYLPLSKEVLEQIVRGKLTRLEQLFK
                     QRYAADVVIEDSLIEEILSRATRSENGARMLEAIIEGQLLPPISLALLNKLADKQPVQ
                     RIYLAAEEGEFIGEVE"
     misc_feature    83882..84040
                     /note="HMMPfam hit to PF02861, Clp_N, score 1.9e-06"
     misc_feature    84473..85057
                     /note="HMMPfam hit to PF00004, AAA, score 5.7e-08"
     misc_feature    84488..84511
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
     misc_feature    84752..84790
                     /note="PS00870 Chaperonins clpA/B signature 1."
     misc_feature    85640..86128
                     /note="HMMPfam hit to PF07724, AAA_2, score 1.1e-81"
     misc_feature    85667..85690
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
     CDS             86428..87996
                     /transl_table=11
                     /operon="vts"
                     /gene="vtsH"
                     /gene_synonym="lanH"
                     /locus_tag="VANGNB10_cII0080"
                     /old_locus_tag="TVA2733"
                     /product="Type VI secretion system sigma-54 dependent
                     transcriptional regulator, LanH"
                     /note="user locus_tag: VANGcII0080"
                     /protein_id="CDQ47977.1"
                     /translation="MIMSHWLAYATELVVARKPSQLAALFVETLRRELRLDTCLLLVP
                     SSDGRTLVPQDNPLNLSWSVTDFDCPFAHVLQSAKSMHLTADELVFWQSNRLFSQLTS
                     RVGMLDSVVVHPLPNGDTQVQSILLLIGETHTLEGLFEQPDFIKYVDVFCHQWSLLNE
                     MQREEQNRQSLSESLSDVQRDNARRSLIASLSETLIGNSLAMKKLREQIINAAPSQLS
                     VMVQGETGTGKELVAQAVHQLSPRKQAPFVAINCAAIPENLLESELFGYCKGAFSGAD
                     SDKQGLIAQADGGTLFLDEIGDMPLSLQAKLLRVLESRSFRPIGGKNEQSSDFRLVSA
                     THVNLLEQVRNKSFRQDLYYRLFQYPITLPRLAARMDDIERLSQHFVRSFNQQHATNI
                     RGVHYKAIDCLKRYDFPGNVRELKHLIEFGCAQTLDGTQVEESCFTQRLAYTKADQQP
                     ETERHGHKVAKAEPGVSRVVDDLKQAVNEFESRIIRERLQYFAGDRAKAAQSLGIPKR
                     TLAYKCQKLEIKTP"
     misc_feature    87010..87675
                     /note="HMMPfam hit to PF00158, Sigma54_activat, score
                     1.8e-136"
     misc_feature    87082..87123
                     /note="PS00675 Sigma-54 interaction domain ATP-binding
                     region A signature."
     misc_feature    87268..87315
                     /note="PS00676 Sigma-54 interaction domain ATP-binding
                     region B signature."
     misc_feature    87649..87678
                     /note="PS00688 Sigma-54 interaction domain C-terminal part
                     signature."
     misc_feature    87856..87978
                     /note="HMMPfam hit to PF02954, HTH_8, score 2.6e-08"
     misc_feature    87907..87972
                     /note="Predicted helix-turn-helix motif with score
                     1175.000, SD 3.19 at aa 494-515, sequence
                     GDRAKAAQSLGIPKRTLAYKCQ"
     CDS             87993..88652
                     /transl_table=11
                     /operon="vts"
                     /gene="vtsI"
                     /locus_tag="VANGNB10_cII0081"
                     /old_locus_tag="TVA2732"
                     /product="Type VI secretion-associated protein, LanI"
                     /note="user locus_tag: VANGcII0081"
                     /protein_id="CDQ47978.1"
                     /translation="MNKRLFRLTVCLSMTLYFPMANAENDAIAQAEQCTTITSRLERL
                     SCFDHLFKTPSDVVMPQAATPNAPLSWQRAFDSISQYQDGEASHLTVEGDDDKGNAWI
                     TLVALNQNTKFDDNAKPVLLMSCIDNLSRVELAFPSAIDDPRIQVSIANMQAQSWRSD
                     DLGLLFSSGRGMPAIEMMKAMARENRLVLRSNSPFVDGLQFDASELSQSLTALKTRCG
                     W"
     misc_feature    87993..88061
                     /note="Signal peptide predicted for TVA2732 by SignalP 2.0
                     HMM (Signal peptide probability 1.000) with cleavage site
                     probability 0.999 between residues 23 and 24"
     CDS             88662..90059
                     /transl_table=11
                     /operon="vts"
                     /gene="vtsJ"
                     /gene_synonym="LanJ"
                     /locus_tag="VANGNB10_cII0082"
                     /old_locus_tag="TVA2731"
                     /product="Type VI (ImpA-domain) secretion-associated
                     protein, vtsJ"
                     /note="user locus_tag: VANGcII0082"
                     /protein_id="CDQ47979.1"
                     /translation="MELTDYRRCITQPIQADNPVGERLIDDPLFDFVEDQMMKVGSLS
                     HASVQWDEVEHSTLKLLSGKSKDLKLLIYLLQCLHNQVTPLRFTTSLQLLSDFMSLYW
                     EDCFPAPGKRGSLPRRKFFSQIVQRLALVIDKLDFAQFDGPDRDELNTAIDALQQATT
                     QAGLMSESVESLVAKVQAQLRRATEREQATQHVQETPAVERKTTTQSAISVDSSSDKA
                     TKQTLLKVAEFLSEQEFGIALAIRVRRFAVWSSITSLPEHDVSGETLLRAMAQERIKE
                     YHDQMRSPDLALWRKVEQSLTMAPYWFEGQMMSYQIAQSLGQKAWSEAILSESQQFVA
                     RLPALLELKFKGGEPFVNASVKEWLLSQQQSSAQGQVAGDWQDKRKEAFSLAKEGGIA
                     VALSMLNDGLVSASEPRDKFYWRLLSADLLNSNNLDAMAKEQYQTLHAQVSTMSVTDW
                     EPSLVEQLEQYTTSE"
     misc_feature    88806..88991
                     /note="HMMPfam hit to PF06812, ImpA-rel_N, score 1.2e-18"
     CDS             90077..93622
                     /transl_table=11
                     /operon="vts"
                     /gene="vtsK"
                     /gene_synonym="vasK"
                     /locus_tag="VANGNB10_cII0083"
                     /old_locus_tag="TVA2730"
                     /product="Type VI secretion-associated protein, IcmF
                     (LanK)"
                     /note="user locus_tag: VANGcII0083"
                     /protein_id="CDQ47980.1"
                     /translation="MWKFIVGIARKLTPGIAAAMPILLFSTFILLNVAIWWAGPWLEI
                     AGNKPLESITARAVASSLFTLGALAVWGVWQWRKLQGFKAEQKREDQLRQDPIKAYEE
                     RQEVELNQVMVSMKENLNKRNYLYALPWYLVLGLENAGKTSLINRSGQNFVFSSVMRA
                     SGQKSENPYSFDWWIGDESVLIDPDGELLTQGNHSNDNDGAMERRLWLHFVNWLERTR
                     SRRPLNGIVLALDVSHLATATATERKAYANLLRARLRELMETLSTRLPVYIALTKLDL
                     LHGFEPFFKHYSRSQREDVLGFTFSLDSIDDLDNWLNEFSKDYSQFVERINDVLPHAV
                     SVPMDLEERNAIYSFTRQISGLKEILLQFFNDALASDQFSTSALVRGAYFTSVYQQGV
                     PTNAFDDAASRRYGLDHAINKAQQAKNSTVYFTQKLFNNIIYPEAGLASDNFRVAKQK
                     RRLIGLSVVAGSIATVLLVGTWHRYYLSNVKHSDAVLAKVNEYKNEFPSNLYLASQQD
                     VLVPLNKIREATLEFGFFRDKPQYISDFGLYQGHTIGPMVEATYLNLLENRFLPLLMA
                     DVVVQLNQAKTDEEKLAVLRVYRMMVDKSGRYKDYVLDYFSKYWQQEFAGQRVIQEEL
                     LGHLDYAMLHTDLAGDRARGDRNAESVMKPYDQVVAKVQSDLGSMPNDQRVYRNLKLN
                     AQTVLGPSINLRNLIGPVFDVVFEERVVNSSSLYIPQMLTKKGFEDYFMPQSESVSEL
                     ALIDSWVLGQSKSAQFSEADKHDLRNKIRSLYVADYTNTWRAALNEISVKYFSDINDA
                     VSVLENFTGNIEPMQRLLRTLESNTQMYASVPKDEAAQKELLKNPKYKVASQIDAPFA
                     ELNAMLKPVGDKPAYINEVLVAVEELQNYLKSIQEAPDVGMAALDATKARVKLVNADP
                     IYTVKRIASGLPKPLDTMVSKLADESWYVVKQEAIKHLEVRWHDDVYKTFEEKLAGRY
                     PFNESSNKDSSLSDFEAFFAPNGTLDNFYNNQLRMFVEENIAVNDDDNAQSIIRKDVL
                     EQLKQAKKIQQAFFNRKGVLDVSFSVEPLRLSNNKRRSVLNVDGQYLAYSHGPRDSVE
                     LIWPNTLRDSAISKVTLVPTKNNMSPRSINIQGPWAFFRLLEQGDVVGASSTSVDFKF
                     AVDGGEMIYRLNSEADINPFTERLFKSFKLSKTLY"
     misc_feature    join(90134..90202,90230..90298,91433..91492)
                     /note="3 probable transmembrane helices predicted for
                     TVA2730 by TMHMM2.0 at aa 20-42, 52-74 and 453-472"
     misc_feature    90479..90502
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
     misc_feature    91604..92551
                     /note="HMMPfam hit to PF06761, ImcF-related, score
                     1.7e-118"
     misc_feature    92828..93193
                     /note="HMMPfam hit to PF06744, DUF1215, score 2.3e-51"
     CDS             93680..94975
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0084"
                     /old_locus_tag="TVA2729"
                     /product="putative Type VI (ImpA-containing) secretion
                     protein"
                     /note="user locus_tag: VANGcII0084"
                     /protein_id="CDQ47981.1"
                     /translation="MSNIVFIDHARFHLIDDAAAVRHIDAYQKVRDEINRRNNPLSGG
                     PDWAVVKVACETLAKGPGIDLLLCGYYTVACLKMQGLAGYANGVELLCCCLSNLPKPD
                     VKSAKMRKEVLDWVNARVVRELKDLRPNHEALRDLYRCERFCERMHAILELQQPDYLV
                     DFEGVGFAIFEHIDRLETQYHSLLKRHTQTEQVELVRNQKRSRVTHVAAFISGVLGVV
                     MVYGAVTYLPFFNSMSYATNLRLPALHTPEQVNAFQQANSPAKLEQLSNEIVPLYREA
                     IEQKMARSFESARVEAQQVLDALLQLYPQTESVLEVDQAFADAKREALQQTERFMERF
                     SETRTKMANIALLAQKGKLTELQRQTKSLEEFAISLSPIYGRAAYVEELLKKGDVVQA
                     EQEFMILKQRLNNLSWKMAELDKQFEHLTVTHNQEAQAQ"
     misc_feature    94298..94366
                     /note="1 probable transmembrane helix predicted for
                     TVA2729 by TMHMM2.0 at aa 207-229"
     CDS             95143..97191
                     /transl_table=11
                     /gene="vgrG1"
                     /locus_tag="VANGNB10_cII0085"
                     /old_locus_tag="TVA2728"
                     /product="Putative type VI secretion-associated
                     protein,VgrG"
                     /note="user locus_tag: VANGcII0085"
                     /note="BlastN-similarity/overlapping fragments vs
                     VgrGnuc_gi|15600771 Vibrio cholerae O1 biovar El Tor str.
                     N16961 chrII (80-100% nt)"
                     /protein_id="CDQ47982.1"
                     /translation="MARLSFRLTVEGLADDTLVVHEYQGVESLSDSTQAGLRCYGFRY
                     EIKLASRQSGLTALELVDKTAQLEILRDDLVVQRVHGIVRQFSKGDIGHHHTFYSLTL
                     VPALERLSLRQNSRIFQLKTVPEILSIVLQEMGINDYAFSLKRECAQREFCVQYRETD
                     IDFLHRLAAEEGLVYHFIHEEGKHTLFFSDDSQSLTKRETPIPYNVLAGGVMESPYVS
                     QLTQHSQTEVSHSALQDYSFKKPSYSFAQQAQGREMDYQQATYEHFDAPGRFKDDISG
                     KAFNQIRLEYLRREARTATGKSNHPGLQAGTKFDLQEHLDDSANRDWVVVQVHHQGQQ
                     PQALEEEGGSGATTYSNQFTLIPADVTWRATPQAKPQVDGPCMALVVGPDGEEIFCDE
                     HGRVKLHFPWDRYSNGDEHSSCWVRVSQGWAGSQYGMIAIPRIGHEVIVSFLNGDPDQ
                     PIVTGRTYHATNKAPYALPDNKTKTVLRSETHQGEGFNELSFEDQAAQEKIYLHAQKD
                     LDALVLNDATAHIKHDQHLTVDNDQFTHVKHNQHLTVEGESRESVKGSCILMVDGSLH
                     VKSGQVWTNESGDEIHIKAGQKVVIEAGSEITVTAGGSFVKVDPAGVHLSGAGVNLNS
                     GGSAGSGSGFSGDLPLLPGELELQKSPAPPQTILYQALLQAEEARVPAVKVCPLAGDA
                     "
     misc_feature    96265..96501
                     /note="HMMPfam hit to PF04524, DUF586, score 1.2e-55"
     CDS             97191..97988
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0086"
                     /old_locus_tag="TVA2727"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0086"
                     /protein_id="CDQ47983.1"
                     /translation="MLKSWFEAQSEHQYWLVDHKLHKLALAQNGGFGFEEAVPLFYGS
                     MFDSVMPLSPWLIPVTDIVLELPESLLAQGLVLSSQVSTQEVLGHLRSLLIAALDGEE
                     VMFRFYDRDVIIPILRAMDETEVNHFLGNINQLVAIDHHEEDALITFSNTSCSEFVLR
                     HGTWWKMLPHHLAPLYNINVHANSLERRWWELLPHLLQRLESPQQTILSALQSALEKQ
                     NSYEVAEQHALVALVTATDTALDDLSHPLHLTSDELKELKAIKESWQ"
     CDS             97985..100126
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0087"
                     /old_locus_tag="TVA2726"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0087"
                     /protein_id="CDQ47984.1"
                     /translation="MRSTTGVSPFCAPCENRMHWIEIIIRDEFNKPFEGITGSITDSA
                     KHEFPVVLGEAPILLKTLVPGPVTLTLDAEQWLREAQGKRRKPNNEADPTLDFAKQYQ
                     DHLGNSAVFLNVTTGDLTELTPEQALPARHQKGQADACNLLTDKSYVLKVRGFNFITL
                     RVGMFFDGTANNSYSAQWGKTQLEHYYQTWKMKYNVDCDIISRKTGRLKNDIPATHLS
                     SECFDYPKKDNFFISLFKNDEGEVETVAGSATNELTNVQKLFDRYILSDDIREGGIYT
                     DAVYITGIGTGNDTNIAPADESEIFGQGAGIGQYGVTAKVSSSIDQLTGNLDALKAKF
                     ASAQPNTVDGLDKLQFDVFGFSRGAAAARHFINVVLDGEQGEFAQAFSKACQKSGISL
                     AYGFDWSEADEAKASCEITFAGLFDTVASVVDLLSFDFSTHHDNGDVRLWLDPQRVRR
                     AVHLTADPTIECRYNFSLNHLNSVDSVDHFHEFVLPGAHSDIGGGYHSRLSYNNSDYL
                     LPILEKKLVKRASRSFSDHWDKDRAEQYVRKKLAEYKQRDLATGWQDSDYVEPEVEFI
                     NHGKKEGGRVVGRLYIQRRVEGELSRLYLRLMYGLAEFHGVPLEDYDGKIWHVPDPYA
                     VYYTVRDFPERTINGLAASFKAFNQKVLDMAKQGQYTKLESEFDEKRKQELMQLNVFH
                     HSSDDSFALKPLWDESQGCYKRASYPCEKGK"
     CDS             100128..100862
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0088"
                     /old_locus_tag="TVA2725"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0088"
                     /protein_id="CDQ47985.1"
                     /translation="MYLKSISFLLITALLNACSSYAGSIPETPWSVSISMPTFYPVSV
                     TQAYGVNDAQDWTSPLHTFSQFMRISAFENINKRFHEYDGFGLPIQDYAMNQKKQVVQ
                     IKLPPDTLYLYWVSLINTQFYVTKYTVSEDVKSLMARKSLYQNRDGSLGNVCYRTEFV
                     FGLLPNGQAKVWLRGCGEIIYLAELGPDRVLDRDSNGFDEERYKQGSLLNDIQQRAKD
                     AGVSIAPIPWDKVNKVYSMEEIKSLN"
     misc_feature    100128..100193
                     /note="Signal peptide predicted for TVA2725 by SignalP 2.0
                     HMM (Signal peptide probability 1.000) with cleavage site
                     probability 0.953 between residues 22 and 23"
     CDS             100990..101628
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0089"
                     /old_locus_tag="TVA2724"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0089"
                     /protein_id="CDQ47986.1"
                     /translation="MPSFYPVKVTQAYGVNEAQNWTSPLHTFSQFMRISDLKNVQGWL
                     PEYDGFGLPVHSFAMNTQGEQVVKIKLPPDSLYLYWVSLINTQFYVTKYTVSEDVKSL
                     MAQKSLYQNRDGSLGNVCYRTEFVFGLLPNGQAKVWLRGCGTTIYLAELAPDKVMDRD
                     SNGFGVETYKQSGSSLERIHQRAKDAGVSIDPIPWDKVDKVYSAQEIKPLQH"
     CDS             101711..102100
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0090"
                     /old_locus_tag="TVA2723"
                     /product="membrane protein, MAPEG family"
                     /note="user locus_tag: VANGcII0090"
                     /protein_id="CDQ47987.1"
                     /translation="MVTALYASILSVLFLWLAINVIKQRRANQVRYADGGVPALQLAR
                     SAQGNAAEYIPITLILMGLLESNGASVWWIHGVGITFIVGRILHARAILSDQLKGRIR
                     GMKLTFSAMVILIVLNIIYLPFGQVLG"
     misc_feature    101723..102079
                     /note="HMMPfam hit to PF01124, MAPEG, score 5.5e-05"
     misc_feature    join(101723..101776,101921..101989,102026..102094)
                     /note="3 probable transmembrane helices predicted for
                     TVA2723 by TMHMM2.0 at aa 5-22, 71-93 and 106-128"
     CDS             complement(102110..102733)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0091c"
                     /old_locus_tag="TVA2722"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0091c"
                     /protein_id="CDQ47988.1"
                     /translation="MMKWIVGLSLLFSNVASLAATSVDWLQVKSEDGITIYSRHHSDG
                     LVQIRAQMFVPTSYFAFMRLLDDSEHVPNWIDNVSNSRVLKKISDTENIVYTQFSAPW
                     PAKNRDMVTYSKFEMLPNGLSLDIVDALNYLPEQPGYIRITQVNAHWTLQKLTNGMTH
                     IDYIAFANPGGALPNWLVNKLSTDSAFTTFEGLRRELATYQTSPCRE"
     misc_feature    complement(102137..102721)
                     /note="HMMPfam hit to PF01852, START, score 9.8e-05"
     misc_feature    complement(102677..102733)
                     /note="Signal peptide predicted for TVA2722 by SignalP 2.0
                     HMM (Signal peptide probability 1.000) with cleavage site
                     probability 0.943 between residues 19 and 20"
     CDS             102906..103655
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0092"
                     /old_locus_tag="TVA2721"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0092"
                     /protein_id="CDQ47989.1"
                     /translation="MKSLRWYEVWFCLILSWISIPVWAAPSSIHNSHIIRISAGEWPP
                     FIGQHLENNGFVAEIIRKAFKDAGYEVEFHFFPWARAYAEAKAGRYDATAIWMFNQER
                     TVDFYYSEAVSDERFVFFHHKETDFHWESLYDLKGLHLGGGIAYSYGAELDRLLETQQ
                     IKMSRVNDPKQNFERLAKKRIDLMPEEIHIGYYTLDKYLPQWREMITHHPKPFLINNN
                     YLLFPKMGERSEQLLTLFNHGLKESDVSMME"
     misc_feature    102906..102977
                     /note="Signal peptide predicted for TVA2721 by SignalP 2.0
                     HMM (Signal peptide probability 0.997) with cleavage site
                     probability 0.997 between residues 24 and 25"
     misc_feature    102924..102992
                     /note="1 probable transmembrane helix predicted for
                     TVA2721 by TMHMM2.0 at aa 7-29"
     CDS             complement(103713..104669)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0093c"
                     /old_locus_tag="TVA2720"
                     /product="membrane transport protein, putative auxin
                     efflux carrier protein"
                     /note="user locus_tag: VANGcII0093c"
                     /protein_id="CDQ47990.1"
                     /translation="MTTIIEQLLFSASITGPICLMLVLGVVLKRTGVINDNFIDVASR
                     IVFQVTLPAMLFLSIVKSQHDFSSSAALIGYGLLANFLFFLFTTFFTKKAFPQHLDHG
                     VIIQGGFRANTAIIALAYVANTYGEPGLALAAMYVAATTILYNIQAVITLTPKGESSG
                     LKAAGVIAKTLTKNPLIIGILLGVLCYSLSLPIPKMVTDAGQYFANMTLPLALLCTGG
                     SLNIGSLRSDKAPAWFATAHKLILAPILITSGALLFGFRGLDLGLVFLMSASPTAAAS
                     YVMARAMGGNATLAANIIALTTVFSLFTCTLGIFLLASLNLI"
     misc_feature    complement(join(103725..103793,103821..103889,
                     103908..103976,104004..104072,104091..104159,
                     104217..104285,104304..104363,104406..104474,
                     104493..104549,104592..104651))
                     /note="10 probable transmembrane helices predicted for
                     TVA2720 by TMHMM2.0 at aa 7-26, 41-59, 66-88,
                     103-122,129-151, 171-193, 200-222, 232-254, 261-283 and
                     293-315"
     misc_feature    complement(103743..104663)
                     /note="HMMPfam hit to PF03547, Mem_trans, score 9.1e-18"
     CDS             104796..105404
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0094"
                     /old_locus_tag="TVA2719"
                     /product="Putative transcription regulator protein, tetR
                     family"
                     /note="user locus_tag: VANGcII0094"
                     /protein_id="CDQ47991.1"
                     /translation="MSKGRITRENVLNKAFELASENGLESLTIGELAKQCGLSKSGLF
                     AHFNAKENLQIAVLEHAHSVFTERVITPARLIGDENIEAKLRVLLEHWLGWNHSFQGS
                     CMFLDAWKDAATCDCAIQKVLKKTIATWIHYLQIQIQKGVDSAQFHPKLDVKQAAYEL
                     YGLYLSAHLFYSIYGQMESYQHFWKGVGDLMSRWRNIVKQQC"
     misc_feature    104826..104966
                     /note="HMMPfam hit to PF00440, TetR_N, score 6.5e-11"
     misc_feature    104874..104939
                     /note="Predicted helix-turn-helix motif with score
                     1825.000, SD 5.40 at aa 27-48, sequence
                     LTIGELAKQCGLSKSGLFAHFN"
     CDS             105552..106409
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0095"
                     /old_locus_tag="TVA2718"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0095"
                     /note="Similar to Vibrio parahaemolyticus subname:
                     full=putative uncharacterized protein vpa0054
                     UniProt:Q87K44 (EMBL:BA000032) (285 aa) fasta scores:
                     E()=1.5e-79, 69.0% id in 281 aa, and to Vibrio
                     parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
                     subname: full=putative uncharacterized protein vpa0054
                     UniProt:Q87K44 (EMBL:BA000032) (285 aa) fasta scores:
                     E()=1.5e-79, 69.0% id in 281 aa"
                     /protein_id="CDQ47992.1"
                     /translation="MSEKIYFSTSNTFSVKRTLVNMSTRLHHTLAPSHAKKVARNVLL
                     TPARSKPQNLPPIGLKTGRVMCVEGALTTYQLGSGPIWLLTHGWSGTASQFYPLMEHI
                     AARGYTALAYDHPAHGQSEGVYGHIPAFVGGLEAILDSIDNVAGIVGHSMGTAAALEC
                     RHHKIEHCPMLLVAPVLDYLDNLFSSVARSGYSMRLFEAVVAEVADQYRYPIQSIDPY
                     HKLAQRQSRSVIVHDENDKFTKYSVSKRAAEEIEKVSLITTQNQGHGRVMKGEQVKYG
                     FDLLAGIPC"
     CDS             complement(106489..106590)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0096c"
                     /old_locus_tag="TVA2717"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0096c"
                     /protein_id="CDQ47993.1"
                     /translation="MRAYWQQYDHTYSNKEIIIIAKLLTLSRLWLTI"
     misc_feature    complement(106573..106641)
                     /note="1 probable transmembrane helix predicted for
                     TVA2717 by TMHMM2.0 at aa 37-59"
     CDS             106604..107989
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0097"
                     /old_locus_tag="TVA2716"
                     /product="Sodium/sulphate symporter transmembrane protein
                     (NadC family)"
                     /note="user locus_tag: VANGcII0097"
                     /note="The CDS seem to be truncated at the N-terminus (50
                     aa; cfr sequence upstream to the next M/TGA??)"
                     /protein_id="CDQ47994.1"
                     /translation="MNRNDSVPLPSNTREWFFNRNSLIILADIVLFFVLYNALPVDSN
                     VALGISMLAFIAVLWLTEALHVTVTAILVPIMAIVFGVFNTQTALNNFANSIIFLFLG
                     GFALAAAMHRQGLDKVIADKVLIMARGKMSVAVFMLFGVTAALSMWISNTATAAMMLP
                     LVLGVLSKVDKDRGHSTYVFVLLGIAYSASIGGIATIVGSPPNAIAAAEVGLSFTDWM
                     KFGAPTAAIMLPIAITILYFALKPDLNGEFELNYEPVTWDKGKVVTLGIFALTVFCWI
                     FSKPVNAMLGGFASFDTLVALGAIVLVNFARVVHWKDVEKTADWGVLLLFGGGICLSN
                     VLKQTGTSVFLANELSALISHLGLFFIVFVIAVFVVFLTEFASNTASAALLIPVFASV
                     AEAFGISPVILSVLIAIAASCAFMLPVATPPNAIVFASGHIKQSEMMRVGMMLNIACI
                     GLLTMIAMLFW"
     misc_feature    join(106781..106849,106868..106936,107033..107101,
                     107135..107203,107261..107323,107384..107437,
                     107450..107518,107555..107611,107654..107722,
                     107741..107809,107819..107887,107924..107983)
                     /note="12 probable transmembrane helices predicted for
                     TVA2716 by TMHMM2.0 at aa 10-32, 39-61, 94-116,
                     128-150,170-190, 211-228, 233-255, 268-286, 301-323,
                     330-352,356-378 and 391-410"
     misc_feature    107396..107986
                     /note="HMMPfam hit to PF00939, Na_sulph_symp, score
                     8.5e-22"
     misc_feature    107762..107827
                     /note="Predicted helix-turn-helix motif with score
                     1209.000, SD 3.30 at aa 337-358, sequence
                     PVFASVAEAFGISPVILSVLIA"
     misc_feature    107810..107842
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
     misc_feature    107834..107884
                     /note="PS01271 Sodium:sulfate symporter family signature."
     CDS             complement(108054..108686)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0098c"
                     /old_locus_tag="TVA2715"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0098c"
                     /protein_id="CDQ47995.1"
                     /translation="MNLIKPALCTLTMIFSASVLANITLEIPDTINLLAVNGQKPETS
                     GSLFSSAKSLELADGEQQIVFKYAPYFTQGNDRVIIESDAVIATFTAKDAKLNFAMPE
                     YRDAHRAEKEIKTMQWSLIDQAGQTLEIKQDRLLKEGYQVGRDYIREANDYNRAGGIA
                     AIGMTDVAMLQNELAQSGNVQNAAEEMLHFWYNKADEKTKARFKEFVNQQ"
     misc_feature    complement(108624..108686)
                     /note="Signal peptide predicted for TVA2715 by SignalP 2.0
                     HMM (Signal peptide probability 1.000) with cleavage site
                     probability 0.999 between residues 21 and 22"
     CDS             109153..111702
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0099"
                     /old_locus_tag="TVA2714"
                     /product="Putative glycosyl hydrolase (glycosidase),
                     family 18"
                     /note="user locus_tag: VANGcII0099"
                     /protein_id="CDQ47996.1"
                     /translation="MNRITLCAASIAMALSGTAMAAPATPSVDVYGSNNLQFSKVELA
                     MESTAGYNQMVKYYDQAPIAVKFNQWSGTTGNTYKIYFDGAQVATGPITGSQTTANFS
                     YAQGGVYQMAIEACDATGCSKSAPVEITIADTDGSHLKPLVMNIDPNNKTYTTDKDTV
                     VGTYFVEWGIYDRKYTVDNIPADNLTHILYGFIPICGPNESLKSVGGNSYNALMTACN
                     GVNDYEVVIHDPWAAYQKSFPQAGHQYSSPIKGNYAMLMALKQRNPDLKILPSIGGWT
                     LSDPFFDFTNKANRDTFVASVKKFLTTWKFYDGVDIDWEYPGGGGQAADRGDPVNDGP
                     AYIALMRELRAMLDELQSETGRTYELTSAIGVGHDKIEDVNYGEAIQYMDYIFAMTYD
                     FYGGWNNVLGHQTALYCGSFMRPGQCDGKGVDENGEPYKGPAYTADNGIQLLLAQGVP
                     ANKLVLGAAMYGRGWEGVMPASLSDPTDPMTGVGNGKLKGTSAQGVWEAGVIDYKGIK
                     SFMLGANNTGINGFEYGYDAQAEAPWVWNRTTGQLVTFDDNRSIKAKGAYARNLGLAG
                     LFSWEIDADNGDILNAMHESLAGGGTTPPANRVPTANAGVDQSVVGPVSVVLDGGASK
                     DSDGTIVSYVWQQTAGTAVSLVNANSARASFDAAEVVQVQTLTFKLTVTDNKGATASD
                     VVTVTVKPKATEPVNTPPVAVITAPSNASAGEVVVVDASASSDVDQDTLTFAWDVPAG
                     LNATIQGASVSFVAPEYTQDTTLSFTVTVSDGKAAASASASVIVAKKDSGGGDTCSNL
                     WDKSAVYTGGQQVSWAGKVWEAKWWTTGENPSTTGVWGVWKEIGPASCPTS"
     misc_feature    109153..109215
                     /note="Signal peptide predicted for TVA2714 by SignalP 2.0
                     HMM (Signal peptide probability 1.000) with cleavage site
                     probability 1.000 between residues 21 and 22"
     misc_feature    109210..109623
                     /note="HMMPfam hit to PF08329, ChitinaseA_N, score
                     6.9e-77"
     misc_feature    109627..110877
                     /note="HMMPfam hit to PF00704, Glyco_hydro_18, score
                     6.5e-129"
     misc_feature    109771..109803
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
     misc_feature    110071..110097
                     /note="PS01095 Chitinases family 18 active site."
     misc_feature    110956..111216
                     /note="HMMPfam hit to PF00801, PKD, score 0.014"
     misc_feature    111262..111504
                     /note="HMMPfam hit to PF00801, PKD, score 0.00017"
     misc_feature    111538..111666
                     /note="HMMPfam hit to PF02839, CBM_5_12, score 2.4e-13"
     CDS             111897..112268
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0100"
                     /old_locus_tag="TVA2713"
                     /product="Putative transcriptional regulator, GntR family
                     protein"
                     /note="user locus_tag: VANGcII0100"
                     /protein_id="CDQ47997.1"
                     /translation="MTDWQDNQPIFRQLADKITEQILQGIWLEDSALPSVRTVSADMK
                     INHLTVMKGYQLLVDEGIVEKRRGQGMYVAKGALAQLQAKQKQHFLEQQIPEIAQTLK
                     LLAMPLEDFINQLQQHIEGDQ"
     misc_feature    111924..112115
                     /note="HMMPfam hit to PF00392, GntR, score 9.7e-12"
     CDS             112265..113128
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0101"
                     /old_locus_tag="TVA2712"
                     /product="Putative ABC transporter ATP-binding protein"
                     /note="user locus_tag: VANGcII0101"
                     /protein_id="CDQ47998.1"
                     /translation="MNPLVEVNGVSKQYAKHAESEALQNVSFKLYAGQVLGLLGHNGA
                     GKSTLIKSLLGAHHYQGDILIQGLNPITEHAQVMAHLSYISDVNVLPDWMTVKQILRY
                     TSGVHPSFSLDKATQVLTQTNIRLSSKIRTLSKGMKVQLHLAIVIATDTKVLILDEPT
                     LGLDLIYRDTFYRHLLEWFHDGERALIIASHEVSEIEHLLTDVLILKQGKVVLQDSME
                     AITQGYFVLEASNAHQDVIQTYRPLASQPSLGTTKWLLTSEHRQAVEGLGSIYSVKLA
                     ELFLALQKESA"
     misc_feature    112361..112891
                     /note="HMMPfam hit to PF00005, ABC_tran, score 1.8e-37"
     misc_feature    112382..112405
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
     misc_binding    113072..113086
                     /gene="parS2-G"
                     /bound_moiety="parB2"
                     /note="parS2-G, ref: Yamaichi, Y., et al. (2007). Distinct
                     centromere-like parS sites on the two chromosomes of
                     Vibrio spp. Journal of Bacteriology 189(14): 5314-5324.
                     Search-seq: ATTTAsArTGyAAA(G/t)"
     CDS             113128..113985
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0102"
                     /old_locus_tag="TVA2711"
                     /product="membrane protein"
                     /note="user locus_tag: VANGcII0102"
                     /protein_id="CDQ47999.1"
                     /translation="MHPSIYMLEKELIENKNVTRIPLFLLVCGTLLFISLLMNNTLQH
                     NLFFEMEFGGDISDVHIEFVDDFNTFIIMLVGFISLMLSSLYFPRTFRKERKEGSSMF
                     WRSMPVTNNMTHIVKLGFGLFVIPVVCSVLVICADALLWGLNLATENRLALLFEQRSL
                     GYAVQHWLNYLSIMWVIAVTMLPLACFTLVISQIFNSPILVMFVGGFVLKWISIVMLN
                     SDIVGEFYHAIFNLPLQLMTSSNMFTAFEGAGWGNLFVYIMIGIASYWISHKLYSTDE
                     LSLKSLLTR"
     misc_feature    join(113188..113241,113335..113388,113482..113550,
                     113635..113703,113722..113790,113860..113928)
                     /note="6 probable transmembrane helices predicted for
                     TVA2711 by TMHMM2.0 at aa 21-38, 70-87, 119-141,
                     170-192,199-221 and 245-267"
     CDS             114311..116197
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0103"
                     /old_locus_tag="TVA2710"
                     /product="putative methyl-accepting chemotaxis protein"
                     /note="user locus_tag: VANGcII0103"
                     /protein_id="CDQ48000.1"
                     /translation="MFKKMSLKNKLAISASAAIILGGLLVEALSYRAALERLDIDVEQ
                     RLQSTTASYNQYVTDWLLSKERALTSLSQDAEKQAIVTHLKQVRDSAAFDNVFLAYPD
                     GSQNNANGVILPPGNDDPRKWGWYTNAKANPSKVFMDNPTVAAATGANVVSLGKALNL
                     NGQQVVLGADVEITDILNSMKQVILPGEGYMFIANDKGNIFTHSDTKLLNKSVSDLGL
                     NFADIRQAIAKSSDLLVDIRGEEYVLYARSINGTNLSTVVVINHDSLIAPLSEATFSQ
                     LIVTAVVVILCTLLFNLLCNILFRPLNNVSQALAQIANGSGDLTQRIEVENSDEVGEL
                     ARNFNTFVESLQQLIGHIRHQSHQLEAQSEHGAHRANQSASELSHQQQEIVMVATAVT
                     EMASATQEIASHAEQTARAAQDSATSTNNGHALVIHTKGSINNLAKSVSEASGVIAAL
                     NQHAQEISTVLATIQGIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRVLSQRTHT
                     STEEIKSTIDTLQETTKRAVSLMQSSSTLAENSVEDADKASGALEEIKAAVALISDMA
                     TQIATAAEEQTHVTSEITQNVTSIKDVTEQLVIGAEDSLSQSNELKQQAEELSAKVAT
                     FKLA"
     misc_feature    114311..114394
                     /note="Signal peptide predicted for TVA2710 by SignalP 2.0
                     HMM (Signal peptide probability 0.999) with cleavage site
                     probability 0.504 between residues 28 and 29"
     misc_feature    join(114347..114415,115139..115207)
                     /note="2 probable transmembrane helices predicted for
                     TVA2710 by TMHMM2.0 at aa 13-35 and 277-299"
     misc_feature    114806..114958
                     /note="HMMPfam hit to PF02743, Cache_1, score 1.3e-08"
     misc_feature    115136..115351
                     /note="HMMPfam hit to PF00672, HAMP, score 1.8e-19"
     misc_feature    115442..116194
                     /note="HMMPfam hit to PF00015, MCPsignal, score 1.9e-59"
     CDS             116359..117093
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0104"
                     /old_locus_tag="TVA2709"
                     /product="putative transcriptional regulator"
                     /note="user locus_tag: VANGcII0104"
                     /protein_id="CDQ48001.1"
                     /translation="MNETKLSASQVNEKSLQLLMQVAVNEEPVSAKTLSEQLQVPLSS
                     LYRHLKILKEWNLIEESPHDKTLIIGSAALLLMRSYETSQHNLDAVDAVLSRLQKQTG
                     EMAAYMVPVGYRALCVSQKESMQALRCSFVQGQSQPLLRGASSKVMLAYLPAPRCEKI
                     LRYFGEDHQMEKWQTELEKIRRNGYAVSTSEIDPGVSGISAPVMKGSKLIGAISVMAP
                     AHRVETNKQRIILHVLQAARALPPER"
     misc_feature    116398..116553
                     /note="HMMPfam hit to PF08279, HTH_11, score 0.0024"
     misc_feature    116443..116508
                     /note="Predicted helix-turn-helix motif with score
                     1123.000, SD 3.01 at aa 29-50, sequence
                     VSAKTLSEQLQVPLSSLYRHLK"
     misc_feature    116737..117090
                     /note="HMMPfam hit to PF01614, IclR, score 1e-06"
     CDS             117100..117936
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0105"
                     /old_locus_tag="TVA2708"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0105"
                     /protein_id="CDQ48002.1"
                     /translation="MLSLFKRYRMSRTQSQPAYPFTFMTLCEQIKPMSQVEFEFAQQS
                     LEFASDWLYQRQSTPCYSDAGHIVVKDKNATRFQDTLSHQLALSSVPVVLANCHEMLL
                     NALPVMAFENDEVGIVSIGHHFELKQTLDLQVGSAFHFALSRYNNTRLFCIGIDEMHQ
                     SNQVWEYAEDLGCDWLTLNECGFRHRNQLKSQLGHYIEHCDQLIVTIDLASLVPGVGV
                     DENNALDNQMVLRTLRQCALSGKVKLIQLVGAKDKLIYSKQTKEILDELCALSPDVIH
                     AA"
     CDS             complement(118054..119517)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0106c"
                     /old_locus_tag="TVA2706+07"
                     /product="Putative chemotaxis protein (methyl-accepting)"
                     /note="user locus_tag: VANGcII0106c"
                     /protein_id="CDQ48003.1"
                     /translation="MYSLSAQTYQQMAASLAENVATSVRFNKVESLEERVKVAVDSSN
                     KELKHIAVFLADGSLFYQLNEKSVSPSGVNIKNALTQASTNAIIIEQSTQHVIIINPL
                     TSGKEAKLVGYLVTQWQFDKVNAISKELGLWAISIGITFVLITFIGLFFILRSALLHP
                     LNQLKNLCESLASGRCDLKQRIPFNKDNELGDLATAINMFIEKVEHTFHPIEQNICNV
                     TDVTKAVERQVKQLEHNINGQQREIAQSVQIGEGARQSIASVTENINTASLSLQQAVI
                     SGQESQQQLKHALSENKNLAEKSQVTAKTAESLNAQVEKVTDILQIIRTIADQTNLLA
                     LNAAIEAARAGENGRGFAVVADEVRNLAEKTSSSTNQVEEILTVLSNFSKDLIGYMGE
                     SVNASMSCVEAIESSNELVSQAIKDVNQANNANHLAVNSSDEQLSHVEDLLTQLSNLN
                     QHSLELLNDSKVMSDCSKELFQKAQATSLSLSKFSAH"
     misc_feature    complement(118396..118599)
                     /note="HMMPfam hit to PF00015, MCPsignal, score 3.5e-33"
     misc_feature    complement(119060..119130)
                     /note="1 probable transmembrane helix predicted for
                     TVA2706 by TMHMM2.0 at aa 130-152"
     CDS             complement(119646..120206)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0107c"
                     /old_locus_tag="TVA2705"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0107c"
                     /protein_id="CDQ48004.1"
                     /translation="MKYFICLIACFSFSSFANEFEGALKNFIDTEVAEIIANPVLIQA
                     INAQNAQHANLTQMQIDQLDKDWRSQVGQTDAPLINKLLSSPASSELKSIQQASNGLI
                     TEIFAMDNKGLNVAQSEITSDYWQGDEEKWQDTYLKGPSAYLIGEIEEDESTQMFQSQ
                     ISHSVVDPSSGKVIGAITIGVNVEAL"
     misc_feature    complement(120156..120206)
                     /note="Signal peptide predicted for TVA2705 by SignalP 2.0
                     HMM (Signal peptide probability 1.000) with cleavage site
                     probability 0.941 between residues 17 and 18"
     CDS             120649..122526
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0108"
                     /old_locus_tag="TVA2704"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0108"
                     /protein_id="CDQ48005.1"
                     /translation="MWKREEQESQFSEMIEARLSRRRFMAGSAAVSAGAFLSLNPVAK
                     AVAAKSSSSLLNFEAIPVSTADAIVVPKGYKATPLISWGDPISVDAPEFDQSGKQDSR
                     AQELQFGDNTDGMSFFPISDDRGVLAINNEYTNYEYLFDHKGKSMTADDVRKAQAAVG
                     VTVVEVMNKNGQWTVDRAGKRNRRITANTPMLLTGPAAGHTLMKTATDPKGLNPLGTF
                     NNCANGQTPWGTYLTCEENFDDFFGSNQDGVKLTADHKRYGIEAKPSDYQWHQHDERF
                     DVAKNPNEPNRFGWVVEIDPNDPTSTPLKRTALGRFKHENAALTLNKDGHAVVYLGDD
                     ERGEHLYKFVSKNRYQAGNDAANRNLLEEGTLFVAKFDMNEKELKGSGKWLELTFGKN
                     GLTPENGFKDQAEVMIFARRAATQVGATTMDRPEWVAIHPDNKHVFCTLTNNKNRGKE
                     GQPVGGPNPRAKNNYGQILRWMPANEDHTSTVFAWDLYLIAGNPTVHKGDLYAGSDNI
                     SADNMFNSPDGIGFDKAGRLWIQTDGNYSNKGDFAGQGNNQMLCGDPITGEVKRFLTG
                     PIACEITGLTFSPDQKTMFVGVQHPGEDEAPSHFPYGGTTKPRSTIMMITREDGGVIG
                     A"
     misc_feature    120697..122424
                     /note="HMMPfam hit to PF05787, DUF839, score 0"
     CDS             122845..123594
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0109"
                     /old_locus_tag="TVA2703"
                     /product="membrane-associated phospholipid phosphatase"
                     /note="user locus_tag: VANGcII0109"
                     /note="aa-sequence different from pgpA and pgpB genes of
                     Escherichia coli"
                     /protein_id="CDQ48006.1"
                     /translation="MKKQIQMKKSGLVLLALFSLLLVPISLVGSSIDLTTPVSEGVGA
                     FFTYLTDSAGWQGFGFTFALLAFLATRTATSRIELLNRIIQIGLLLVIGMAAKTGLKY
                     LTESPRPYTELMTYELLIPNPAHFYKLSELQKESVMTDIATQVSDWRLRHWQGEKDYS
                     FPSGHTIFAAICLAFFGGLFMEQKRYIFAAGLLLWACGVAFSRLWLGMHRPVDLYGSL
                     LFVSMIYLVIPKVYPLDHPKLKPLLTRLHLC"
     misc_feature    122845..122931
                     /note="Signal peptide predicted for TVA2703 by SignalP 2.0
                     HMM (Signal peptide probability 1.000) with cleavage site
                     probability 0.432 between residues 29 and 30"
     misc_feature    join(122881..122940,122998..123051,123319..123387,
                     123397..123465,123484..123543)
                     /note="5 probable transmembrane helices predicted for
                     TVA2703 by TMHMM2.0 at aa 13-32, 52-69, 159-181, 185-207
                     and 214-233"
     misc_feature    123088..123558
                     /note="HMMPfam hit to PF01569, PAP2, score 2e-14"
     CDS             complement(123684..124388)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0110c"
                     /old_locus_tag="TVA2702"
                     /product="putative membrane protein"
                     /note="user locus_tag: VANGcII0110c"
                     /protein_id="CDQ48007.1"
                     /translation="MNKSLLTNIIALALLAAGYQLDNTIALYAGLFAFSGAITNWLAI
                     HMLFEKVPGLYGSGVIPARFEEFKTAIKSLMMEQFFTQSNIDRFLSKEMTGSKTLDLE
                     PVIAKVDFNPTFDSLVEVIANSPFGGMLAMFGGTDALQPLKQPFVEKMQQSMIDISQS
                     DSVKQALKEQLEAPEMIEEITANIENIIDQRLNELTPKLVKEMVQKMIKQHLGWLVVW
                     GGVFGGLIGVASSFFA"
     misc_feature    complement(join(123690..123758,124257..124316,
                     124326..124376))
                     /note="3 probable transmembrane helices predicted for
                     TVA2702 by TMHMM2.0 at aa 5-21, 25-44 and 211-233"
     misc_feature    complement(124341..124388)
                     /note="Signal peptide predicted for TVA2702 by SignalP 2.0
                     HMM (Signal peptide probability 0.874) with cleavage site
                     probability 0.320 between residues 16 and 17"
     CDS             complement(124486..126330)
                     /transl_table=11
                     /gene="vcaM"
                     /locus_tag="VANGNB10_cII0111c"
                     /old_locus_tag="TVA2701"
                     /product="ABC-type multidrug efflux pump"
                     /note="user locus_tag: VANGcII0111c"
                     /note="Similar to Vibrio cholerae non-O1 vcam subname:
                     full=abc-type multidrug efflux pump UniProt:Q93GU0
                     (EMBL:AB073220) (619 aa) fasta scores: E()=1.6e-179, 83.7%
                     id in 613 aa"
                     /protein_id="CDQ48008.1"
                     /translation="MYKKFESFTQAFPKEEPKQPPATLWAFCRYYTRGFEKPLILMAL
                     ISTLIAVVEVSLFGFMGQLVDWLSSSNPETFLTENRDTLIGLSILVLVIMPLLIGIYS
                     LLIHQTMLGNYPMSIRWLAHRYLLKQSLSFYQDDFAGRIATKVMQTALSIRETVMKTL
                     DVFVYVSVYFTAIVVMLAQADWRLMVPMLVWLAAYICIQLHFVPQLKKVASEQADARS
                     TMTGRIVDSYTNIATVKLFSHTRRETDYAEQGMESFLDTVHRQMRLVTGFNLCVELAN
                     YILVFVIAATSIYLWMQSAISIGAIAIAISLSLRINGMSKWIMWEVGALFENMGTVVD
                     GMKTLSKPITIEDKPNAKPLQVAQGGIEFDDVSFHYGENKGVINHLNLTIKPGEKVGL
                     VGRSGAGKSTLVNLLLRFHDVEGGQIRIDGQAINEVTQDSLRSKIGMVTQDTSLLHRS
                     IRDNILYGNPDASEEQLLQATRQAHAHEFIETLTDPFGNLGYDAQVGERGVKLSGGQR
                     QRIAISRVLLKDAPLLVLDEATSALDSEVEAAIQESLNELMQGKTVIAIAHRLSTIAA
                     MDRLIVLDKGNVVEQGTHQELIAQNGIYAHLWAHQTGGFIGCDDVEIA"
     misc_feature    complement(124507..124539)
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
     misc_feature    complement(124603..125172)
                     /note="HMMPfam hit to PF00005, ABC_tran, score 1.4e-56"
     misc_feature    complement(124780..124824)
                     /note="PS00211 ABC transporters family signature."
     misc_feature    complement(125128..125151)
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
     misc_feature    complement(125386..126216)
                     /note="HMMPfam hit to PF00664, ABC_membrane, score
                     4.6e-05"
     misc_feature    complement(join(125404..125463,125473..125541,
                     125722..125781,125791..125847,126016..126084,
                     126148..126216))
                     /note="6 probable transmembrane helices predicted for
                     TVA2701 by TMHMM2.0 at aa 39-61, 83-105, 162-180,
                     184-203,264-286 and 290-309"
     CDS             126842..127813
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0112"
                     /old_locus_tag="TVA2700"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0112"
                     /protein_id="CDQ48009.1"
                     /translation="MMLQEQVITQPAVNTVQNANCVVMVPPKEFKFNAQTAQDNEFQH
                     QVALSTEQVRIQAMAEYQSMVETLRLEGVQVVEFDYPLSEVETPDAVFPNNWFSTTPE
                     GTLFTFPMACKNRQQEVRPQALVEALTLSGRKVLAQDSLLAYQDQQAYLESTGVMVMD
                     HLNRTIYSALSQRCDREVLEEYAKRIGYDRVVSFQTALPSGQPVYHTNVMMAVGEAFC
                     VICDEVIPEFERRFVVKSLAKDKQIISISLEQMNCFCGNILQLETAAGDKVIAMSQSS
                     FDAFSLAQRAQLASHGKLLPCNVKTIEDIGGGSVRCMLGEVFLPSIG"
     CDS             complement(127803..128759)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0113c"
                     /old_locus_tag="TVA2699"
                     /product="Putative diguanylate cyclase with PAS/PAC
                     sensor"
                     /note="user locus_tag: VANGcII0113c"
                     /protein_id="CDQ48010.1"
                     /translation="MEEYLKRIKQLEEQVEHLKKENSSLEEKLNATLEGTGLCLWEQH
                     IPSGTLKIFNREWGDMLGYQSHELDATVDIWKSKLHPDDYDLAVGAFEDHLNGKADTY
                     QVIHRMIRKDGGQSWVSDRGRIVEYDENGKPLRMMGTHTDITNEKHYELELSKLAAQD
                     PLTNLLNRKALETKFDEMNDLVEHPAALIFIDLDDFKTVNDHLGHQAGDFVLLQVSQW
                     LQENAPQPSSIARLGGDEFVLLCINQSTETLKQFIDSLLTKAYSPLKLSHGEVQIGFS
                     IGVCQFTTSMHTFETLYELADQAMYQVKKNGKNGVEYINLSQ"
     misc_feature    complement(127830..128303)
                     /note="HMMPfam hit to PF00990, GGDEF, score 2.6e-43"
     misc_feature    complement(128322..128612)
                     /note="HMMPfam hit to PF08447, PAS_3, score 1e-26"
     CDS             complement(128879..129301)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0114c"
                     /old_locus_tag="TVA2698"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0114c"
                     /protein_id="CDQ48011.1"
                     /translation="MKLLHLQLFWYEKHHTLLEMEALPTLTPTQEQALAEWVKCRRKI
                     LSFEAHQHTWVKVNVDGFSSALHLKPNGTLVERDLFGEKTLQGLWKAIDGFLFIKVIS
                     GEFIVEYQIVGNNEQSIHCGIEYINGRVSTYSKFIQTK"
     CDS             complement(129490..130371)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0115c"
                     /old_locus_tag="TVA2697"
                     /product="Putative hexulose-6-phosphate isomerase SgbU"
                     /note="user locus_tag: VANGcII0115c"
                     /protein_id="CDQ48012.1"
                     /translation="MYQHLPRQRIGLYEKALPNHFSWEEKLATTKELGFDFLEISVDE
                     SDERRQRLDWDDATIYQLRRWCEQYQIPLQSMCLSAHRKFPFGSSDPAIREQAILHME
                     KAITLAYKLGIRTIQLAGYDVYYEPANKETHQRFIEGMQLAAKLAERAGVMLAVEIMD
                     TSYLNSLSKFEILKREVPSPYFMAYPDVGNISGWNYDVCTELALGMPHITQIHLKDTH
                     CVTSSSTGQFRDLVIGEGEVNFDAISQTLKEANCVVPMVIEMWAQDEHWKHNIRVAQH
                     RLNQACDAADSPRLFNL"
     misc_feature    complement(129658..130293)
                     /note="HMMPfam hit to PF01261, AP_endonuc_2, score
                     1.7e-39"
     CDS             complement(130380..131027)
                     /transl_table=11
                     /gene="sgbH"
                     /gene_synonym="yiaQ"
                     /locus_tag="VANGNB10_cII0116c"
                     /old_locus_tag="TVA2696"
                     /product="Putative hexulose-6-phosphate synthase SgbH"
                     /EC_number="4.1.1.85"
                     /note="user locus_tag: VANGcII0116c"
                     /note="Similar to Escherichia coli (strain K12) sgbh
                     recname: full=3-keto-l-gulonate-6-phosphate decarboxylase
                     sgbh short=kgpdc ec=4.1.1.85 altname:
                     full=3-dehydro-l-gulonate-6-phosphate decarboxylase
                     UniProt:P37678 (EMBL:AP009048) (220 aa) fasta scores:
                     E()=5e-38, 48.4% id in 215 aa"
                     /protein_id="CDQ48013.1"
                     /translation="MTKPMIQIALDQTDLISAIEVAKNVASFVDVIEVGTILAFAEGM
                     KAVKTLRHNHPDHILVCDMKTTDGGAILARMAFEAGADWITVSAAAHIATISACKKVA
                     DELDGEIQIEIYGNWTFADAQAWIDLGITQAIYHRSRDAELAGIGWTSEDVEKMRTLS
                     DMGLELSITGGIVPEDLYLFEGIKAKTFIAGRALVGEKGRVTAEALRSQIDRFWC"
     misc_feature    complement(130410..131018)
                     /note="HMMPfam hit to PF00215, OMPdecase, score 4.8e-56"
     misc_feature    complement(130734..130766)
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
     CDS             complement(131033..131854)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0117c"
                     /old_locus_tag="TVA2695"
                     /product="putative uncharacterized (hydrolase) protein"
                     /note="user locus_tag: VANGcII0117c"
                     /protein_id="CDQ48014.1"
                     /translation="MYKVLALDLDGTVLTDEHTIHPQLKQAIQQAQQHCHVVIVTGRH
                     HTAAKPYYQELGLTTPIICCNGTYVYDYQNEKVLKHNAITKHDALTFLALAKEFQMKL
                     VMYVTDAMTYSKRSPIAYMQALEKWANQYPPTAQPKIEQIDSFRHRVEQETFIWKFVV
                     EGLPSSVERLAQQAWVQETFNGERSWSNRVDFAAKGNSKGQRLAEYVQSLGYHANHVL
                     AVGDNHNDISMLDYAGLGVAMLNADDTVKSHAKLICTTDNNHDGLAHLIRDKIQG"
     misc_feature    complement(131054..131842)
                     /note="HMMPfam hit to PF08282, Hydrolase_3, score 4.2e-85"
     misc_feature    complement(131129..131197)
                     /note="PS01229 Hypothetical cof family signature 2."
     misc_feature    complement(131810..131845)
                     /note="PS01228 Hypothetical cof family signature 1."
     CDS             complement(131860..132552)
                     /transl_table=11
                     /gene="ulaF"
                     /locus_tag="VANGNB10_cII0118c"
                     /old_locus_tag="TVA2694"
                     /product="L-ribulose-5-phosphate 4-epimerase UlaF"
                     /EC_number="5.1.3.4"
                     /note="user locus_tag: VANGcII0118c"
                     /note="Similar to Salmonella paratyphi A ulaf recname:
                     full=l-ribulose-5-phosphate 4-epimerase ulaf ec=5.1.3.4
                     altname: full=phosphoribulose isomerase altname:
                     full=l-ascorbate utilization protein f UniProt:Q5PJ61
                     (EMBL:CP000026) (228 aa) fasta scores: E()=1.7e-63, 64.0%
                     id in 228 aa"
                     /protein_id="CDQ48015.1"
                     /translation="MYSELKQRVFAANLKLPQYGLVTFTWGNVSEIDREKGVIAIKPS
                     GVEYDVMKVDDMVIVDLNGAIVEGTLNPSSDTATHLELYKAYPEIGGVVHTHSRSATI
                     WAQAGIDIPALGTTHADYFYGDIPCTRKLSCDEIAGQYEKNTGLVIIEEFKHRRIDPM
                     AVPSVIVAGHAPFSWGKDANDAVHNAVVLEEISAMALATRSLNSGIKIQPELSDKHYQ
                     RKHGDNAYYGQR"
     misc_feature    complement(131905..132534)
                     /note="HMMPfam hit to PF00596, Aldolase_II, score
                     3.5e-100"
     CDS             complement(132560..133042)
                     /transl_table=11
                     /gene="ulaC?"
                     /locus_tag="VANGNB10_cII0119c"
                     /old_locus_tag="TVA2693"
                     /product="ascorbate-specific phosphotransferase enzyme IIA
                     component, ulaC"
                     /note="user locus_tag: VANGcII0119c"
                     /protein_id="CDQ48016.1"
                     /translation="MGLKQSLIDNDSIQLNAQASTWQEAIKIGTDRLIKSGAIHPCYH
                     DAIISSVEQLGPYIVIAPNLALPHARPENGVIRTAFALVTLQTPVYFDGEDEPVDVLI
                     TLAGSSSDQHMEGLMEVTQVLDDEESETGVDLDKLRRCRTAQDVYQVIDEALAAQLVE
                     "
     misc_feature    complement(132584..133027)
                     /note="HMMPfam hit to PF00359, PTS_EIIA_2, score 1.4e-44"
     misc_feature    complement(132836..132886)
                     /note="PS00372 PTS EIIA domains phosphorylation site
                     signature 2."
     CDS             complement(133117..134877)
                     /transl_table=11
                     /gene="ulaA"
                     /gene_synonym="sgaT"
                     /locus_tag="VANGNB10_cII0120c"
                     /old_locus_tag="TVA2692"
                     /product="ascorbate-specific permease IIc component"
                     /note="user locus_tag: VANGcII0120c"
                     /note="Similar to Escherichia coli (strain K12) ulaa
                     recname: full=ascorbate-specific permease iic component
                     ulaa altname: full=ascorbate-specific pts system eiic
                     component UniProt:P39301 (EMBL:AP009048) (465 aa) fasta
                     scores: E()=3.3e-119, 65.4% id in 462 aa"
                     /protein_id="CDQ48017.1"
                     /translation="MQFIYDIFYIFYSQVMTKAPLLLGLVTLIGYWLLRRDTTTIIKG
                     SIKTIVGFMLVQVGAGTLVAGFKPVIEKLSEYHGLTGSVIDPYTSMMATMEIMGDDYS
                     WVGYTVLLALAINILLVLLRRYTGIRTIMLTGHIMFQQAGLIAVFYLVLGASMWETIL
                     YSAVLMALYWSISSNIMFKPTEAVTGGAGFSIGHQQQVASWIAVKIAPKLGDKNESVD
                     HLELPKWLHIFHDSIAATAIVMTLFFGIILLSFGLDNLQAMAGKTHWSIYILETGLKF
                     AVAIQVIVAGVRMFVAELSEAFKGISERVIPNAVLAIDCAAIYAFSPNAMVFGFMWGA
                     IGQFTAVLAMLAFDAPIMIIPGFIPMFFSNATIGVFANHFGGWRAVMKICFVMGIIEV
                     VGSAWAIHIFNQYGTEFSGWMGMADWALVFPPIMQGLSVSKLFFFVLIALAGVYMFFA
                     SKKLREEEDAQGLVNISDDPEVIAAVEQALKVSDGVRPVSILAVCGNGQGSSMMMKMK
                     IGKYLEKKGIPHVMDSCAVSDYKSKLATTDIIVSSKHLSGEMEPGEGKFVLGVQNMLN
                     PNSFGDELLDIIDKNFVTLK"
     misc_feature    complement(133141..133410)
                     /note="HMMPfam hit to PF02302, PTS_IIB, score 2.5e-31"
     misc_feature    complement(join(133537..133605,133663..133731,
                     133768..133827,133837..133905,134119..134181,
                     134386..134454,134515..134574,134680..134748,
                     134782..134850))
                     /note="9 probable transmembrane helices predicted for
                     TVA2692 by TMHMM2.0 at aa 10-32, 44-66, 102-121,
                     142-164,233-253, 325-347, 351-370, 383-405 and 425-447"
     misc_feature    complement(133615..134865)
                     /note="HMMPfam hit to PF04215, SgaT_UlaA, score 6.5e-248"
     CDS             135268..136023
                     /transl_table=11
                     /gene="ulaR"
                     /locus_tag="VANGNB10_cII0121"
                     /old_locus_tag="TVA2691"
                     /product="HTH-type transcriptional regulator UlaR"
                     /note="user locus_tag: VANGcII0121"
                     /note="Similar to Escherichia coli O157:H7 ular recname:
                     full=hth-type transcriptional regulator ular
                     UniProt:P0A9W2 (EMBL:AE005174) (251 aa) fasta scores:
                     E()=2.5e-61, 59.4% id in 251 aa"
                     /protein_id="CDQ48018.1"
                     /translation="MNEVQRHNEILSLLDNMRTINVTHIIEKFNVSPATARRDISKLD
                     ELGKLKKVRNGAERLEIRKRAWTPLNIDSTDHFHEKSQIAMAAAKLCNPGDSVVINCG
                     STAFLLGKELCGQDVQIVTNYFPLASYLINEDHDDVIIIGGQYNKAQNIFLNPAPDSL
                     GGYAGHWMFTSGKGLTENGLYKTDMLTAVAEQQMLEQIGKLVVVVDSSKVGQRTGMLF
                     CPASKVDIVITGKAADPQVIQALQQQGTEVILV"
     misc_feature    135283..135387
                     /note="PS00894 Bacterial regulatory proteins, deoR family
                     signature."
     misc_feature    135283..135453
                     /note="HMMPfam hit to PF08220, HTH_DeoR, score 9.7e-20"
     misc_feature    135325..135390
                     /note="Predicted helix-turn-helix motif with score
                     1231.000, SD 3.38 at aa 20-41, sequence
                     INVTHIIEKFNVSPATARRDIS"
     misc_feature    135496..135957
                     /note="HMMPfam hit to PF00455, DeoR, score 8.2e-50"
     CDS             136147..137214
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0122"
                     /old_locus_tag="TVA2690"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0122"
                     /protein_id="CDQ48019.1"
                     /translation="MSKIDEITRDSWVLSTFPEWGTWLNEEIEKTEVEANTFAMWWLG
                     CTGIWLKSAGNTNLSIDFWCGTGKKTQKNALMNQQHQMMRMGGVRELQPNLRTSPFVL
                     DPFGIKEIDAVLATHDHADHIDINVAAAVLQNCGEHVKFIGPQACVDLWQGWGVPSER
                     CIVAKVGDCIEVGDISIRVLDSFDRTALITLPKGVSSYDKGILDGMDDRAVNYLLETS
                     GGSIYHSGDSHYSNYYAKHGNDYKIDVALLSYGENPRGITDKLTASDILRAGEALDCE
                     VVIPFHHDIWANFQNDPREIEVLWQMKKDRLQYGFAPFFWQVGGKYTYPTDKGRMHYQ
                     HFRGFKDIFVDEPELPFKAFL"
     misc_feature    136249..136281
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
     CDS             complement(137316..139277)
                     /transl_table=11
                     /gene="glgX"
                     /locus_tag="VANGNB10_cII0123c"
                     /old_locus_tag="TVA2689"
                     /product="glycogen debranching enzyme GlgX"
                     /note="user locus_tag: VANGcII0123c"
                     /protein_id="CDQ48020.1"
                     /translation="MKCTISSPYPLGATLDNTGCNFAIHAPANKQLLLALFDQQGSFT
                     THELENEYAGVKYTHVPNIKAGQKYGYLILNGDEPHYISDPYAKAIDKNLGYKTPFSS
                     KKSFELPKCVVVDDQFDWQSTKKPHIPRDKTILFETHVKGVTKLNPRVPKAEQGTYLG
                     LISEEMLEFYRKQNINTLQLLPIAACMHEPHLLDMGKVNYWGYNPYLFMVPDPRYAQK
                     DAVTELKTAIRELHRHGIEVILDVVYNHSAEGGEDGPIFNLKALDPKYYLKHGQHYAN
                     FTGCGNTIDLSYQPALNLVMDTLRYWVSEYQVDGFRFDLAATLGRNGDNFSPDAAFFK
                     AVAQDPTLKRVKLIAEPWDIGPNGYQVGNFPFGWNECNDKLRDITRSFWRGDQGYLKE
                     FATRLMGSRDLYSAANWPYKLTVNYITYHDGFTMQDLVSYKHKHNEANGEQNRDGHGD
                     NRSDNYGVEGETENMVIKATREKQKRNMMASLLFAFGIPHILTADVLSHTQQGNNNAY
                     CQDNEISWLDWNMTERKSYFKHWLSQMVAARHLYMVPFIRAFSGEERNANRVFWRRVD
                     GTLMEHDDWNRLSSVALQMGIGSDGAEMLYLINQTNAPARFTLPKDRNQNWEVICDTN
                     LRNVQPGHAEGELLQSPISMTILHYQPEV"
     misc_feature    complement(138330..138611)
                     /note="HMMPfam hit to PF00128, Alpha-amylase, score
                     1.6e-09"
     misc_feature    complement(139017..139250)
                     /note="HMMPfam hit to PF02922, Isoamylase_N, score
                     0.00045"
     CDS             139752..141026
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0124"
                     /old_locus_tag="TVA2688"
                     /product="putative porin, LamB type"
                     /note="user locus_tag: VANGcII0124"
                     /protein_id="CDQ48021.1"
                     /translation="MKKVSVIAAAVAATLAAGSAFAAETDVLKDGWEVHGYASMNFRM
                     VDGETVDTEFGKPDYKTAGTHGKSTNQVEFVIKKHTEHENGVWSNFTVRSEYGNGNSY
                     AYSSSGSQKANDTAQFEVKETFVEIGGLSYLGEDTSIWAGQRFLNRAAGILSGEFWKQ
                     SSGVGAGVQTKLAGNTAGFAVVVADPDAGAATTNPERTTLSSYDLYYYGVDVGFGSLD
                     FDFKYMEQANKDSKSDDGFGASITLNSSYYGLDGWAQSAIAYGKGVAQNRGVNFGGWS
                     GGDDKQESIFLTSYGVLNISENWQMGSEITYFGALDELFGAKDLKRYIAAVRPSYKVN
                     DNLRLEMTGSYAHEEGAEGYWGRTGEALESDIFNVELAAAFTVNADYFGRPQIKPYIS
                     YISADDEASASQIGIKDGKNETVIGVHTEIWF"
     misc_feature    139752..139817
                     /note="Signal peptide predicted for TVA2688 by SignalP 2.0
                     HMM (Signal peptide probability 1.000) with cleavage site
                     probability 1.000 between residues 22 and 23"
     CDS             141092..141937
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0125"
                     /old_locus_tag="TVA2687"
                     /product="Putative maltose operon periplasmic protein"
                     /note="user locus_tag: VANGcII0125"
                     /protein_id="CDQ48022.1"
                     /translation="MNNKKSLMTLILGAALTACSSVPSTSNLSSTEAISYAKVCCNNY
                     ADFPWIELQSNESIEFDIDESAPIGHFTDGNSYFNAFQLPQRSAKVQIQLSSYMFDKA
                     VFLPKLIMLDQTFNIVSEIDLPQFKIKTSDAFTRTQYYVNVQVDSKQTPYFIIYSPEQ
                     YFGKTIKVDHPAKVRAKDLGEAMPMVTDPTYISSHFGQFKLEIKTLSLQSHQTKRKIE
                     KPASEQTAVAVVVQIETKKYYISAIENAVNTGDVAKALSLLDEAKMLNVDGAQQAFIK
                     AVNAK"
     misc_feature    141092..141169
                     /note="Signal peptide predicted for TVA2687 by SignalP 2.0
                     HMM (Signal peptide probability 1.000) with cleavage site
                     probability 0.458 between residues 26 and 27"
     misc_feature    141116..141148
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
     misc_feature    141122..141934
                     /note="HMMPfam hit to PF07148, MalM, score 6.5e-62"
     CDS             complement(142086..144551)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0126c"
                     /old_locus_tag="TVA2685"
                     /product="Putative glycogen debranching enzyme"
                     /note="user locus_tag: VANGcII0126c"
                     /protein_id="CDQ48023.1"
                     /translation="MTSKYRHSQITSINQTQTRLLICKEFTPICGVEPSTPRIDGTLE
                     LENLFSNLAIESTSKFSYVFSDGVDGYYQGHTYGFSSSGNYRHSQGWYLGQFASFVNG
                     NINDKTQASKARLMPFGIEHHYVGTSSVECLSLLQGQRLACLTITSESKQSLAILPEL
                     NILVNASKPECIDDVLIYEVNDANSVSEEPRFIAISANQSVIAKEMATDECATTSKLM
                     GLSDSNVKLMISSTESTQKLVIYLYFESTKTEAIKGAQLAAQNHANIIFQNNLYRFLT
                     RNYLWTNDLEYNRAVMWSRLASRTFVNQEFGSGIWAGLPWFKDCWGRDTFIALSGTSL
                     INGQFPESRAIIENFASMQMQDHTSVNYGRIPNRVTSKTDIIYNTTDGTPWMIREVME
                     YINYSGDIAFAKDIYPIVKRFIDGIESNYLSEDGLLKHRHPDTWMDAKIKGQIPWSPR
                     GPKANDIQALLFESFHVAARLAEMNKNDLDHRYYLKLAEKLKMSFIRKFWDEDKKQLA
                     DHLKEFDIPDNSVRPNQLMVLSIPQTEAFLPLEIGQFIIRNSIDHLLFPWGICSLEQY
                     HEDFHPYHDNRSEYHKDAAYHNGTIWGWNAGFTVSALTSFSKQDLAFQLSKNLAKQIL
                     QQGHRGTMSENLDAYQHDEDNLIETGTYAQAWSVSEYARNAQQDYLGFKPELSKNKIN
                     LSPKLPSCWTSFSATLPYGQDENLYFNWQCRDGKASYMINPRYLRADLILNLILELGN
                     YQINIECDLTKNVEIILDVNTDDIKFNRNDIIVKKVVAPSYPELSKLKFTYPNWHLTH
                     NSLKQNDYLQTKRHSQNLQKAVD"
     misc_feature    complement(142563..142658)
                     /note="HMMPfam hit to PF06202, GDE_C, score 4.6e-05"
     misc_feature    complement(142672..143666)
                     /note="HMMPfam hit to PF06202, GDE_C, score 8.5e-104"
     misc_feature    complement(143541..143570)
                     /note="PS01005 Formate and nitrite transporters signature
                     1."
     CDS             complement(144628..145806)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0127c"
                     /old_locus_tag="TVA2684"
                     /product="Bacterial extracellular solute-binding protein"
                     /note="user locus_tag: VANGcII0127c"
                     /protein_id="CDQ48024.1"
                     /translation="MKNSIKNLSICTLATLMAAPLMAMQEGEITIWINGDKSYDGLAQ
                     IGQQFEQDTGIKIIVQHPESLEAKFQQHAATGSGPDIIFWAHDRFGGYAEAGLLHEIK
                     PSKQFKEKLVDFSWDAVTVNGKLVGYPLAIEALSLIYNKDLLPTPPKTWEELVSIHNT
                     MEKQGKKAIMWDIKNAYFTWPVISSGGAYAFEKIVGGYNAKSTGVNNEAGINGLQFLV
                     NMVNQGVLNPNMDYAVSDAAFSKGEVAMTINGPWSWGNLDKLGINYGVAELPTLNGGK
                     GNPFVGILSAGINSASPNTDLAVEFLENYVFQDDALKIMNDDKPLGAVTLKSFQKILE
                     QDQRIKATMINAENGEIMPNIPQMTAYWFAEGAAIDNAMQGKQGVKEALDMAAKQITK
                     "
     misc_feature    complement(144871..145779)
                     /note="HMMPfam hit to PF01547, SBP_bac_1, score 3.1e-34"
     misc_feature    complement(145738..145806)
                     /note="Signal peptide predicted for TVA2684 by SignalP 2.0
                     HMM (Signal peptide probability 1.000) with cleavage site
                     probability 0.925 between residues 23 and 24"
     CDS             complement(146130..147047)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0128c"
                     /old_locus_tag="TVA2683"
                     /product="putative regulatory protein"
                     /note="user locus_tag: VANGcII0128c"
                     /note="contains 1 lysR family signature"
                     /protein_id="CDQ48025.1"
                     /translation="MDKSLRYFLMVAIENNIKQAAEKLHISQPSLTTAIKKLEHELGV
                     ELFIRRSKGVELSAYGKLFREYVQEQQEKQQQLLHQFTDMQQRHQGKLKLGTGEAWWE
                     LFVRDTVCLYQKNTPNCSIHLEFGNNLSLIHHLVQGDIDLFIGHEIQDLHERCKVHFQ
                     PLFRDQEALFVCSSHPILNTKKSDDELLLEQAQYPLIRVTPDHSRHRTMLAEHASLAK
                     QYTEQRESKRAIYDVDSLFASIDILEMANAVMPYSDKMCHWMARRNIATLTINKKKKG
                     NVGIYIKQGIADPKITSFIEILTKYTSSL"
     misc_feature    complement(146865..147044)
                     /note="HMMPfam hit to PF00126, HTH_1, score 1.9e-18"
     misc_feature    complement(146910..147002)
                     /note="PS00044 Bacterial regulatory proteins, lysR family
                     signature."
     misc_feature    complement(146940..147005)
                     /note="Predicted helix-turn-helix motif with score
                     1562.000, SD 4.51 at aa 15-36, sequence
                     NNIKQAAEKLHISQPSLTTAIK"
     CDS             147266..148903
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0129"
                     /old_locus_tag="TVA2682"
                     /product="Oligosaccharide alpha-1,6-glucosidase protein"
                     /EC_number="3.2.1.10"
                     /EC_number="3.2.1.93"
                     /note="user locus_tag: VANGcII0129"
                     /protein_id="CDQ48026.1"
                     /translation="MEPKWWHSAVVYQIYPRSFYDSNHDGIGDLNGIISKLDYLAELG
                     INVIWLSPVYQSPMDDNGYDISDYQAIAQEFGSMEDMQRLLSEAQKRNIKIVMDLVVN
                     HTSDEHQWFLQAKQSRDNPYRDYYIWRDAKPDGSVPDDTGSIFGGSAWHWDEQTQQYY
                     FHLFSKRQPDLNWENPKVQQEVHSMMNWWIEQGIGGFRLDVIDLIGKEIDKGITGNGP
                     SLHPLLQQMNAATFGNQDLLTVGETWGATPDIAKLYSAPSRRELSMVFQFEHITLTWE
                     QGDKWSPIPLDLKQFKQVLTKWQIELADQGWNSLFWNNHDLPRAVSKYGDDKRYRVES
                     AKMLATSLHFLKGTPYIYQGEEIGMTNVAFDSLAQYRDIETLNFYRVKTESGVSHQHM
                     LDAIHQNSRDNARTPMQWSADKHGGFTQGSPWIEANPNYLKVNVEQALADKQSIYHHY
                     KKLIALRKKHLSIVYGSFTPLFEEHDQVFGYVREYQGEQIVVVSNFSSATVCLAIPEK
                     FQLRAVECLSSNYQEIEKLEENLVLEPYQSIAVLIRE"
     misc_feature    147302..148636
                     /note="HMMPfam hit to PF00128, Alpha-amylase, score
                     6.6e-127"
     CDS             149233..150378
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0130"
                     /old_locus_tag="TVA2681"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0130"
                     /protein_id="CDQ48027.1"
                     /translation="MSTIGIAIGATGLSLILIFVWMFSLSLRKKRLEEERKEREIAYR
                     KAIEKSREQERQDRLFKAETGHVPTILYLAKEAERTNLKEAMYWYDKAANYDNVTGMY
                     GVVRICQKFRDDLILREKEKFWQTCIAGIEGNLTAKYETGMAYIHGRGVEANTAKGVS
                     LVQEAAEANLLDAVIFMGDWCVSHDNIAPSPADSTFWYSKAAKLNSPIGQMKLGLNYL
                     KGVGVAMDHSKACYWLERASEKGHVEAMYHAGEAWIDKGSNGNAIAYIWLFLSAHFGF
                     EPAKVLRDQVGSRIGVDSVVGLQSLAKPLMKKIGAGTVSKHSIIKALNKLYKRGIPIP
                     EKGELPDEDDLSLSVVADASEERLSSKPSDAHEVLTRLDFSNTSMDR"
     misc_feature    149245..149313
                     /note="1 probable transmembrane helix predicted for
                     TVA2681 by TMHMM2.0 at aa 5-27"
     misc_feature    149431..149523
                     /note="HMMPfam hit to PF08238, Sel1, score 0.96"
     misc_feature    149635..149742
                     /note="HMMPfam hit to PF08238, Sel1, score 0.0077"
     misc_feature    149851..149958
                     /note="HMMPfam hit to PF08238, Sel1, score 6.8e-08"
     CDS             complement(150490..151707)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0131c"
                     /old_locus_tag="TVA2680"
                     /product="sodium/dicarboxylate symporter"
                     /note="user locus_tag: VANGcII0131c"
                     /protein_id="CDQ48028.1"
                     /translation="MQSNNIFARFARGNLVLQILAGIVLGGILATLSPDDAKSVGLLG
                     DLFVGALKAVAPILVFILVAASIANQKKNQHTYMRPIVVLYLFGTFTAALTAVVLSFI
                     FPTTLTLVAGAEGATPPQGIAEVLNTLLFKLVDNPVNALMSANYIGILAWAVGLGLAL
                     HHASATTKAVFEDLSHGVSQIVRFIIRLAPFGIFGLVASTFATTGFESLAGYANLLFV
                     LLSAMLIIALVVNPIIVYAKTRQNPYPLVFQCLRESGVTAFFTRSSAANIPVNMALCE
                     KLKLDEDTYSVSIPLGATINMAGAAITITVLTLAAVNTVGIEIDLMTALLLSIVAAVS
                     ACGASGVAGGSLLLIPLACGLFGISNDVAMQVVAVGFIIGVIQDSAETALNSSTDVVF
                     TAAVCQAEHNKSA"
     misc_feature    complement(150523..151665)
                     /note="HMMPfam hit to PF00375, SDF, score 1.8e-140"
     misc_feature    complement(join(150580..150648,150661..150729,
                     150757..150825,151003..151071,151099..151167,
                     151228..151296,151399..151467,151501..151569,
                     151612..151671))
                     /note="9 probable transmembrane helices predicted for
                     TVA2680 by TMHMM2.0 at aa 13-32, 47-69, 81-103,
                     138-160,181-203, 213-235, 295-317, 327-349 and 354-376"
     misc_feature    complement(150676..150717)
                     /note="PS00099 Thiolases active site."
     misc_feature    complement(150700..150732)
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
     CDS             complement(152062..152505)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0132c"
                     /old_locus_tag="TVA2679"
                     /product="putative exported protein"
                     /note="user locus_tag: VANGcII0132c"
                     /protein_id="CDQ48029.1"
                     /translation="MKLNALFLASLALSPLAFANTDIMVHHPYARATAPTATTSAVFS
                     QIMNKGETDRFIVSANTDVAGKVELHDVITEGDVMKMRQVTEFKIPAKGHVELKPGGL
                     HIMLFDLKKPLVEGEKIDVQLTFANGEQQTITAPVKKVMSGMAHH"
     misc_feature    complement(152086..152433)
                     /note="HMMPfam hit to PF04314, DUF461, score 8e-56"
     misc_feature    complement(152449..152505)
                     /note="Signal peptide predicted for TVA2679 by SignalP 2.0
                     HMM (Signal peptide probability 1.000) with cleavage site
                     probability 1.000 between residues 19 and 20"
     CDS             complement(152507..153115)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0133c"
                     /old_locus_tag="TVA2678"
                     /product="Putative Sco1-related protein"
                     /note="user locus_tag: VANGcII0133c"
                     /protein_id="CDQ48030.1"
                     /translation="MSKNWSLALVVAFVLGFGIKTYFDTQQSMDLESGNSSSSEVILF
                     GKANQPISIFDTKDERIRVVYFGFTRCPDVCPTSLAMLAGALNQLDDVTKAKLRPLFI
                     SLDPERDAADASHQYAQYFHPMIEGLSAPLDITTPLAHQYGVIFRKTELKGSELKYTL
                     DHSSYFYFLQPDGTLITKVPHTLSPAPIVEAIKTIMTSSQGK"
     misc_feature    complement(152564..153085)
                     /note="HMMPfam hit to PF02630, SCO1-SenC, score 8.1e-20"
     CDS             complement(153112..153540)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0134c"
                     /old_locus_tag="TVA2677"
                     /product="Putative membrane protein"
                     /note="user locus_tag: VANGcII0134c"
                     /protein_id="CDQ48031.1"
                     /translation="MHNAIKIGVFVLALLAGYFSSDIFNWLSSTHSSPDINRYCQLSS
                     APCRQGDVVMTLAHDKSQPLVANTLTVEWPQANASKLTLTLNGLEMEMGTAKYVLTPQ
                     EDGLYTAQIVLPVCTTEKMTWIGELSDGRTQVFPAIRMER"
     misc_feature    complement(153454..153522)
                     /note="1 probable transmembrane helix predicted for
                     TVA2677 by TMHMM2.0 at aa 7-29"
     CDS             complement(153684..154568)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0135c"
                     /old_locus_tag="TVA2676"
                     /product="Uncharacterized membrane protein"
                     /note="user locus_tag: VANGcII0135c"
                     /protein_id="CDQ48032.1"
                     /translation="MGAADVVPGVSGGTIAFITGIYDTLLESIRRINPSLLRIVKRDG
                     LAAAFQHINGFFLLALFGGIFTSILSLAKLISWLLATHPIPIWSFFFGLILVSVFHIV
                     KQIEQFKLSRLLFALLGIAFAYSITVLNPMQMEPTALNTVLAGAIAICAMILPGISGS
                     FILLLIGMYAPVLGAVKEMQADILALFLLGCIGGLLSFSHVLSWLLKQFRDLTLIFLT
                     GLMIGTLPKIWPWKETLTWRTNSHGELVPLLQRNLSPLEFESITSQPSQLLVAILLML
                     CAVALVLGLEQYAKHHDV"
     misc_feature    complement(join(153714..153767,153876..153935,
                     153963..154022,154041..154145,154173..154232,
                     154266..154334,154362..154430,154491..154559))
                     /note="8 probable transmembrane helices predicted for
                     TVA2676 by TMHMM2.0 at aa 4-26, 47-69, 79-101,
                     113-132,142-176, 183-202, 212-231 and 268-285"
     misc_feature    complement(153753..154568)
                     /note="HMMPfam hit to PF04018, DUF368, score 1e-121"
     misc_RNA        154850..154855
                     /note="-24, sigma54-promoter; cfr NB10-qrr3"
     misc_RNA        154863..154865
                     /note="-12, sigma54-promoter; cfr NB10-qrr3"
     ncRNA           154877..154984
                     /gene="qrr3"
                     /function="Qrr operates as part of a negative feedback
                     loop which regulates the shift in cell state from that of
                     low density populations to that in high density
                     populations (QS)"
                     /note="Bacterial regulatory sRNA gene, qrr3: Quorum
                     regulatory RNA; a non-coding RNA that is thought to be
                     involved in the regulation of quorum sensing (QS) in
                     Vibrio species."
                     /ncRNA_class="other"
     CDS             155257..156483
                     /transl_table=11
                     /gene="gltS"
                     /locus_tag="VANGNB10_cII0136"
                     /old_locus_tag="TVA2675"
                     /product="Sodium/glutamate symport carrier protein
                     (Glutamate permease)"
                     /note="user locus_tag: VANGcII0136"
                     /protein_id="CDQ48033.1"
                     /translation="MHHLISIGPLESFLIAISVLFLGHFINAKLPILEKFNIPEPIVG
                     GLIVAFAITLLHFYGLDLEFSLPLQNIFMLMFFSTVGLAANYTQLVKGGAKVFLFLAV
                     ASFYIIIQNGVGVSLATALGLDPLMGLIAGSITLSGGHGTGAAWAQTFNDNYGLSNTL
                     EIAMASATFGLIIGGIIGSPVAQKLINKNGFESEYGRGTKTHDKFPELVTYNEYEEDK
                     VTAKKVIEGLFILLICVTGAKYLEQWVSAFEIKWLMIPDFVYALFIGVFITNILELTK
                     VHKIDAETVDILGTVSLSLFLAMALMSLKLWNIFDLAVPFLVILAVQSVVLGIFAYFV
                     TFKVMGSNYDAAVIAGGHCGFGLGATPTAVMNMGSLVTRYGPSPQAFMVVPIVGAFFV
                     DIVNLVILQGYISFLG"
     misc_feature    join(155266..155334,155368..155436,155464..155523,
                     155542..155610,155734..155802,155938..155997,
                     156010..156078,156115..156168,156196..156264,
                     156283..156351,156409..156477)
                     /note="11 probable transmembrane helices predicted for
                     TVA2675 by TMHMM2.0 at aa 4-26, 38-60, 70-89,
                     96-118,160-182, 228-247, 252-274, 287-304, 314-336,
                     343-365 and 385-407"
     misc_feature    155269..156384
                     /note="HMMPfam hit to PF03616, Glt_symporter, score
                     1e-232"
     CDS             complement(156555..157298)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0137c"
                     /old_locus_tag="TVA2674"
                     /product="Putative type IV pilus assembly (PilZ) protein"
                     /note="user locus_tag: VANGcII0137c"
                     /protein_id="CDQ48034.1"
                     /translation="MESQSAVLKDEQNPNRSTERNKTLSTLNSTDALSMVEHSSELTL
                     SITTPVGTKFQCKTSFIGTYSHSHLLVEIPKISADDLSFFFQEGFWMNIRAISPRGEG
                     ALIHFRSQLLHVLQEPIPLAMLSIPNSMQVTQLRKEARYDVNLAGKATVGTHKSDCEV
                     RDLSKSGCRFVTPPLGRTFQVGDKISLELFTDPRSSQFFAPLMGKVCNLQRSLHYARY
                     GVQFDEEGVKNAKSLLGQLKFDGTKLTLK"
     misc_feature    complement(156582..156899)
                     /note="HMMPfam hit to PF07238, PilZ, score 3.2e-17"
     CDS             complement(157735..158706)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0138c"
                     /old_locus_tag="TVA2673"
                     /product="Putative endonuclease/exonuclease/phosphatase
                     protein"
                     /note="user locus_tag: VANGcII0138c"
                     /protein_id="CDQ48035.1"
                     /translation="MTITFATINLFNYLAPPNAYYQFDNIYTQAEWQKKKQWFSQKIK
                     QLDADIIGFQEVFSFDELRNQMMDLGYPYVACVDEPIVKDGYIYSHPVVVIASRYSLR
                     QVSAVHGTLPNQAAPFCFNRTPLHATVCLPMLGDIDVYIVHFKSQRPAESPAAPHHLI
                     DEWQQETLGRWLSTVQRGFEANLTHQYIVNTQKQTGRPCVLMGDFNKPLHHEEFQGLL
                     SQALYRRPETQQPLAGYALYDAWDLHTESVEQPRKATHYAGSTGSVLDYILLSADFAP
                     FIQPMKSYISHYTVLDQHLVNPSYELDNFSTDHALVAVTLKVNTAPS"
     misc_feature    complement(157759..158700)
                     /note="HMMPfam hit to PF03372, Exo_endo_phos, score
                     1.1e-05"
     CDS             158861..160051
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0139"
                     /old_locus_tag="TVA2672"
                     /product="permease, major facilitator superfamily"
                     /note="user locus_tag: VANGcII0139"
                     /protein_id="CDQ48036.1"
                     /translation="MYPKASQGWRTPQNFLLIISIIVPIAFSSWMALLNNFVIEKANF
                     DGSDIGLLQSVREIPGFLAFTAVFVLLFIREQRFILISLGMLTLGTAMTGFFPSLTGL
                     LLTTLLMSTGFHYFETLKQSLSLQWLNKDEAPEMLGKLISVGALASLITYGALWVMLE
                     VFQLDFKWVYAISGGAGFVLVLIIAFAFPEFKAEVPQNKKLVLRKRYWLYYALTFMSG
                     ARRQIFTVFAGFLMVEKFGYSAADITLLFLINYLFNFLFAKRIGKFIGVVGERKALLF
                     EYTGLIVVFVGYGLVQNAHWAAALYVVDHLFFALALAIKTYFQKIADPADMASTAGVS
                     FTINHIAAVFIPATFGLIWLISPASVFYIGAVMALVSLLLSLNIPIKPEAGNEVRILR
                     WSDR"
     misc_feature    join(158894..158962,159005..159073,159092..159145,
                     159155..159208,159269..159337,159365..159424,
                     159485..159553,159566..159634,159680..159733,
                     159746..159814,159851..159919,159932..160000)
                     /note="12 probable transmembrane helices predicted for
                     TVA2672 by TMHMM2.0 at aa 12-34, 49-71, 78-95,
                     99-116,137-159, 169-188, 209-231, 236-258, 274-291,
                     296-318,331-353 and 358-380"
     misc_feature    158906..159922
                     /note="HMMPfam hit to PF07690, MFS_1, score 5.4e-19"
     CDS             complement(160153..161283)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0140c"
                     /old_locus_tag="TVA2671"
                     /product="Secretion protein, HlyD family"
                     /note="user locus_tag: VANGcII0140c"
                     /note="The secretion proteins are evolutionary related and
                     consist of from 390 to 480 amino acid residues. They seem
                     to be anchored in the inner membrane by a N-terminal
                     transmembrane region. Their exact role in the secretion
                     process is not yet known."
                     /protein_id="CDQ48037.1"
                     /translation="MDLLLIMTYAALCIAIFKVFKIPLNKWTVPTAVLGGVILIGTLI
                     LLMNYNHPFTQLGSQVFSTTPVVSGVRGRVIEVPVQANQPLKQGDVLFRIDPVPFEAE
                     LAKIEAQIKEASQGALGLESNVSEAAAAKVQAIADRDKAQREYARYQRGYDKGAFTEQ
                     DLDTRRQAYKAAEAAVEVAQARLNQANISLNSEINGENTTVARLLADFRQAQFNLEQT
                     IVRAPTDGYVTQLALRPGAMSVPLPLAPMMTFVHTEDKIYTAAFRQNSLQRLKPGFEA
                     EFLFRALPGKVFKGEVVEILPVIGESQIQARGTLLGTEALRTNGRVLVTLKVTDDLSD
                     YHLPLGTAFEAAIYSDSFSHVSIMRKVLIRMKSWQNYLYIDH"
     misc_feature    complement(160249..161100)
                     /note="HMMPfam hit to PF00529, HlyD, score 5.7e-33"
     misc_feature    complement(join(161137..161205,161224..161274))
                     /note="2 probable transmembrane helices predicted for
                     TVA2671 by TMHMM2.0 at aa 4-20 and 27-49"
     CDS             complement(161283..161669)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0141c"
                     /old_locus_tag="TVA2670"
                     /product="putative membrane protein"
                     /note="user locus_tag: VANGcII0141c"
                     /protein_id="CDQ48038.1"
                     /translation="MFLDYFALGLLIFVALVIFYGIIVIHDIPYEIAKERDHPHQDAI
                     HVSGWVSLFTLHAIWPFLWIWATLWRKDRGWGFTKLQEEQHDIHHRVDELIDQVATLT
                     RELHELKAQPPVAQANIDHASNQETK"
     misc_feature    complement(join(161472..161540,161583..161651))
                     /note="2 probable transmembrane helices predicted for
                     TVA2670 by TMHMM2.0 at aa 7-29 and 44-66"
     CDS             complement(161732..163312)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0142c"
                     /old_locus_tag="TVA2669"
                     /product="Putative GGDEF protein"
                     /note="user locus_tag: VANGcII0142c"
                     /protein_id="CDQ48039.1"
                     /translation="MEVLLSKIKDTGLDATSVSGEEAIIFWNHVRQHIASTSKEKALS
                     YIISAEYRSELHQSSASIEELRHALALLELPKDAEIILSVKNSLSDRLMESGEFAAAL
                     NEYVSASNIAVDTGYIDEYVLAVIGMGNLCDAYGEHSRALRYYQKIDSIDHAITSRSL
                     RLRYKLYMLSCYIQLHRISAATDLIKECEELSILVSDKILTGQISLYQAQLYLHQDQV
                     DKALITLSSVQYSAGNMNSTWLSNMIRIETANCLAKIGKSHIANMMLASTDKRLQRYT
                     SPTMAKQLYRAFSAVCERQGLYQAALIYEKKGFRIETDLMKNIPISELGANQLRRLSR
                     FELQLKLILSEIENRELKETTEHQKNAVAQLQQDVFTDPLTTLHNRRWLDVKLKDLLL
                     HEKLFAFLVIDIDHFKSINDELSHLVGDKAIVNVSRELKNYFKFRGSSCVRFGGEEFL
                     VILEDCSLDQAEMHAENYRERIFQFGWHDILGERGLTVSIGITLHRDGENTQRTFYRA
                     DKALYRAKANGRNQVCTE"
     misc_feature    complement(161747..162220)
                     /note="HMMPfam hit to PF00990, GGDEF, score 3.5e-36"
     CDS             complement(163293..164780)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0143c"
                     /old_locus_tag="TVA2668"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0143c"
                     /protein_id="CDQ48040.1"
                     /translation="MDKSQYLLEIEIEQLRARIETEPEKVSIVAEQCLLRAQQIFFPE
                     GAIQCLIILSRCAWCLMDYRVGLKYIKEALSTQNTLDTDDCLPEILHIHALQLWGQAK
                     YYTAQQYWINALEQSALVDEVDIQIECLIGLGNVWRITNEYQLSCSTHELAVKVANNA
                     RIHWLEGKARILWAWDLYLLNQYIDMLTVLDGAEEALQDHPDKTWQAEVWDFRGLALL
                     GLERIEDAEAATTKALELAVEHNLVWMKAHSFISRARLELLRKDSKKATELLLLAEAS
                     AASFDKGELLSQICYQQSLVAEQRGDFKASLASFKKYRQFTVEMLREQTARIGLDKAR
                     ASKRQLEQRARKLINRIRGQHEYDPEKHLSNVVSETYWWEQLMLFKTELKHSNHAVIV
                     IQHNDSKYLDVCTEIAHSLCNQKDLVSRLSSERLALLLADKGDAALHVFHVLAKMIEI
                     YPWERKGLTGSLPQVMFQDILSFPFTLEQLEDSQPQEWSHGSTAQ"
     misc_feature    complement(164061..164162)
                     /note="HMMPfam hit to PF07719, TPR_2, score 0.0017"
     CDS             complement(164944..166278)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0144c"
                     /old_locus_tag="TVA2667"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0144c"
                     /protein_id="CDQ48041.1"
                     /translation="MVCRECGAFPPLLNNREVLNELHRLRQLHSDGLPACRSDDCQNF
                     GLSVHTHKHLYHAFGYSGDRQRYRCKACQSTFVDKWSGANKKLVFQETLLGLLFMSYS
                     VREICRKLSINPKTFYDHVEHIASRCRRKLAMIDARWVNHANQYELACNYIPLQPHSD
                     NGVLWFATGEAKTGYILCQHVNYSANEEPAGELDHNPYHSPARFVSREHSSEANLPTP
                     DASPLLRERIDQKYQTILARGNVEDPMGNLTTFHYPSKGALIRPPYTSYAHFLHVLDL
                     CLEDKRVSIYLPQDPVLRSAALSVCLPRIKRKNVDLMYVEEDPQWQNGHSVNKTDIVH
                     MGWWRDRWAIANQAQAAKGVCYLAGDNPTPEAWLDKASIKQTEFYQKRFQLLFESFIN
                     EPRRKLRPGGLQPMLDIFRAWHNLCYQDKHGFTAAQNLELTKHPLTLKELLS"
     CDS             complement(166474..167184)
                     /transl_table=11
                     /gene="deoD"
                     /locus_tag="VANGNB10_cII0145c"
                     /old_locus_tag="TVA2666"
                     /product="purine nucleoside phosphorylase"
                     /EC_number="2.4.2.1"
                     /note="user locus_tag: VANGcII0145c"
                     /protein_id="CDQ48042.1"
                     /translation="MATPHINAQVGDFAETVLMPGDPLRAKYIAETFLDDAKQVCDVR
                     SMFGYTGTYKGKKVSVMGHGMGIPSCSIYVHELISEYGVKNIIRIGSCGAVRDDVNLM
                     DIVIGMGASTDSKVNRIRFNNHDFAAIADYGLLETAVNQARAQNVPVKVGNVFSADLF
                     YTPEGDLFEKMNKLGILGVDMEAAGIYGVAADLGAKALTILTVSDHIIRGEKLSSEDR
                     QTSFNDMMKVALETAISI"
     misc_feature    complement(166486..167142)
                     /note="HMMPfam hit to PF01048, PNP_UDP_1, score 6.1e-99"
     misc_feature    complement(166954..167001)
                     /note="PS01232 Purine and other phosphorylases family 1
                     signature."
     CDS             167496..168449
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0146"
                     /old_locus_tag="TVA2665"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0146"
                     /protein_id="CDQ48043.1"
                     /translation="MSNPEIRIGISACVLGEQVRFDSGHKASDFVTKELTNYFSFIPV
                     CPEVAIGLTVPRPAIRLISHEERLALVETKDETKDYTQAMFDFSERKVDELELMKLCG
                     YIVCAKSPTCGMERVKVYKHQRADKEGVGLYTATLMRKMPWLPVEEDGRLHDPVLREN
                     FITRVYCLHDFYQSIGDNPTPGKVVAFHSRYKLTLMAHHPQAYRELGRLVAEVKQHPP
                     QYFIEHYRQGLMDALKHRASRKNNTNVLMHIQGYFKRALNKEQKVELAQLIDDYRTGE
                     LPLLAPITLLKHYIKMYPDAYLQQQHYLSPYPQTLRLRYGL"
     misc_feature    167514..167924
                     /note="HMMPfam hit to PF04463, DUF523, score 1.1e-51"
     misc_feature    167826..167855
                     /note="PS00339 Aminoacyl-transfer RNA synthetases class-II
                     signature 2."
     misc_feature    168069..168419
                     /note="HMMPfam hit to PF08349, DUF1722, score 2.7e-68"
     CDS             168472..169272
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0147"
                     /old_locus_tag="TVA2664"
                     /product="Uncharacterized transcriptional regulator, MerR
                     family"
                     /note="user locus_tag: VANGcII0147"
                     /protein_id="CDQ48044.1"
                     /translation="MTEKLYAIRDVAEMTGVKPVTLRAWQRRYHLVQPQRTEKGHRLY
                     SQEDIATIRTIQGWLAKGVSIGKVSALLSGSESIIDTLANHGSELLEQEQLLQALVDL
                     NKGKAESTIATVLKEYPLEIVEQQFVFPVIDTLERVKGPLRSLQKGLFQALMISKLSS
                     IIEAENKAATKGKCLCVNLDPTSSILAWLWFVGKVEAGYNLTILDGVEDLTALVDHDA
                     LANYQQVALFANRALTEQQVQALRKLRISLGDKLSLSDVVARLHHSLD"
     misc_feature    168487..168552
                     /note="Predicted helix-turn-helix motif with score
                     1478.000, SD 4.22 at aa 17-38, sequence
                     YAIRDVAEMTGVKPVTLRAWQR"
     misc_feature    168490..168603
                     /note="HMMPfam hit to PF00376, MerR, score 2.6e-10"
     CDS             169289..170701
                     /transl_table=11
                     /gene="phr"
                     /locus_tag="VANGNB10_cII0148"
                     /old_locus_tag="TVA2663"
                     /product="Deoxyribodipyrimidine photolyase
                     (Photoreactivating enzyme)"
                     /EC_number="4.1.99.3"
                     /note="user locus_tag: VANGcII0148"
                     /protein_id="CDQ48045.1"
                     /translation="MKLLWLRRDLRSVDNTALHAAIDGEEPVVAVFIATPAQWQKHHL
                     APMQADLIYRRLFELQRELQALNIALLYEEVDDYADAAQQIATMAKQLNASAVLVNRE
                     YEINELQRDEMASQFCLERQIEWRAYDDKCIIAPGLVKNKQGDYFKVFTPFKRAWLSQ
                     AALPQILPTPISAHYKRIKDLEPLLWSEHRSFSYPRISSDHWVVEFDAIRAKLRQFCR
                     DKVQNYHQQRDFPALDSTSALSPYLAIGALSARQCMARLYAESQHIGLSEGAQTWLSE
                     IIWREFYQHLIGFRPDLCKGKDFAPWGKHVSWWENSTAFERWQQGQTGFPIVDAAMRQ
                     LNKTGWMHNRLRMVVASFLTKDLHIDWRLGEQYFMQTLVDGDYASNNGGWQWCASTGC
                     DGQPYFRIFNPTSQGERFDPKGDFIRQWVPELASLPDKYIHTPWKFPAVNSLSYPTPM
                     VDHKVEREITLQLYKDAKDT"
     misc_feature    169292..169810
                     /note="HMMPfam hit to PF00875, DNA_photolyase, score
                     4e-36"
     misc_feature    169892..170692
                     /note="HMMPfam hit to PF03441, FAD_binding_7, score
                     7e-127"
     misc_feature    170255..170293
                     /note="PS00394 DNA photolyases class 1 signature 1."
     misc_feature    170315..170374
                     /note="PS00691 DNA photolyases class 1 signature 2."
     misc_feature    170432..170464
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
     CDS             170707..171630
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0149"
                     /old_locus_tag="TVA2662"
                     /product="Putative peptidoglycan-binding YkuD-family
                     protein"
                     /note="user locus_tag: VANGcII0149"
                     /protein_id="CDQ48046.1"
                     /translation="MLRKLLSLCCCWGALSVNAFAATYDFPAEGSSMVGRTQYHVIEQ
                     GETLAQIAKQYDVGFLSLMAANKGIDPFLPQQEFVLTIPSQIILPRVAYEGIVINLAE
                     LRLYYFEPEKRKVHIFPVGIGRIGRDTPEMETTISQKRPNPTWTPPQSIRTEYKAKGI
                     ELPAVVPAGPDNPLGEYALRLAYGAGDYLIHGTNKDFGIGMRVSSGCIRMDPKDIEWL
                     FKQVQRGEKVKVIDEPIKLALEPDRSVFLEAHEPLTRSNGSKKELQVPQELRWWLDEF
                     NKSDAKARAVILAQNGVPVEVVAADFSTSLE"
     misc_feature    170707..170769
                     /note="Signal peptide predicted for TVA2662 by SignalP 2.0
                     HMM (Signal peptide probability 1.000) with cleavage site
                     probability 0.996 between residues 21 and 22"
     misc_feature    170824..170955
                     /note="HMMPfam hit to PF01476, LysM, score 0.00038"
     misc_feature    170977..171396
                     /note="HMMPfam hit to PF03734, ErfK_YbiS_YhnG, score
                     6.1e-64"
     CDS             complement(171739..172008)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0150c"
                     /old_locus_tag="TVA2661"
                     /product="putative outer membrane lipoprotein"
                     /note="user locus_tag: VANGcII0150c"
                     /protein_id="CDQ48047.1"
                     /translation="MNKMLIAAAASSVLLLAGCASGPDDAAMTKMDQLSNQVSQLSDQ
                     ISALKSEQSTLSSKVSQAADAAAAAQEEAARANERIDNIAQSYTK"
     misc_feature    complement(171931..172008)
                     /note="Signal peptide predicted for TVA2661 by SignalP 2.0
                     HMM (Signal peptide probability 0.999) with cleavage site
                     probability 0.782 between residues 26 and 27"
     misc_feature    complement(171952..171984)
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
     CDS             172416..173750
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0151"
                     /old_locus_tag="TVA2660"
                     /product="ATP-dependent RNA helicase"
                     /note="user locus_tag: VANGcII0151"
                     /note="Similar to Escherichia coli ATP-dependent RNA
                     helicase SrmB UniProt:P21507 (444 aa) fasta scores:
                     E()=5.9e-47, 37.055% id in 421 aa"
                     /protein_id="CDQ48048.1"
                     /translation="MQFKDLGLDNRLLKTLKHYDFKQATEIQQQAVPVAIAGKDLLAS
                     SKTGSGKTLAFVLPMLHKSLKTKALSAKDPRALILAPTRELAKQVYGELRTMLSGLSY
                     EATLIVGGENFNDQVKALRRFPRFIVATPGRLADHLEHRSLRLDGLDTLILDEADRML
                     DLGFAPELRRIHHAANHRRRQTLMFSATLDHGQVNDFGTELLKDPKRISIGVVNEEHK
                     DITQKFYLCDHLDHKEALLERVLQEAEYRQVIIFTATRSDTERLTLKLNEQKLKAVAL
                     SGNLNQNQRNTIMSQFERAVFKILVTTDVASRGLDIANVTHVINFDMPKHTEEYVHRV
                     GRTGRAGNKGDAISLVGPKDWDSFKRVEAFLQQDIEFSQFDDLKGKFIGLKPRVPAFK
                     KNAAAKTKSTKPKAHTANKKPVKRDKTFYQNVAVGDAVFVPKKRVAPKVDDE"
     misc_feature    172488..173006
                     /note="HMMPfam hit to PF00270, DEAD, score 4.4e-62"
     misc_feature    172869..172895
                     /note="PS00039 DEAD-box subfamily ATP-dependent helicases
                     signature."
     misc_feature    173208..173438
                     /note="HMMPfam hit to PF00271, Helicase_C, score 3.6e-33"
     CDS             join(174067..175164,175166..175984)
                     /pseudo
                     /transl_table=11
                     /gene="ptrB"
                     /locus_tag="VANGNB10_cII0152"
                     /old_locus_tag="TVA2659"
                     /product="protease II (pseudogene)"
                     /EC_number="3.4.21.83"
                     /note="user locus_tag: VANGcII0152"
                     /note="The merged CDS contains a framshift after codon 366
                     (in both 454- and PacBio-sequencing)."
                     /db_xref="PSEUDO:CDQ48049.1"
     misc_feature    175319..175966
                     /note="HMMPfam hit to PF00326, Peptidase_S9, score
                     6.3e-64"
     CDS             175985..178126
                     /transl_table=11
                     /gene="hutR"
                     /locus_tag="VANGNB10_cII0153"
                     /old_locus_tag="TVA2657"
                     /product="TonB-dependent heme receptor HutR"
                     /note="user locus_tag: VANGcII0153"
                     /protein_id="CDQ48050.1"
                     /translation="MKLSPITAAVLSVLAVGSVHAEFSLTKLEEVVVSANKVEQPLSK
                     VAGSISAIDGETIEKQGATELYDVLSHEPGISVTGGAGRPQNITIRGMTGNRIEIIQD
                     GVAASDGYGANDINDKVGRNTFALDNIKSIEVVKGAGSTIHGSGAIGGVVVVTTKSPA
                     DYLQGRDFYIDASGSYTGISNQYKSSSTLAVRNGNGESLVTISYWQGEETRNFNQDLY
                     NRDIEGFSASLAHDHMVNDSLLLSAKFNAYKDENIRKEGIASIQRDDKWESKEFFEQE
                     QHQTLSASLGVQLDTLSFWADHVDAKLYWRDSQSDTQTNRLLTKEHAFFDTLEFRRER
                     RDESFSDQLIGLSVDLEKAARVHNIEHQFIYGAVLNTNRYERPRHVDTKDSNGETYEN
                     IIPFAPAKAYGFGVYLQDRFSLNQWTFSAGLRFDLNNLTPQSEQPIAGFAVSEIQTSE
                     WSPSASVAYQWTPSFNSYLSYNHGYRAPTYDKAYGAADHSFVPLTPFFIAPNMNLQAE
                     TSDSFELGSKYDNGQSQAYVAVFYSLFDNFMDTKDVGFDSDRGAWIKQYQNINGVETY
                     GVEFTFAHQLNQHWSTTFKAGYVDGKDDQDEYVRTITPWEGNGQLNYQQQDWDAYARW
                     NWASSMDRAPACSDDIGRKAQCAQTSAWSTVDLGVSYQVMRDLDVSLNIMNLFDREYV
                     RYQDVAGVSQSQTLYSTEPGRYFTATAKYVF"
     misc_feature    175985..176047
                     /note="Signal peptide predicted for TVA2657 by SignalP 2.0
                     HMM (Signal peptide probability 1.000) with cleavage site
                     probability 0.999 between residues 21 and 22"
     misc_feature    176105..176437
                     /note="HMMPfam hit to PF07715, Plug, score 8.2e-25"
     misc_feature    176837..176857
                     /note="PS00307 Legume lectins beta-chain signature."
     misc_feature    177338..178123
                     /note="HMMPfam hit to PF00593, TonB_dep_Rec, score
                     2.8e-29"
     misc_feature    178070..178123
                     /note="PS01156 TonB-dependent receptor proteins signature
                     2."
     CDS             178136..180412
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0154"
                     /old_locus_tag="TVA2656"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0154"
                     /protein_id="CDQ48051.1"
                     /translation="MKKIIVLSTLLCLSHSAFAGEWDYPLAKTTIATKESAELYLSSL
                     YPDVGTLKFRYQTESLLGNHYNFDVWQNGQYQPQKALVLSTDQSDVVTRVFKSLHNTV
                     ERDGVALVAAELESPRRLVANEPPALSSGDVQSINVQLFDPDLRTMDQLPAPDSAWND
                     LADYPNQPHYQSVNVEMLQSAGKYYLANERVRQADATAIQQQDDAKQWVDSGVGLLSA
                     ENVAQWNSDAEILSMEMLDDRFVQLMAFYHLDQSIDYTKQLGFSLFSEPVRFDARGLS
                     SNNSSYYVGPKAVLFGVGGSPDALDADVVTHELGHGIHYQIVPDWAYGHSGAIGEGFG
                     DYWAGSHSFRRQYTQGKAFEIDTVFNWDGYFGTRISTRSLWNQRAKYFASAEYRAHES
                     VAGELGDELWSTPLFQALKQAVNEYGQEAFSEFDRIVLESMYGLGRGLKMHDLSESML
                     YTAKQLYPHRAYDAMLLQQFKQHNLVQEPFKFLLERRFVMPTDPLNVHIQATDRQASL
                     QTVATLQGETVTFASEKFQQQQWSIALPTTYTCGVKQTLQLESSYQYQPYLAMQSDKQ
                     TLSFIVGKPQLATPPVAINSVLKDASIDSTDTVTSGFKSYGLTIDVDNALIDEDFVVR
                     LQLSHPELQELRVTLISPAGTRVELLNQAPSAINGFDDYWVLAHDAILDSLQGEALSG
                     YWRLEVVDYSPGNSGTLIEWGVGRLAGYQCPQPVTNALSPETGGGSTSLLLLLPLAAF
                     ATRRRNLLAIFSLKLKNT"
     misc_feature    178136..178192
                     /note="Signal peptide predicted for TVA2656 by SignalP 2.0
                     HMM (Signal peptide probability 1.000) with cleavage site
                     probability 1.000 between residues 19 and 20"
     misc_feature    179045..179074
                     /note="PS00142 Neutral zinc metallopeptidases,
                     zinc-binding region signature."
     misc_feature    179987..180256
                     /note="HMMPfam hit to PF01483, P_proprotein, score
                     2.3e-20"
     CDS             180415..181875
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0155"
                     /old_locus_tag="TVA2655"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0155"
                     /protein_id="CDQ48052.1"
                     /translation="MHLRLSTLSLALLLAGCGGGGSGDVANTSLPSHKISGQIQAQNV
                     ALDATVCIDSNQNFACDVGEISTQADSQGRYTLMSDSTQIYRFPIVADVSTGISVMTR
                     SRQTSQSSILIAPALGKSSGNILNGVSSIFAGIMLDGNTEKEANRLLAEQLLQLGVEV
                     NGDISQNFSHTALAILDANAVVLLQKAKASERIDLLATLGQTMAKNTPLIASEIVSGE
                     KMTEYANTLMAQVSEERPLQDTGIIQFYSDQGAQARADADYPGQDAEYGLDITAKNDV
                     TGKSFAFIKLDAAGNELEAEASDWSCVKDVYSGLIWEVKSEDAASLNYKERLFALEIA
                     DKFIPFAKDVTAASCQAAGDAICTTQDYINRINQDKLCGLQTWRLPTNSEQYMMLDLG
                     ELGDDAVGFNRDYFPHQPQNTEFFDGHTWTSGIAYLNTSQFQSDGSMQYLYTALSGAT
                     KGERSPIELYSSSTAADNDPSYVSPIRVVATKENNQ"
     misc_feature    180415..180492
                     /note="Signal peptide predicted for TVA2655 by SignalP 2.0
                     HMM (Signal peptide probability 0.998) with cleavage site
                     probability 0.429 between residues 26 and 27"
     misc_feature    180433..180465
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
     CDS             join(181872..182132,182131..182418)
                     /pseudo
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0156"
                     /old_locus_tag="TVA2653"
                     /product="putative exported protein (pseudogene)"
                     /note="user locus_tag: VANGcII0156"
                     /note="Pseudogene after both 454- and PacBio-sequencing"
                     /db_xref="PSEUDO:CDQ48053.1"
     misc_feature    181872..181928
                     /note="Signal peptide predicted for TVA2654 by SignalP 2.0
                     HMM (Signal peptide probability 0.999) with cleavage site
                     probability 0.682 between residues 19 and 20"
     misc_feature    181998..182153
                     /note="HMMPfam hit to PF07603, DUF1566, score 3.6e-06"
     misc_feature    182200..182256
                     /note="Signal peptide predicted for TVA2653 by SignalP 2.0
                     HMM (Signal peptide probability 0.767) with cleavage site
                     probability 0.763 between residues 19 and 20"
     CDS             complement(182601..183734)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0157c"
                     /old_locus_tag="TVA2652"
                     /product="putative uncharacterized metalloenzyme domain
                     protein"
                     /note="user locus_tag: VANGcII0157c"
                     /protein_id="CDQ48054.1"
                     /translation="MAKFIVVVLDGFGVGEMADVPLVRPQDCGANTGRANLAHEGGDT
                     FMGHQEIMGTRPTAPLIQPFQVALPDIESALLAQGYRVNRHTIQQVSLLIVNEGVVIG
                     DNLEADLGQVYNLTCNFNRVTFESLLAIAAVVRKANSVTRNIAFGGSGCGITMDQILS
                     AVEVKQNPTNGQKYIGINAPSSGVYSEGFQVAHLGYGVDAKTQVPWYLHQRNIQTWLY
                     GKVADIVQNPHGCSYTSLVDTNQIFRFLIRDLCIEKEGFFCANIQETDLAGHQQDPKQ
                     YWTVLEKADEGLKDVITNMNEKDVLIVMADHGNDPFIGHTKHTREQVPLLCYQKGKQA
                     ISIGLRTTLSDVGATVCAFFGAQLPDHGTPITSLLNDQQKCHQ"
     misc_feature    complement(182703..183029)
                     /note="HMMPfam hit to PF01676, Metalloenzyme, score
                     1.3e-24"
     misc_feature    complement(183576..183638)
                     /note="HMMPfam hit to PF08342, PPM_N, score 6.8e-09"
     misc_feature    complement(183639..183728)
                     /note="HMMPfam hit to PF08342, PPM_N, score 8.3e-09"
     CDS             complement(183736..184893)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0158c"
                     /old_locus_tag="TVA2651"
                     /product="alanine racemase domain protein"
                     /note="user locus_tag: VANGcII0158c"
                     /protein_id="CDQ48055.1"
                     /translation="MFLDALEKQNPDLITAALTLFKQGKLQPDTTVIDVDQLLNNAQR
                     MKEVADRLGICLYAMTKQFGRNPLIARLLIEQCGYEGIVCVDYKEARMMAAHGLPIAN
                     VGHLVQPPSNMIRSLVAQIKPQVMTIYSLEKAQQISDAAIASNRQQGLLLKFFHSRDK
                     LYVNQEAGFPLEQAADVVRAIQNMPGVYIAGVTHFPCFLYDETLGKTEPTPNLTTLID
                     AKQALANLGIECEQVNAPSSTSIETLPLLAQYGCTHGEPGHAFTGTTPANATQPQAES
                     IALLYLSEISHQFANDSYCFGGGYYRRGQLENARVYSGDSCERVSVFNDDTDSIDYHL
                     RIPGLHPIGSPVVMAYRTQVFVTRSDVALVQGVSTPNPKLIGLYDALGNEV"
     misc_feature    complement(184093..184812)
                     /note="HMMPfam hit to PF01168, Ala_racemase_N, score
                     2.4e-09"
     misc_feature    complement(184702..184767)
                     /note="Predicted helix-turn-helix motif with score
                     1090.000, SD 2.90 at aa 43-64, sequence
                     QRMKEVADRLGICLYAMTKQFG"
     CDS             complement(185053..186354)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0159c"
                     /old_locus_tag="TVA2650"
                     /product="putative transport system permease protein"
                     /note="user locus_tag: VANGcII0159c"
                     /note="The function is not known but several
                     (family-members) are annotated as being homologues of
                     Escherichia coli YhfT, a protein thought to be involved in
                     fatty acid oxidation. Membrane associated"
                     /protein_id="CDQ48056.1"
                     /translation="MDIMHIGLVATLCAMTALIANMSAAVFHDGIRPILPQLVEGNMT
                     RREAGSVAFGLSIGFVASVGISFTLSTGLLNPWLLFLPTDILGVMIGSRWLAATAGGL
                     WGVLVVTSLAGVNAVLTGLPVDALGALGELGTPVMSAFALFPLLAIFYQFGWKAGAIT
                     AVVILFSRLMVMKFTGIYPESIQIFIGMLMLVFFAIQKDISDRKKGIEAPDMSGLHGL
                     FEERTKRIVKNLPFLAVTGALIAAVSNGGIFAGSEVSIYSLAEAYKITDPAAHDTAMK
                     QVALSEFMRGLGFIPLIATTALATGVYGVVGMTFVFVVGYLAPNMPVAAVLGAITICI
                     EIFLLRGIGRFLEQFPSIRNASDNIRNSMNTLMEFALLIGGVLAVMKMGSTTGFTIFA
                     MLFFLNEVMGRPVLKIAAPAVAAILTGVILNILYVIGLFAL"
     misc_feature    complement(join(185065..185133,185176..185244,
                     185326..185394,185422..185490,185593..185661,
                     185767..185835,185854..185922,185986..186054,
                     186067..186135,186145..186213,186274..186342))
                     /note="11 probable transmembrane helices predicted for
                     TVA2650 by TMHMM2.0 at aa 5-27, 48-70, 74-96,
                     101-123,145-167, 174-196, 232-254, 289-311, 321-343,
                     371-393 and 408-430"
     misc_feature    complement(185479..185502)
                     /note="PS00030 Eukaryotic putative RNA-binding region
                     RNP-1 signature."
     misc_feature    complement(186280..186354)
                     /note="Signal peptide predicted for TVA2650 by SignalP 2.0
                     HMM (Signal peptide probability 0.830) with cleavage site
                     probability 0.417 between residues 25 and 26"
     CDS             complement(186364..186723)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0160c"
                     /old_locus_tag="TVA2649"
                     /product="putative uncharacterized (membrane associated)
                     protein"
                     /note="user locus_tag: VANGcII0160c"
                     /protein_id="CDQ48057.1"
                     /translation="MKKIAIAGLQREQIRAQIELSEPGIFECHILSDMEAALKVKAGE
                     MDYFIGCCNTGAGGALAMAIAIIGFGQSCTIAKPAIKAKETEVAQFIERGCVAFGLSI
                     EHIEHAIPMLANLLAKK"
     misc_feature    complement(186505..186537)
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
     misc_feature    complement(186517..186585)
                     /note="1 probable transmembrane helix predicted for
                     TVA2649 by TMHMM2.0 at aa 47-69"
     CDS             complement(186761..187636)
                     /transl_table=11
                     /gene="php"
                     /locus_tag="VANGNB10_cII0161c"
                     /old_locus_tag="TVA2648"
                     /product="phosphotriesterase homology protein"
                     /EC_number="3.1.8.1"
                     /note="user locus_tag: VANGcII0161c"
                     /protein_id="CDQ48058.1"
                     /translation="MIDSTGYTYCHEHLHIDLSPQKGNLDCRLDQYELLCDEMKELRI
                     RGVRNIIEVTNAFMGRNPHFIENLIDDTGMNVLLATGFYIEGFFPDFLYTMDTQQIAK
                     QMIKEIEVGIEDSSLKASVIGEIGSSENGFSDTEQKVFRAAAIAHLETGRPISTHQSM
                     STMGKVQIDLLKSCGVEMENLTVGHCDLRDNLDDIQWMLDQGCYIQFDTIGKNSYYPD
                     TRRAQSLKTLCERGYVGQIMLSMDITRRSHLKANSGLGFSYLIDEFVPLLKQHGISDL
                     QISTMLQTNPARLFG"
     misc_feature    complement(186764..187633)
                     /note="HMMPfam hit to PF02126, PTE, score 4e-102"
     misc_feature    complement(187166..187213)
                     /note="PS01323 Phosphotriesterase family signature 2."
     CDS             complement(187640..188017)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0162c"
                     /old_locus_tag="TVA2647"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0162c"
                     /protein_id="CDQ48059.1"
                     /translation="MEQRLALLLHANVISQRAYDGCLQVIAMMDRQLGLPHDNEQYQM
                     ALTHLSRAADRIWQGEAVAEGLDSELLDEIYDDPGIQSVIDIHQKTLNAMSLSTVPAT
                     EESFLIANIYALYLAAQHDETQE"
     CDS             complement(188070..188966)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0163c"
                     /old_locus_tag="TVA2646"
                     /product="putative uncharacterized protein c4153"
                     /note="user locus_tag: VANGcII0163c"
                     /note="No Vibrios among Artemis-refs"
                     /protein_id="CDQ48060.1"
                     /translation="MPTQYINKEGTAIMNIAQYLMTTTEGDRLRTIDSLSEEFCVSVG
                     FIQKALTTIEHRNAVILSKQGRNGTFITQLNYRELVACAGINNVVCAMPLPYTRHYEG
                     LASGLKAQIGDLPLYFAHMRGASVRAECLRNGTYDIAIMSKLAAKELANGLVTAMTLG
                     VHSYSHEHRLIFKKGGYDQIRRVGVDPDSPDQKILTHQSFKDKNIEIVEIHYGESLIH
                     LTNGDIDAVVWLPEAIEMEKYGLDEKSLSDLPACRDASEAVILANGASTHITTLLRKL
                     IRMDQLIKHQRAVVNGEITPSY"
     misc_feature    complement(188814..188879)
                     /note="Predicted helix-turn-helix motif with score
                     1093.000, SD 2.91 at aa 30-51, sequence
                     RTIDSLSEEFCVSVGFIQKALT"
     CDS             complement(189278..191620)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0164c"
                     /old_locus_tag="TVA2645"
                     /product="putative lipase, Pla-1/cef, extracellular"
                     /note="user locus_tag: VANGcII0164c"
                     /protein_id="CDQ48061.1"
                     /translation="MLKTTFKISLLCSALWSVGCGDETNSSGASTTPTYEAYIQDALK
                     RDTSIKFTLSGANANVPLPSFALMNAKDGTLEIPTKGDDALTNPVAAMGTMDGWSTSM
                     PLFLDFEGVGLADGLISNGIYLIELTDSMIGSPTVKNVLTLNTNFTAIASASSDKIAI
                     VPNKALNPASEYILAVTDEITDVNGNIAGTSSSYAALKSKVKIYTDDKLGALQKVTQG
                     VESIFALAGVDQTKIIYSTWFSTQSVGQTLYSVKGATAAGLATTDIGNIWKQGANPNN
                     LNLSAAYTMSFGATTDFVTALNNDANFQTYIGAEKTTAKAFIENEYTTSSYNVNVTTG
                     TVKLPYYLEKGSNWNSQPFESAMPSLALIKNALADDNEKATIANQLIANNIDVTQLAT
                     SPSEQLKLVGLTLTKSDGSALDPQRIITRYSPVPKVKSLEDVDFLLFTPNAGTDWPIV
                     IYQHGITSVKEDAYFTAAHLANAGIAVIAIDQPLHGARSLDAQRSANADILAYLNLNN
                     LAVARDNTRQSILDIMGLRAAITYSQSAGLFVGSQLANADNTATTPPKFLGHSLGGIV
                     GLSAVANANANRTIGDASGDALYKFSGMAIANSGGQIGNLLMGSANYGPLIKHNLALS
                     ASPKYKAFADQYCPGLTEKVCYTTFENTASASDKAALQSQLDQFTYATQTLLDTMDPY
                     TNASYLISGGTATIPTYLLQVAGDESVPNNVTNTRAGTEPLATLLGLANAVPSDVITN
                     TSKVFVKMDSGTHTTFLAPQDTADGVLRAGALSQLAIFLN"
     misc_feature    complement(191558..191620)
                     /note="Signal peptide predicted for TVA2645 by SignalP 2.0
                     HMM (Signal peptide probability 0.826) with cleavage site
                     probability 0.535 between residues 21 and 22"
     misc_feature    complement(191561..191593)
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
     CDS             complement(join(191636..192799,194312..194383))
                     /pseudo
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0165c"
                     /old_locus_tag="TVA2644"
                     /product="long-chain fatty acid transport protein
                     (pseudogene)"
                     /note="user locus_tag: VANGcII0165c"
                     /note="split by IS-element"
                     /db_xref="PSEUDO:CDQ48062.1"
     misc_feature    complement(191642..192799)
                     /note="HMMPfam hit to PF03349, Toluene_X, score 1.7e-151"
     misc_feature    complement(191870..191917)
                     /note="PS00012 Phosphopantetheine attachment site."
     repeat_region   complement(192800..194311)
                     /rpt_family="IS91"
                     /note="ntCAAG + NB10_ISVa3 (complete: 1.508 bp); Accession
                     Number:AY255699"
     CDS             complement(192956..194203)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0166c"
                     /old_locus_tag="TVA2643"
                     /product="Transposase, ISVa3 (IS91 family)"
                     /note="user locus_tag: VANGcII0166c"
                     /protein_id="CDQ48063.1"
                     /translation="MVQYSGRRRRHHTLKEFVPRATKLLFEKDNAWEKVLWKHAQTFS
                     LWQITCVERMLACGTNMMGAKHYDCGTSNCPHTKVVCQSCKTKACSSCGTKSTEQWIH
                     TQLDVMPDCEHQHITFTMPSELWPIFEANPTLLNDLFSLAADTLLEWAKKHGLEVGIF
                     GALHTYGRALNWHPHIHLSVTRGGLDKHNTWKPIYFKKKHVEYHWRRTLIRLLRQKYD
                     DLNLSTSTTHHIQYYRQWNFFLERHYQRYWNIHFAKKTKVLKQTVNYLGRYLKRPPIS
                     ASRLRHYSGGTVVFKYLDHRDGTHKTKTLTQEEMILRYVSHIPQHHFKMVRYYGFLSN
                     RKRGRLLPLVYLALEKKSLEQAEPLTYAKQYKGFTGNDPYQCVLCGGRMEFTGFMKGP
                     KNDELLDSRRMSMREARRLSVAA"
     CDS             complement(194729..196777)
                     /transl_table=11
                     /gene="malS"
                     /locus_tag="VANGNB10_cII0167c"
                     /old_locus_tag="TVA2642"
                     /product="alpha-amylase"
                     /EC_number="3.2.1.1"
                     /note="user locus_tag: VANGcII0167c"
                     /protein_id="CDQ48064.1"
                     /translation="MKFSTLTLALCAAAPVVFAAPNLTISTTTTSRDFPLDAKTPLVI
                     PLTKESYTIKVSGIESQCSAPAQQSIKFNAPIALNCGQETELPLTIRFTGDYAFAYDG
                     EQQTLTFVRQAKKSTTSKFKRPIPSVSCEQYQGGEVTLQLGNTFPDGTRLKETFTGQI
                     LSVKNSQVTLMPSPTSGGLVLLAPATDAASEPFTYRNATIYFVMVDRFNNGDPSNDNS
                     YGRKKDGKEEVGTFHGGDLKGVIAKLDYIKSLGTDAIWLSPIVEQVHGFVGGGDSGSF
                     PFYAYHGYWTRDFTKIDQNFGDEEDLKTLVTEAHKRGIKILLDAVLNHSGYATLADLQ
                     FDQIEVVNPQNLPQKWVDWMPKAEENWHSYNQSIDYQSANWSLWWGKDWVRAGLPGYQ
                     KPGSSDITMTLAGLPDFRTESTQAVTPPQWLLNNPGTRVVAREQYSVADYLIEWQTDW
                     VKRFGIDGYRVDTVKHVEGEVWRRLKSEASRSLDAWREQNGQQGQPFWMMGEVWGHSA
                     YRSPYFDDGFDALINFDMQKRVDKGAACLSQMAMVYRDYAQTLAKYPDFTPVSYLSSH
                     DTELFFSRFNSFEMQRNAANALLLAPGAVQIYYGDEVARQVGPYADDFHQGTRSDMVW
                     SLDEERQALLKHWQTLGQFRQSHPAIGAGIHHEIEQQNAYLFSRTLNNDRVVIAFVGR
                     "
     misc_feature    complement(194846..196174)
                     /note="HMMPfam hit to PF00128, Alpha-amylase, score 5e-81"
     misc_feature    complement(196721..196777)
                     /note="Signal peptide predicted for TVA2642 by SignalP 2.0
                     HMM (Signal peptide probability 1.000) with cleavage site
                     probability 0.999 between residues 19 and 20"
     CDS             197099..198007
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0168"
                     /old_locus_tag="TVA2641"
                     /product="putative oxidoreductase, aldo/keto reductase
                     family"
                     /note="user locus_tag: VANGcII0168"
                     /protein_id="CDQ48065.1"
                     /translation="MVAKVTIAPQGPDFSELVQGYWRLADWGMTPQQRLTFLKQHIEL
                     GISTVDHADIYGNYQCEKLFGEALALEPALREQIQIVTKCDINLCGAKTPQRKINHYD
                     TSSAHIYQSVNNSLERLGVSEIDLLLIHRPDALMDADEVAEAFSELRKVGKVKHFGVS
                     NFSPRQFELLQSRLGKPLVTNQVEMNPLNFDVVHDGTLDHLQTQRIRPMAWSCLAGGE
                     IFNGQTEQAQRVRSELEAIAQEIGADSIDQVIYAWVLRLPSKPLPIIGSGKINRVKAA
                     IAALDLELTREQWYRVWVAAKGHGVP"
     misc_feature    197120..197989
                     /note="HMMPfam hit to PF00248, Aldo_ket_red, score 1e-54"
     CDS             198212..199030
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0169"
                     /old_locus_tag="TVA2640"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0169"
                     /protein_id="CDQ48066.1"
                     /translation="MAHLAYLLRNLSSSSKFHHQRMKGTIMMTTFSYSRSLRNLLLSV
                     GLLLSITAVQANPSDALIMQYNQAAEGDSDKVELVLHQLEQLIKQQGAKPLSLAYLGS
                     AQTLQGRDAFMPWNKMRYVEEGLATIDKGLTLLSNHPQPLAEQERVMGLPDSYLTRAV
                     SAATYTSLPDMFNHFERGYDLYLDLLVEPELTAQPFAATAWVYRYAIQAALRANDIPQ
                     AEQWLAQMQTHQKQGKQVDNQPAEHPQIIQAKALITNALIENGLTEKTHELKSE"
     misc_feature    198212..198376
                     /note="Signal peptide predicted for TVA2640 by SignalP 2.0
                     HMM (Signal peptide probability 1.000) with cleavage site
                     probability 0.990 between residues 55 and 56"
     CDS             199045..199728
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0170"
                     /old_locus_tag="TVA2639"
                     /product="Putative ABC transporter, ATP-binding protein"
                     /note="user locus_tag: VANGcII0170"
                     /protein_id="CDQ48067.1"
                     /translation="MLRFEQISKTYQLGMQPLLALSAVNGEVKQGEMLALCGPSGSGK
                     STLLNILGLLDQDYQGDIELAGYPYPTDPREAAALRRKKLGFVFQKFNLVPVMTAAEN
                     IAYPLMLNGYSLRDQRTLTRTMLAKVGLETLAHHRPDHLSGGQQQRVAIARALIHNPE
                     MVIADEPTASLDSHTANVVIDIMKSLGHEMGTTFIVATHDARMANRCDRTLQLVDGKV
                     IQEAMKWAS"
     misc_feature    199135..199692
                     /note="HMMPfam hit to PF00005, ABC_tran, score 4.9e-56"
     misc_feature    199156..199179
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
     misc_feature    199465..199509
                     /note="PS00211 ABC transporters family signature."
     CDS             199746..200975
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0171"
                     /old_locus_tag="TVA2638"
                     /product="putative transmembrane protein"
                     /note="user locus_tag: VANGcII0171"
                     /protein_id="CDQ48068.1"
                     /translation="MAALNLLRNRRRSLLSVLIIAIAVFALTSAGGFGLYTYQALRES
                     TARDTGHLTLSQPGFFEQDEESPLANGIADSALIVERLIDDKRIRGIQPRIEFSGLVS
                     NGSKSTIFVGSGVNHKEFDMKGPFLDVRQGKTLSNIDSPRFDASEPEVMLAVDLAKNL
                     NVSIGDWVTLLTSTADGALNAVDFKVHGIYSTGVPELDKRQLYLHIQSASELLASNKV
                     STLSLFLFSTEQTESMRHWVENKLSLMSLRQAIQVTPWQQRAFFYQKVKDLYDRIFGI
                     MGLVMGLVVFVALFNTLTMSVTERTREIGTLSALGTYPNEIVASFIREAVLLAILGTL
                     VGAAFNALTSVLLMVVDVQMPPPPGRTEGYPLHIYFSWELVLLSAFGVLSICIAAAWL
                     SARKGVNKPITEALAYV"
     misc_feature    199746..199835
                     /note="Signal peptide predicted for TVA2638 by SignalP 2.0
                     HMM (Signal peptide probability 0.999) with cleavage site
                     probability 0.389 between residues 30 and 31"
     misc_feature    join(199782..199850,200562..200630,200727..200795,
                     200853..200921)
                     /note="4 probable transmembrane helices predicted for
                     TVA2638 by TMHMM2.0 at aa 13-35, 273-295, 328-350 and
                     370-392"
     misc_feature    200397..200951
                     /note="HMMPfam hit to PF02687, FtsX, score 1.4e-33"
     CDS             200968..201729
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0172"
                     /old_locus_tag="TVA2637"
                     /product="putative uncharacterized (membrane) protein"
                     /note="user locus_tag: VANGcII0172"
                     /protein_id="CDQ48069.1"
                     /translation="MYKWIMLLLIMLSGGYSAAGWAALDAGQMTKNADQYRLGYSAAK
                     VVSLVSLYERGELDKTRQYHVYTKANRDSLVVFKSSVEAGQKMLMLDENYWLLMPKSR
                     RPIRITPMQKLLGEASVGDISTLTWSEDYQSQLMGEEQIETPSGQPYLTHKLSLLAVT
                     EGANYQQIILWLDKENDFPIKASLYLRSGKLAKQAWFRAGEKEGRMRVTSMTLLDQIQ
                     PTKKTVVEYQHIEPMELDEKYYNPAYLTRNSLSEL"
     misc_feature    200968..201033
                     /note="Signal peptide predicted for TVA2637 by SignalP 2.0
                     HMM (Signal peptide probability 1.000) with cleavage site
                     probability 0.682 between residues 22 and 23"
     misc_feature    200980..201039
                     /note="1 probable transmembrane helix predicted for
                     TVA2637 by TMHMM2.0 at aa 5-24"
     CDS             201731..203032
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0173"
                     /old_locus_tag="TVA2636"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0173"
                     /protein_id="CDQ48070.1"
                     /translation="MKRVAFAFLTSVLSLAARAEAPSFDWDWVMSASTTAHRDSLFFP
                     SNQARDTQQIEALLDVEMRWHGWLGLVAIKQNALLSSDAQQHADSEFILQELFWQGSL
                     VLADVPFELTLGKVRLDWGVGYGYRPLDLFQPYRRNPVGIQVEEGAGTLSASYYDQQG
                     EWTLFYTDSSWTEQQGSELQQMTEQQGAGVRRYQLMGNAEWQAIAYYDDVRRGVLGSS
                     FVTVLTDAWEVHASALYQRHYLAYQQPSALAQAVYSQQQEIESRMALESRTQGYQALV
                     GFNWSGSDGQSVIAEYWFDSRSWGKEQWQQAQTNADSVRYQHNQALGWSYAQGYNHVN
                     LVQHNVMLHASLDSQAWRHWPWSQSIEWLQGLVPTLDVLIAPQDGGVIATQWLNYSVY
                     DSGTASIEIELAARFMTGPADSTYANLPDKHMILLNMKGKF"
     misc_feature    201731..201787
                     /note="Signal peptide predicted for TVA2636 by SignalP 2.0
                     HMM (Signal peptide probability 1.000) with cleavage site
                     probability 0.998 between residues 19 and 20"
     CDS             203032..204084
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0174"
                     /old_locus_tag="TVA2635"
                     /product="Putative two component sensor histidine kinase"
                     /note="user locus_tag: VANGcII0174"
                     /protein_id="CDQ48071.1"
                     /translation="MCEKVEIRNLAKSLLFTSLFCVVIAFTTQAIWPSDITLHLAISF
                     GYGYSAVAIAHLLSRFAPQLSARLVNVFSLTGSMIFGTLHAYLWLSKYAHFSHFSAMK
                     PVIFLGFVFTGVCFFYFYAHEQKLIAEKALEASKRRQSEQEKALILSQLQQLQSQIEP
                     HFLFNTLANISVLIGSEPYKAQMMLEKLTDLLRGSLRSNRNRTTTLREELHLVDAYLG
                     IQKIRLGDRLDYEIAMPGAADHIPLPPMLLQPLVENAVSHGIEPKAAGGKVTIKSEIY
                     DEWFEVSVCDSGIGLQPSALSAGHGIALDNIRQRLSGLFADDACLTIAQNHDAGVTAT
                     IRIKRLLLDQLQGSAT"
     misc_feature    203032..203121
                     /note="Signal peptide predicted for TVA2635 by SignalP 2.0
                     HMM (Signal peptide probability 0.772) with cleavage site
                     probability 0.741 between residues 30 and 31"
     misc_feature    join(203068..203127,203137..203205,203230..203298,
                     203341..203394)
                     /note="4 probable transmembrane helices predicted for
                     TVA2635 by TMHMM2.0 at aa 13-32, 36-58, 67-89 and 104-121"
     misc_feature    203479..203727
                     /note="HMMPfam hit to PF06580, His_kinase, score 6.3e-42"
     misc_feature    203758..204051
                     /note="HMMPfam hit to PF02518, HATPase_c, score 6e-08"
     CDS             204081..204869
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0175"
                     /old_locus_tag="TVA2634"
                     /product="Putative response regulatory protein"
                     /note="user locus_tag: VANGcII0175"
                     /protein_id="CDQ48072.1"
                     /translation="MSTVSATAIIADDEPLLRHHLNRALGEVWPELDIVAQAENGRVA
                     LSMIEQHQPEVAFIDIRMPEMDGMSLARQLAGLAKPPLIVFITAYDEYAIQAFEANAA
                     DYLLKPLSEVRLVQCCTKLQLRLAEHSSERQLPDLQTLLQQIQHISQQASPSFLSWLK
                     VQKGEDIHLISVADMLYAKAEDKYLSIYVKSDSGVQEFLLRSSLKELLQQLDPNQFWQ
                     IHRSTAVNVAKIDKVKKEFTGKMYVLIGPDKLPVSRALQAQFKS"
     misc_feature    204096..204428
                     /note="HMMPfam hit to PF00072, Response_reg, score 8e-28"
     misc_feature    204573..204866
                     /note="HMMPfam hit to PF04397, LytTR, score 2.7e-22"
     CDS             complement(204904..206487)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0176c"
                     /old_locus_tag="TVA2633"
                     /product="Putative sensory box (GGDEF/EAL domain)
                     regulatory protein"
                     /note="user locus_tag: VANGcII0176c"
                     /protein_id="CDQ48073.1"
                     /translation="MQNNDSSPSKFSVAKEILSAKINAFIPILGIFLFVFTFAIVKNF
                     YDTNRQATRFGEQAITQLEHHINQTSDELNQLSKNISKHCQREDIIALRSYVFRSKMV
                     KEVGMYNAHGTIFCTSNEGHTTIHLYKHILDRLKQSPTNTTISLTKSRSKEQTFFVYA
                     SQPDMSGLNALMPPEQFMNLVAPKLAKWHYGYQVNVLSQSIRSDQEEIDSAHTSFLFK
                     SEHYPLSIQIYLNNGSYAYHFLDNLWLVLLTASIISLIYLAYHNYYLSRNTLEVSLRE
                     AISNHQLELYLQPIVDITENRIVGSEALLRWNEPSQGYISPTIFIPLSERIGVIHQIT
                     YRVLKLVTECVEQHKHALHDQYISINISRLLIIDNYFMDYMKRYATKHPAIVPRLLLE
                     ITEDNHFNVDELKLAMENLQRLKQLGFKIAIDDFGTGYSGLNFIHQHDFHTLKIDQVF
                     IKSLHQNSAITSVLVSMIKLAKQLNMRLIAEGVENQDQVRELELLGVRYIQGFYYSEP
                     MSVDAFFQFTLSAKQIAHR"
     misc_feature    complement(204964..205692)
                     /note="HMMPfam hit to PF00563, EAL, score 8.7e-85"
     misc_feature    complement(join(205693..205761,206356..206424))
                     /note="2 probable transmembrane helices predicted for
                     TVA2633 by TMHMM2.0 at aa 22-44 and 243-265"
     CDS             206866..216300
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0177"
                     /old_locus_tag="TVA2632"
                     /product="Haemolysin-type calcium-binding repeat
                     containing protein"
                     /note="user locus_tag: VANGcII0177"
                     /protein_id="CDQ48074.1"
                     /translation="MDLQVVVQPASVSEVVGDVIAVDAKGNARQVTVGDSLMKGEILI
                     TVNHSSVTLFINGQVAVVEQNCVACFGDTVLEHYTSIDLIQFPVAGDINADLTQLNEA
                     NFDADNIAAIQQAILDGQDPTQILEATAAGAGGEGSANAGFITIDYNFAEVLASTFFE
                     TAGRDAQQSLTETNLSPLRFTAGGESLSAALVEGSLSLNSYPQSVTANVLIAAGDLPL
                     DAASFVPESLSLAALLSELNSDITSAGRSVSFRYDATANHIVGELDGSEVLRIDLVAT
                     SVGKDINLEIVTTISQPIDHVPSVGGGLVSFANDQIAIQFDVTGSDAGGNPIRSPISI
                     AISIGDGNNPVMSDEPSTSVYEDNLANIGSDASASQTITVSGQFDTQLGSDQIESYQL
                     DLSANPLAGLTSAGVAVQLASSSSLNGVYTYQASANGQPIFELILNPDGRYQFTLQGA
                     LDHPVNSDELLLNLSVLATDYDGDSSESVRLPINIIDDKPEIIGVDALSVDEDDLASG
                     SDSSKEPLFAEGYFTTTQGADTVVSYQLDTSINPIAGLTSQGESVVLGAATVDANGNY
                     LYQASTTPSGQTVFSLVLNADGSYRFTLQGPIDHAQGSDELLVNFKVVATDYDGDSAN
                     ILLPVTIHDDQPIIAGVQALSVDEDDLASGSDSSKEPLFAEGVFTTQSADKVVSYQLD
                     TSSNPLAGLTSQGEAVSLGAATIDADGNYHYQASAAPSGNAVFSLVLNADGSYRFTLQ
                     GPIDHSQGSDELLVNFKVVTTDYDGDSANILLPVTIHDDQPIITGVQALSVGEDDLTS
                     GSDSSKEPLFAEGVFTTQSADKVVSYQLDTSSNPLAGLTSQGEAVILGAATIDANGNY
                     HYQASTTPSGNAVFSLVLNADGGYRFTLQGPIDHAAGSDERLVNFKVVATDYDGDASD
                     ILLPVTIVDDKPTIIGIRVGSEQSVDEDDLATIGSDRSDSTVIAGHFDVIDGADGIVS
                     YQLSDLVTPVENLTSGGQEIEIIQISSSNGVTVYEAVIKNTTDVVFRLTLNGSADSYQ
                     FELLKAIDHPTGNGENSYILDLPITATDRDGDVSASASLPISIVDDIPTLHDKSITSV
                     ENTAIKTVNLFSQDNNTSPDTQGADHGAITKFVAVDEAGRDIQFRDGNGASLANEIEL
                     NGITKTVTVVEIKNGVERDLGTLTITPNGNATFKPVASLEHGDDPTISFTVDVTAQDF
                     DGDVSTEQLNINILDRNATITVANVIGAEDAGRDGVTILFNDPNQITNSQDNQSGLNT
                     SPLKVDLQINLYDLDRNESIGDVKITASNAHGDFYYLNSSDVYVKLELVSGRFVLPAD
                     AVEQSLTGSVAKIENLYFVPDRHYASANGGFQLNITVQVLNNGLHDHNVNGKLRIEVE
                     SVADIATWNSSSQFHYDAVEDSDNITLDVLAQTQDNSTPETILYEIRFTQGEGEAQLV
                     YADGTPVVMSSDASGHYYLVSASNINQVQVDPNDNFSGQIKLDITAITTEQNNAHVGK
                     ESARSETKEIVIDVSPVADMGSFSVNRVNVFEDNAATQNTVDPTTDHDPLLLSEVITM
                     AGSVDSDGSETLYVRLSDFSETGVTLIWLGAGASEISQITDANGHTYYEVPEQYLDQV
                     EVLPPLHSNADFTFSVEGIIKDMVNLSTGAVTDEISLGAKTVNVSVKGVADIPTIDFH
                     SNSTNTWNEFSENGLQVIETTIDENQSVGFGFSVLSGELADNPADSSESITVLLSNIP
                     DGVKLYDSVGSVINLVFVGYDTAQQPIYQANLTSAQVDSGIRVEPSHSSTENINIKMT
                     TIVTENDGHTRQIESEIRIKVAPVIDVVDNYQSHSLGNEDSRINIHWQPEEEQHLDAD
                     EYFASVTLSGFPAGSTIYVDGVVTALGSNGKLILTPALGQSEQDFSAQVLTTGYVQVQ
                     PPEHSSTDFTLSTEIVVKEQDNEYVDAINSGEGIASKVIHGSVDVTVRPIVEADGQLR
                     VEDNGVVTNKAVADASGAIYFTINDAAGGEPNANVIRFDNADTQSTEGYQSLEVVDQL
                     VVRFSNITPQVLDQLLITGAINNGDGSWTIVDEQNFSVKAPNGLTLSSGNDPDGDGYN
                     DITVTIFAQVYDQGEDSSEAKVVRQVQSELTLQFPLTATGNNTVAADITLVGNADDIV
                     LGIEDNAINLGQQIQDKLMVSASGFDGVEDELSIVIAQSVLPAGASLSGGHFDFVDGL
                     YVYKGTVNTDGSISGLENLQLHLPEDYAGDFNLPITFVTTDTASGDEKTFSTQIPVAV
                     SPVADVPGTHQPQDDDITPKATLTIEGTLGLDANHQPTSSSSDVPTNDGTGYEDGIIH
                     LSLDIDLADIRNSATEGQEVLSEVTLTLQGTNIGTFVDAQGNDLGTSITFSQPQLPAA
                     LDNVYFKPAPNYPTGDDDNTVNITVAGKVTDITQFDDTNANALGVANTDADKPFTTQV
                     SFDVTSVVDDVIISSGGSSDIEVHGLEDEWIVLSKPGSEFTVDLTDTDGSEVFVSIKL
                     TGVPTDFVVSSLSSDYTVKNNGGGEWSIQINNPAQTSINLSDIAMKPAKNFSGEVEIG
                     IKVFTQESLLGVPVEHNGSFRLDITPVGDVVDVEPVTNGAGDEGVDIEIDINAQIIDK
                     ADSIAAGTNHSENSPETLRIEVSGVPDGASIALPDGTLGTYIGGGVWLLNADAQSLDK
                     LIFNSGDWHKDTWAGDLTIKVQSVDTGLDGTEHLGPAREFTVSVDVQAVNDAPTIDSA
                     TVTTTIDEEAGQKVTGLSVSDVDYAGSHANDPMTVILSVSEGLLSAVIPALSSVTQST
                     NLAGELVLQGTLSDINALLNSSDPASGVFVDATAIGSDHIDLTIKANDGGVYADNVSG
                     MALEETETVSIAVTPKANTPILTLDPSFNYMKQTYVSQSISAQGIALLGLIAALTDSH
                     EVLSLEIDSLPSGATLSSSSGSVIEQNGVWIVSADAIDGLQVSGLDLGQHTLSVAAIS
                     TETDGSRAASASIDIAIEVLPDGSTIDQSTNGDDAQLLAGNVGAQLLGGSGHDHLEGG
                     DGDDSLVGGGGNDTLIGGLGADILTGGSGADIFKWTLDTVDEQTDTITDFNAGEGDVI
                     DLTDVVADLHLPMDQLLVSLHTSHQIEAKVMTNTTDVELEILTDNNVHQTIVVQDLAS
                     QFNFDGMASIDIVGFLLDNNIIKHDV"
     misc_feature    215854..215910
                     /note="PS00330 Hemolysin-type calcium-binding region
                     signature."
     misc_feature    215863..215916
                     /note="HMMPfam hit to PF00353, HemolysinCabind, score
                     0.0008"
     misc_feature    215917..215970
                     /note="HMMPfam hit to PF00353, HemolysinCabind, score
                     0.0017"
     CDS             complement(216427..217755)
                     /transl_table=11
                     /gene="dcuB"
                     /locus_tag="VANGNB10_cII0178c"
                     /old_locus_tag="TVA2631"
                     /product="C4-dicarboxylate transporter, anaerobic"
                     /note="user locus_tag: VANGcII0178c"
                     /protein_id="CDQ48075.1"
                     /translation="MLYLEFLFLLLMLYIGSRYGGIGLGVVSGIGLVIEVFVFKMPPT
                     SPPITVMLIILAVVTCASILEAAGGLKYMLQVAERLLRKNPKNVTLIAPFVTYAMTFM
                     LGTGHAVYSIMPIIGDVALKNGIRPERPMAASSVASQIAITASPISAAVVYYLAQLSN
                     IQHEITLLSILLVTVPATLFGTLLMSLYSLRRGKELDDDPEYQERLQDPVWKEKILNT
                     TATTLNETLPAAARNSVLIFIGAILTIVVLAMVPETRTIVEGSKPISMAVVIQMMMLC
                     FGGIILLATKTDPRDVPNGVVFKSGMVAAIAIFGIAWMSDTYFQYAMPQFKSGIVEMV
                     TDHHWTFALALFIVSVVVNSQAAVAVMMLPVGLGLGLEPALLVGLMPALYGYFFIPNY
                     PSDIATVNFDTTGTTKIGKYYFNHSFMSVGLIGVVSACCLGYVLSQIIIG"
     misc_feature    complement(join(216436..216504,216589..216657,
                     216676..216744,216814..216882,216901..216960,
                     217003..217071,217195..217263,217291..217359,
                     217420..217488,217546..217614,217639..217698))
                     /note="11 probable transmembrane helices predicted for
                     TVA2631 by TMHMM2.0 at aa 20-39, 48-70, 90-112,
                     133-155,165-187, 229-251, 266-285, 292-314, 338-360,
                     367-389 and 418-440"
     misc_feature    complement(216466..216498)
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
     misc_feature    complement(216637..217743)
                     /note="HMMPfam hit to PF03605, DcuA_DcuB, score 8.5e-243"
     CDS             complement(218036..218485)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0179c"
                     /old_locus_tag="TVA2630"
                     /product="Putative acetyltransferase"
                     /note="user locus_tag: VANGcII0179c"
                     /protein_id="CDQ48076.1"
                     /translation="MKVTFRPASDSDYQFAFDLKKVAEMDGITAIFGWDEELQQVLHR
                     QEWHSGLPTIICADGQPIGTYLLQSKHETLYFSRFFILPDFQNRGVGSQVLQLVVNQA
                     NLTQYPCKLCYLQGSPVGALYQRFGFTHYQMDDEFSHMHFIPTPKGQ"
     misc_feature    complement(218099..218329)
                     /note="HMMPfam hit to PF00583, Acetyltransf_1, score
                     9.1e-08"
     CDS             complement(218528..219622)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0180c"
                     /old_locus_tag="TVA2629"
                     /product="Putative response regulator"
                     /note="user locus_tag: VANGcII0180c"
                     /protein_id="CDQ48077.1"
                     /translation="MPIENLDNCTVLIVDDSPDNLAFMSQGLANRYHVKAAKSGPMAL
                     SILDKFSIDLVLLDIVMPEMSGFEVIQKIMANPNTQDIPVIFLTAKDNPEDQKLGFEL
                     GAVDYVYKPVSVPLLRARVDTHLQNKISKDILKNQNGYLEKEVIKRSNELDKMQDAVV
                     YALASLAETRDPDTGNHILRTQHYVKALAEQLAKLPKYQQKLTPNVINTYFKAAPLHD
                     IGKVGIADNILLKPGKLDSDEFEIMKGHASLGLRALEKAEKMSGAKNDLIDMAKEIAH
                     GHHEKWDGSGYPNGLQGDAIPLSARLMAVADVYDALICRRIYKEPMPHADAKGIILDG
                     RGSHFDPEVIDAFLAIEERFISIAHEYADD"
     misc_feature    complement(218687..219103)
                     /note="HMMPfam hit to PF01966, HD, score 6.6e-22"
     misc_feature    complement(219257..219598)
                     /note="HMMPfam hit to PF00072, Response_reg, score
                     1.3e-33"
     CDS             219746..223708
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0181"
                     /old_locus_tag="TVA2628"
                     /product="Sensor histidine protein kinase"
                     /EC_number="2.7.13.3"
                     /note="user locus_tag: VANGcII0181"
                     /note="The CDS seemed to be truncated at the N-terminus;
                     adjusted to match Vvul-sequence (which were different from
                     the ref_Vchols)."
                     /protein_id="CDQ48078.1"
                     /translation="MRSIRTLFTVLFIAMGLCSIAMFSITDKVAALRTESRQLNDELY
                     RFYRLSQELKQSSDHLTKFARAYASTGDEKWLNLFNYVLSVRNGSVPLPKGNEYEFWD
                     VVAQNKLLARSLGGAPDNPSLLDRMRLSGIESVEFLELKNALTLSDSLVSLEREAFMA
                     IKGWKKNSQGEFVDTGEPDLELARAILYGDQYFAEKAKIMQAIGSAHQSIMQRMEQNI
                     QRADSEALRYEWINLALVLTLLSVIIASFVLLWRLYINPLSQLLKTVVTQVKREDYAF
                     TITQTAYAELQHFIDSLNVVFHHIAEQLSQNTLLKDFNIILRKNDSTDRLCNEVTQFL
                     LHQFPLEMVGMYIYQEGVLKRVAGVGYGEHSAREYTDPSSTQLSVLLSGQPYAMKALD
                     GNCHIEFNGGKLVINEVYYLPLHVNQHPVALLELGTIGSLSSLQFQWLSQMLDDLSVS
                     IQLSQNIEIQRRAEQKVLEQSQLNQEILDATPNPMYCLSASGTYLTINAKFMDLVGLS
                     AEQIIGKSPQDIFQNETATIFAQVHKRLGEEQSSQDYELSLYDASHHKREMLVYEASF
                     QNNRGEVSGIVGILLDLTDRKQMEEQLREAKETADAMSQAKGDFLANMSHEIRTPMNA
                     ILGMAHLALNTELNPTQQKYISRINESAKNLLGIINDILDFSKIEAGKLNVEHIDFSL
                     DEVLDNLTTLISLKAQEKNIEFLLDIDPHIPVGLVGDPLRLGQVLVNLCGNAVKFTEQ
                     GEIIVSARVVGQNDANVTLKFTVSDTGIGIAESNVATLFSAFSQADNSITRQYGGTGL
                     GLSISKQLVGLMGGDIQVHSEEGSGSTFEFTVECGLQEAKMRDIAKPLSALAGKRALV
                     VDDNDSARNILMTLLNAMHFEAKSVSNGFEALDEIRNTHFDMLFIDWNMPGMNGIELL
                     QRMKPLGVFDNTKRFLVTAYGREISLVGENSKLVDALIVKPVNPSNLLDAIMDSYGIE
                     QLRQSHEYLDHDTRPTFIGQKVLLVEDNEVNQEVAFGLLESTQLSIVLANNGQEALTT
                     LQQEAFDLVLMDMQMPIMDGISATKEIRQHEEWKTLPIVAMTANAMSSDVEHCLNAGM
                     NDHVAKPIDVQRLYQVLRKYLKANETTPVPSTVLPDQVKPSTGYPELTGIDVEQAIFR
                     IGGNAQRYFEILDHFLASQQQEIAQFPKLIDKGQWEEAERVMHTLKGSAANLGIEPIA
                     QLANEMEGVVQRHTKPAIQDLNTVSKLMSTLLDELRDWEQTQLHPQQEHRDIALLYQQ
                     LVQCVENYDADAIHMIHQIKQCNLWSNEQKKSLMHAIEDFDFEAAKEVLAQLPVPTEK
                     "
     misc_feature    220442..220510
                     /note="1 probable transmembrane helix predicted for
                     TVA2628 by TMHMM2.0 at aa 212-234"
     misc_feature    221177..221509
                     /note="HMMPfam hit to PF08448, PAS_4, score 2.1e-09"
     misc_feature    221270..221293
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
     misc_feature    221561..221758
                     /note="HMMPfam hit to PF00512, HisKA, score 2.4e-28"
     misc_feature    221897..222244
                     /note="HMMPfam hit to PF02518, HATPase_c, score 2.4e-40"
     misc_feature    222299..222643
                     /note="HMMPfam hit to PF00072, Response_reg, score
                     5.4e-23"
     misc_feature    222719..223063
                     /note="HMMPfam hit to PF00072, Response_reg, score 2e-40"
     misc_feature    223211..223459
                     /note="HMMPfam hit to PF01627, Hpt, score 5.2e-11"
     CDS             223853..225589
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0182"
                     /old_locus_tag="TVA2627"
                     /product="methyl-accepting chemotaxis protein"
                     /note="user locus_tag: VANGcII0182"
                     /protein_id="CDQ48079.1"
                     /translation="MNINNTMKLVFAVIGIGIVISVVTVLQLNGLMQQVDNMAQVRYQ
                     SYQAADELRQSSDDLTRLGRTYVVSGDEKYEKMYMDILDIRNGKKPRPQNYHTIYWDL
                     VLQYGQKPKADGKNISLNQMMTDLGFTQQEFSLLKEAQANSDGLVNMEVKAMNAVKGL
                     YPDSNGNYTVRKEPDRNMAISLLHSNEYHQEKAKIMAPIDKFFIELENRTNKQFMDAA
                     QKVKSTVLIGNISLISVFVIAIIGYAIVNRKVVKPIDTMAKLLQQVDKNSDLTLRVDD
                     NSHNELGIIGGTINKVLGSYATTISKINQVNHTISAISETISDVTKQNVKVANQQNQE
                     LEMAATAMEEMTSALSSVAESTTMAEEYAGSAEKEASTSKQVFDKTTHEFGELEGEFT
                     KTSEIIQQLANESNNVGNVLDVIKAIAEQTNLLALNAAIEAARAGEQGRGFAVVADEV
                     RSLAQRTQQSTGEIESMISMLQEKAEQSTKTIRVSADKMQSTRSNMSVANEALGTIQG
                     SAIEIHKLNTSISAATEEQLAVSDEISSNLSNIKALSGDMNVAINQLGPVVVDLQRNV
                     DELNSAIKHIRT"
     misc_feature    join(223880..223948,224525..224593)
                     /note="2 probable transmembrane helices predicted for
                     TVA2627 by TMHMM2.0 at aa 10-32 and 225-247"
     misc_feature    224534..224746
                     /note="HMMPfam hit to PF00672, HAMP, score 7.6e-05"
     misc_feature    224795..225487
                     /note="HMMPfam hit to PF00015, MCPsignal, score 6e-51"
     CDS             complement(225719..226981)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0183c"
                     /old_locus_tag="TVA2626"
                     /product="Putative (amino acid) transporter"
                     /note="user locus_tag: VANGcII0183c"
                     /protein_id="CDQ48080.1"
                     /translation="MNKLKQEITLLSGIGQLSTTLMGTGLFMIPAIAAGIAGELSLWA
                     WLLLFVAICPIALTFAALGKRYPNAGGTAYFVRQAFNAKLERSVAWLFVSVIPVGVPA
                     AVALAAGFAQQLLPAPLNSAMMAQVLTVLLLIAVNLAGTKSSGQLQTVIALSIFVLVG
                     AFFWIGDVGAADLAMPALSTDSIWPIGAALGVMFWCFVGIEAFAHMGEEFKNPQRDFP
                     IAIIVGCFVAGITYWACSVVILKFGAYGSAEFDSTSIPWLSEQIFGSSLATVISLIGF
                     FACFASINLYTQSLSRMVWAQARQYRPESAIARISIRGVPANATIAVGVVLMASCLLG
                     EWSGLNLEFFLKLANGIFVLVYLLAMFAAYKLLSGINKLLAAISLILCTAVFICLGWS
                     MLYALTIFILLSLPWQGLARKSQPKQEL"
     misc_feature    complement(225722..226954)
                     /note="HMMPfam hit to PF00324, AA_permease, score 6.9e-05"
     misc_feature    complement(join(225797..225865,225884..225952,
                     225995..226063,226124..226192,226262..226330,
                     226367..226435,226478..226537,226574..226642,
                     226652..226720,226796..226864,226877..226945))
                     /note="11 probable transmembrane helices predicted for
                     TVA2626 by TMHMM2.0 at aa 13-35, 40-62, 88-110,
                     114-136,149-168, 183-205, 218-240, 264-286, 307-329,
                     344-366 and 373-395"
     misc_feature    complement(225989..226021)
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
     misc_feature    complement(226145..226177)
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
     misc_feature    complement(226883..226981)
                     /note="Signal peptide predicted for TVA2626 by SignalP 2.0
                     HMM (Signal peptide probability 0.967) with cleavage site
                     probability 0.941 between residues 33 and 34"
     regulatory      226958..226970
                     /note="putative DnaB-box (consensus 5-3seq:
                     GATCTNTTNTTTT)"
                     /regulatory_class="other"
     CDS             227188..227802
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0184"
                     /old_locus_tag="TVA2625"
                     /product="putative threonine/lysine efflux protein"
                     /note="user locus_tag: VANGcII0184"
                     /note="IPR001123 Lysine exporter protein (LYSE/YGGA)"
                     /protein_id="CDQ48081.1"
                     /translation="MTFTVWLSLFTICILGAMSPGPSLAMVAKHSLAGGRKNGFATAW
                     AHAFGIGVYAFITLIGLAVVLHQSPLLFKTVGYAGALYLAYLGINALRSKGGVAAKLE
                     SGETVSVWQSAKEGLLISLLSPKIALFFIALFSQFVAIGNELSSKAIIVLTPFLVDGL
                     WYTFITLILSSPILLDKLRARAVLIDRLSGVVLIALAIRVVMTL"
     misc_feature    227188..227262
                     /note="Signal peptide predicted for TVA2625 by SignalP 2.0
                     HMM (Signal peptide probability 1.000) with cleavage site
                     probability 0.998 between residues 25 and 26"
     misc_feature    join(227200..227268,227311..227379,227533..227601,
                     227629..227697,227734..227793)
                     /note="5 probable transmembrane helices predicted for
                     TVA2625 by TMHMM2.0 at aa 5-27, 42-64, 116-138, 148-170
                     and 183-202"
     misc_feature    227227..227799
                     /note="HMMPfam hit to PF01810, LysE, score 6.2e-32"
     CDS             complement(227883..228092)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0185c"
                     /old_locus_tag="TVA2624"
                     /product="membrane protein"
                     /note="user locus_tag: VANGcII0185c"
                     /protein_id="CDQ48082.1"
                     /translation="MNRFIVTTFAMVVGFFALMLSLLLAIPLAIAAIITGKRIEKQLK
                     RHTFTSKSGYVIEGEYEEKAQAHYR"
     misc_feature    complement(227991..228059)
                     /note="1 probable transmembrane helix predicted for
                     TVA2624 by TMHMM2.0 at aa 12-34"
     misc_feature    complement(228000..228092)
                     /note="Signal peptide predicted for TVA2624 by SignalP 2.0
                     HMM (Signal peptide probability 1.000) with cleavage site
                     probability 0.982 between residues 31 and 32"
     CDS             complement(228623..230065)
                     /transl_table=11
                     /gene="gapA-2"
                     /locus_tag="VANGNB10_cII0186c"
                     /old_locus_tag="TVA2623"
                     /product="glyceraldehyde 3-phosphate dehydrogenase"
                     /EC_number="1.2.1.12"
                     /note="user locus_tag: VANGcII0186c"
                     /protein_id="CDQ48083.1"
                     /translation="MSPEKHLSDWQASQTIAESMSPLIGQLYRQQGVEVVLFGKTLIN
                     ATTIDIIKAHRVVRRYTGEALSTQQTMPILQKLTTLALSPCRIDIGQLAHQFWQQHDD
                     EHGLEDYLLTALNGALNGETLSEPKDVVLYGFGRIGRLLTRLLIEKSGPGYPLRLRAI
                     VVRGGKAGDLEKRASLLRRDSVHGQFNGSIIIDEARKAIIANGNYIQIIYANKPQEVD
                     YSHYGIHNALVVDNTGVWRDSEGLSQHLNCQGASKVLLTAPGKGEIKNIVFGVNHADI
                     QPEDTIISAASCTTNAITPVLKAIHDQYGVLSGHIETVHSFTNDQNLIDNFHSGERRG
                     RSASLNMVLTSTGAAKAVAKALPELAGKLTGNAIRVPTPNVSMAVANLNLANAVNKQD
                     LNAYLREMALNSPLSAQIDYTDSTEIVSSDLVGSRHAGVVDGAATIAQDNRCVLYIWY
                     DNEFGYSGQVVHCMEQMMGVRYRTFPAIAQ"
     misc_feature    complement(228716..229189)
                     /note="HMMPfam hit to PF02800, Gp_dh_C, score 5.5e-56"
     misc_feature    complement(229187..229210)
                     /note="PS00071 Glyceraldehyde 3-phosphate dehydrogenase
                     active site."
     misc_feature    complement(229202..229687)
                     /note="HMMPfam hit to PF00044, Gp_dh_N, score 4.5e-51"
     CDS             230590..233247
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0187"
                     /old_locus_tag="TVA2622/TVA2621"
                     /product="Putative sensor protein (histidine kinase)"
                     /EC_number="2.7.13.3"
                     /note="user locus_tag: VANGcII0187"
                     /protein_id="CDQ48084.1"
                     /translation="MVILTHFSIKARLFLLCLIPTLVILAVAWRLFLPFESRLDTYHV
                     LNQKIGAINQVTTSSALFYTLLSVQLRSENSEDSRPQLKQDLAESLDKIVLDTGSTNS
                     HFGSKSNRTLIENRVLDLHHLLDELPSASQSETLELGRQVFNLLYEVMADLQKTNSFL
                     APVDIHTLDLVYSDLHWFAFWVQKEAWLIKELTMDQEVFQSRQTEYFQAVERQQQYFE
                     RIIDNGAQLEQLMLSFTQPEFLQAALIREKIVSNEADPQALASYVKNVEERYLAIDKL
                     VQSVNQHLSTQLNVRLQQEKMSMLSISASLLAVLALLFVLGASTSSRISSKLKRIINT
                     MSRLREKQNGIEQIPIDGKDEFSRFTINLNHIIEKQQQYESALVETKEAAIAANRAKS
                     AFLANMSHEIRTPLNGIIGMTEILSRSEFTGNEREILADIDTSSQALLILINDILDLS
                     KIESGNLELAPHRFELAELVYDTVNLVNAKALSQHIELNIYLDPALPRFIIADEYRLK
                     QVLMNLLSNAVKFTKDGYVNTGLTLETGDITSIRFAVSDTGSGIDKEMLNTIFDPFIQ
                     EDSSITRRFGGTGLGLAICRQLVDLMQGDIHVQSTKGLGSCFEFVVPIEVAEDQPQVE
                     PLATQALLITNMSNYSSAIRRECVQWGIQLNEARDVEQAVKSGLSAVCILYCQSLSHS
                     VQSDLIALREHFSSAKIVVLQHHLFVNKDAIHLAQASITLPFLGARFERALKALVADT
                     ETDLTPVEESQLDYLECNHKRILIVEDNLMNQKIASFFLEKAGIGYVVANNGQEAVDA
                     ITQGGHFAAVLMDCMMPVMDGLTATKKIREWEKEQGVEKLPIIALTASVLEEDIKSCF
                     DAGMDAYLPKPYKSKQLFDIFSDLQVANS"
     misc_feature    230866..230901
                     /note="PS00141 Eukaryotic and viral aspartyl proteases
                     active site."
     misc_feature    231493..231705
                     /note="HMMPfam hit to PF00672, HAMP, score 0.0086"
     misc_feature    231757..231954
                     /note="HMMPfam hit to PF00512, HisKA, score 8.4e-25"
     misc_feature    232093..232434
                     /note="HMMPfam hit to PF02518, HATPase_c, score 6e-38"
     misc_feature    232867..233223
                     /note="HMMPfam hit to PF00072, Response_reg, score
                     2.1e-25"
     CDS             233393..233776
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0188"
                     /old_locus_tag="TVA2620"
                     /product="putative membrane protein"
                     /note="user locus_tag: VANGcII0188"
                     /protein_id="CDQ48085.1"
                     /translation="MLVMMTLLASSLVSSAPLMAITMSPISAVSHSVTDDANPPQHCS
                     NMSAAHHDSDASDMTSSAMSNDCIDHSDQGVDSCCSVMCMTTLAFFITEHQPFTPHAV
                     LLLINTEATRGIVMVARSLYRPPIV"
     misc_feature    233393..233452
                     /note="Signal peptide predicted for TVA2620 by SignalP 2.0
                     HMM (Signal peptide probability 1.000) with cleavage site
                     probability 0.507 between residues 20 and 21"
     CDS             233859..235289
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0189"
                     /old_locus_tag="TVA2619"
                     /product="putative outer membrane cation efflux protein"
                     /note="user locus_tag: VANGcII0189"
                     /note="IPR003423 Outer membrane efflux protein"
                     /protein_id="CDQ48086.1"
                     /translation="MHERWNFIVNLKLSVIAWSISIVGVLSFPLMVNAAPQAAMAQPD
                     SHAKQLAQLIDAALSNDAVRKQYFAQSQAIQETGMASSTLMDPKIKVGFGGLPIDSFK
                     FDEDPMTNISVGLMQQFERGSSLALQAKKAKQQATGVALQVNLRELEVANSMTQLWLE
                     LGYQQRAERIVRANQTLMRELAGFIETNYSLGKSEAQDLLQARLQVSKLDDKLQANQQ
                     MQQRIVSQLSEWLGSAWLVEQPMLAAEESVNWSRLDAQLVTVNDSTTHYALLVTHPMV
                     GMAEAAIHTNQTQVEIAQTAYQPQFGVEVMYAYRQASSMQGGPAADMVSAYLTMDIPL
                     FTGNRQDRNHAAAQYQVGAAKSQRDVLLAQMNAKVNALLVDKMNLEQRLSRYQTTLLT
                     QAKARTQAVERGYENNTSQFNDVVSAASDELALQLEQVRLMTDLNLTKSNLAYLLNGF
                     DFQVSAPSLTSVEKLTSLETLTPVEK"
     misc_feature    233883..233960
                     /note="Signal peptide predicted for TVA2619 by SignalP 2.0
                     HMM (Signal peptide probability 1.000) with cleavage site
                     probability 0.929 between residues 26 and 27"
     misc_feature    233901..233954
                     /note="1 probable transmembrane helix predicted for
                     TVA2619 by TMHMM2.0 at aa 7-24"
     misc_feature    235299..235379
                     /note="Signal peptide predicted for TVA2618 by SignalP 2.0
                     HMM (Signal peptide probability 0.956) with cleavage site
                     probability 0.790 between residues 27 and 28"
     misc_feature    235311..235379
                     /note="1 probable transmembrane helix predicted for
                     TVA2618 by TMHMM2.0 at aa 5-27"
     CDS             235408..236802
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0190"
                     /old_locus_tag="TVA2618"
                     /product="Putative secretion protein HlyD"
                     /note="user locus_tag: VANGcII0190"
                     /note="IPR006143: Secretion protein HlyD; EcoGene-hit =
                     cusB (4e-46): Silver and copper efflux, membrane fusion
                     protein."
                     /protein_id="CDQ48087.1"
                     /translation="MRCLNRCIGLRRWTQTINVINRASHRWGWTSSLCTPNRRRKHKR
                     RVARWTISAAVENNLGVKTEPVVFAQLSPRIETVGYIAFDDSLLWQTNVRVAGWVEKL
                     NINAVGEQVRKGDVLFTLYSPELVKAQEELLNAHRASRESLLKGATERLVSLGVDRTQ
                     IKQIIARGKATQSIEVKAIADGVIASLNIREGGYLSPAQAVISAGPLNEVWVDAEVFE
                     RQAHWITSGSLASMTLDAIPGKEWQGKIDYVYPILDPKTRTLRMRLKFLNPKGELKPN
                     MFANIALQPVSQQAVLTIPKSAVIHSGGMTRVVLAEGNGKYRSARVEVGREAGERLEV
                     LQGLTEQDTVVTSAHFLLDSESSQSADLSRINGVEAANEAWLTGDISTLMADFGMLTL
                     NYKPVSKWGWQAGQMNFTVEEEFDLSLFAEGQRVRFLVAKQGDEYVLKALEASEQASS
                     ETNITAAETLGGQQ"
     CDS             236799..239927
                     /transl_table=11
                     /gene="cusA"
                     /locus_tag="VANGNB10_cII0191"
                     /old_locus_tag="TVA2615(VSAL_II0714)"
                     /product="cation/silver and copper efflux, membrane
                     transporter"
                     /note="user locus_tag: VANGcII0191"
                     /protein_id="CDQ48088.1"
                     /translation="MIGAIIRWSINNRFLVLVAALFLTLGGLYSVKNTPVDALPDLSD
                     VQVIIKTSYPGQAPQVVEDQVTYPLTTAMLAVPGAETVRGYSFFGDSYVYIIFDDKTD
                     MYWARSRVLEYLSQVTPKLPPNAKPTLGPDATGVGWIYSYVLQDKTGQHDLAQLRSLQ
                     DWFLKYELQTVNGVSEVATVGGMVKQYQVQIDPAKLRAYNLTLQQINAAIQNGNQESG
                     ASVIEVAEAEHMVRTSGYLTNIDDIKALPLKVTDKGTPLLLGDVADINLGPQMRRGIS
                     EFNGEGEAVGGVIVMRFGENASQVIDDVKAKLTDLQRSLPEGVEIVATYDRSTLINQA
                     VENLWHKLAEEFIVVAVVCALFLFHIRSSLVIALSLPVGILSAFIVMHWQGINANIMS
                     LGGIAIAIGAMVDGAIVMIENVHKHIERTPLTDKNRWQVIGKAAEEVGAPLFFSLLII
                     TLSFVPVFALEGQEGKMFSPLAFTKTYAMAAAAGLAITLVPVLMGYFVRGNIISEHKN
                     PINKGLVALYRPLLNLSLRYPKSMIVLALALMASAYYPMSKLGSEFIPPLDEGDLMYM
                     PTTYPGISIGKARELLQQTNKLIKTVPEVKTVWGKMGRAETATDPAPLTMIETVIQLK
                     PRDQWREGVTTESLRKEFDSLVQFPGLTNAWVMPIKTRIDMLATGIKTPIGIKIAGPD
                     LKQIETIGAQLEPILNRVQGTASVYAERVAGGRYVTIDINRLQAARYGLSIKDVQQVV
                     STAVGGMNVGETIEGLERYPINVRYPQDYRDSVVKLQNLPLVTQNGARLALADVADIR
                     YEDGPPMIKTENARPNGWVFVDIDGRDLGSYVAEAQQAVAEQLQLPAGYSLVWSGQYE
                     YMERAKARLSVVAPITIAIIMLLLYFSFRRIGEVLIIMATLPLAMVGGVWLMHYLGYN
                     FSIAVGVGFIALSGVAVEIGVIMLVYLNQAWHYKKIDAQENGAVIDSQDLINAIGEGA
                     GQRVRPVMMTVLTVIIGLIPIMYGTGTGSEVMQRIAAPMIGGMASALLLTLLVLPAVF
                     KLWKNREIATLK"
     misc_feature    236799..236894
                     /note="Signal peptide predicted for TVA2617 by SignalP 2.0
                     HMM (Signal peptide probability 0.933) with cleavage site
                     probability 0.625 between residues 32 and 33"
     misc_feature    236811..237039
                     /note="HMMPfam hit to PF00873, ACR_tran, score 1.4e-21"
     misc_feature    236835..236891
                     /note="1 probable transmembrane helix predicted for
                     TVA2617 by TMHMM2.0 at aa 13-31"
     regulatory      236880..236894
                     /note="parS2-D-like, ref: Yamaichi, Y., et al. (2007).
                     Distinct centromere-like parS sites on the two chromosomes
                     of Vibrio spp. Journal of Bacteriology 189(14): 5314-5324.
                     Search-seq: ATTTAsArTGyAAA(G/t) eg. NTTTACANTGTAAAN"
                     /regulatory_class="other"
     misc_feature    236954..239659
                     /note="HMMPfam hit to PF00873, ACR_tran, score 4.1e-133"
     misc_feature    join(237888..237956,237966..238034,238113..238181,
                     238224..238292,238389..238442,239391..239450,
                     239469..239537,239547..239615)
                     /note="8 probable transmembrane helices predicted for
                     TVA2616 by TMHMM2.0 at aa 322-344, 348-370,
                     397-419,434-456, 489-506, 823-842, 849-871 and 875-897"
     misc_feature    239724..239900
                     /note="HMMPfam hit to PF00873, ACR_tran, score 9e-11"
     misc_feature    join(239742..239801,239829..239897)
                     /note="2 probable transmembrane helices predicted for
                     TVA2615 by TMHMM2.0 at aa 7-26 and 36-58"
     CDS             240004..240501
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0192"
                     /old_locus_tag="TVA2614"
                     /product="Putative uncharacterized
                     (copper-binding/exported) protein"
                     /note="user locus_tag: VANGcII0192"
                     /protein_id="CDQ48089.1"
                     /translation="MKKALITLSLALFTSSVMAEMDHGSMAMKQTDTMNMAMGDMSEV
                     GMPAKGAKPDKVVHVLLSDDMKITFKKEVNIEPDDVVQFVVMNTGKIEHEFSIGSAAE
                     QLKHREMMRQMGNHKHDGGSAVTVAPGKAKQLLWHFHGDNNVEFACNIPGHAEAGMIK
                     KIQLQ"
     misc_feature    240004..240060
                     /note="Signal peptide predicted for TVA2614 by SignalP 2.0
                     HMM (Signal peptide probability 1.000) with cleavage site
                     probability 1.000 between residues 19 and 20"
     CDS             complement(240579..241022)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0193c"
                     /old_locus_tag="TVA2613"
                     /product="putative cytidine and deoxycytidylate deaminase"
                     /note="user locus_tag: VANGcII0193c"
                     /protein_id="CDQ48090.1"
                     /translation="MISKWAQRFYQMAELVGSWSKDPSTQVGAVITKQNRIVSVGFNG
                     YPHGISDSAGTDDRDMKYLKTLHAEENAILFAKRDLDGCEIYVTHFPCPNCAAKIIQT
                     GISAVHCPEQTEDFLSRWGDKIKVSQDMFLQAGVKVNWLPLSDLK"
     misc_feature    complement(240690..241016)
                     /note="HMMPfam hit to PF00383, dCMP_cyt_deam_1, score
                     6.6e-33"
     misc_feature    complement(240726..240824)
                     /note="PS00903 Cytidine and deoxycytidylate deaminases
                     zinc-binding region signature."
     CDS             241878..242768
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0194"
                     /old_locus_tag="TVA2611"
                     /product="Putative NADP or NAD utilising oxidoreductase"
                     /note="user locus_tag: VANGcII0194"
                     /protein_id="CDQ48091.1"
                     /translation="MIRLAVIGTNWITDQFIEGALKTGEFQLVAVYSRSLDRAKQFAE
                     KYDAPALFTDLKSLGESDNVDAVYIASPNVLHGPQSIQMMQAGKHVICEKPLASDFSL
                     AQQMYQVAKQHGVVLFEAFITPHLPNFSVLKQELSQIGAIRKAVLSYCQYSSRYPKYL
                     KGEMPNTFLPEFSNGSIMDIGYYCLGSAIELFGEPKSVQAQAHLLETGVDGNGSVILG
                     YDGFDVLLMHSKTSDSYLPSEIQGEEAALHVEMISTCNRITRINRGGQTQDLSIEQHA
                     NRMFYEATKICRSDTEQDNR"
     misc_feature    241881..242240
                     /note="HMMPfam hit to PF01408, GFO_IDH_MocA, score
                     1.8e-36"
     CDS             242890..243288
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0195"
                     /old_locus_tag="TVA2610"
                     /product="OsmC-like (stress-induced) protein"
                     /note="user locus_tag: VANGcII0195"
                     /protein_id="CDQ48092.1"
                     /translation="MQAEVKWVENFKFLGQSQSGHSVVMDGSGGATAPSPMEMVLMAA
                     GGCSSVDVVDGLKSANQQVTACNAKLTAERRETAPRIFTLVNIHFDVSGVDLDPNVVE
                     KVTADSLEKYCSVCLMLGKGVTMTHSWSIV"
     misc_feature    242932..243273
                     /note="HMMPfam hit to PF02566, OsmC, score 9e-22"
     CDS             243460..244059
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0196"
                     /old_locus_tag="TVA2609"
                     /product="hexapeptide-repeat containing-acetyltransferase"
                     /note="user locus_tag: VANGcII0196"
                     /protein_id="CDQ48093.1"
                     /translation="MTEMEKMMNGMVFDGADPEMEAIRSKAGHLLLQINQCADATARH
                     QLQTQLYRQIGQQSVVQPPFYCEFGETISIGDETFINMNVTMLDGAKITIGNHVLIGP
                     NTQFYTPAHALDYRSRRLWETFCKPITVEDDVWIGGNVVINQGVTIGARSVVAANSVV
                     NQDVPADSLVGGTPARVLRSLKEMNGTSDLHSSVKEGHH"
     misc_feature    243670..243723
                     /note="HMMPfam hit to PF00132, Hexapep, score 34"
     misc_feature    243730..243783
                     /note="HMMPfam hit to PF00132, Hexapep, score 4.1"
     misc_feature    243856..243909
                     /note="HMMPfam hit to PF00132, Hexapep, score 0.00071"
     misc_feature    243865..243951
                     /note="PS00101 Hexapeptide-repeat containing-transferases
                     signature."
     CDS             244056..244970
                     /transl_table=11
                     /gene="yddG"
                     /locus_tag="VANGNB10_cII0197"
                     /old_locus_tag="TVA2608"
                     /product="Putative inner membrane protein, YddG"
                     /note="user locus_tag: VANGcII0197"
                     /note="Similar to Escherichia coli (strain K12) yddg
                     recname: full=inner membrane protein yddg UniProt:P46136
                     (EMBL:AP009048) (293 aa) fasta scores: E()=1.4e-50, 46.4%
                     id in 291 aa"
                     /protein_id="CDQ48094.1"
                     /translation="MKQHKHTLFGVAAILLWSCLMGLIRTVTEQFSPIGGAALIYTVS
                     SVFLMLVMGVPKFKHFSLRYVLIGGALFVSYEICLALALGMANDRHQALEMAVINYLW
                     PALTVLFAVFLSRKPVHILVYPSVALAFVGVAWTITGDSGFSVMQISANIATNPLTYS
                     MAFGGAIIWAVYCNITKQLANGQNAIILFFMATAIALWIKYFLSSESTLVFTVPATLN
                     LALTGVVMGSGYALWNVAILRGNMVLLATLSYFTPVISTLLSSLILGVALGLSFWQGV
                     IMVTMGSLICWWATRERQSTVQEKMPIA"
     misc_feature    244056..244133
                     /note="Signal peptide predicted for TVA2608 by SignalP 2.0
                     HMM (Signal peptide probability 0.783) with cleavage site
                     probability 0.296 between residues 26 and 27"
     misc_feature    join(244074..244127,244155..244208,244245..244313,
                     244341..244394,244413..244466,244509..244577,
                     244611..244670,244698..244766,244785..244853,
                     244863..244922)
                     /note="10 probable transmembrane helices predicted for
                     TVA2608 by TMHMM2.0 at aa 7-24, 34-51, 64-86,
                     96-113,120-137, 152-174, 186-205, 215-237, 244-266 and
                     270-289"
     misc_feature    244554..244919
                     /note="HMMPfam hit to PF00892, DUF6, score 0.00015"
     CDS             complement(245047..245943)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0198c"
                     /old_locus_tag="TVA2607"
                     /product="putative cation efflux system component"
                     /note="user locus_tag: VANGcII0198c"
                     /protein_id="CDQ48095.1"
                     /translation="MCARTRNNENRILTISALLASGFAGGGLVVGMLVGSLVIVFDGV
                     YSLVSLLLTLLSLVASRYIRKPSDSTFPFGRAVLEPAVITIKASVILLVVSYSLYSAV
                     MALFSGGREVDASIATVFGTVNVIGCAIAWWFMVNKSKRYSSGLIDAEVKQWQMDTLL
                     SVAVTVGFIAAWLMTLSPWAKYAVYADPIMMLLMSFYFIKVPYDMLKSATRELLMMSP
                     SKEICKTVDQGVIAVGEESEQDIELTAVTKVGHELWVNVDIRPDENEMIALEDIESTR
                     RSLHKRLSKLPFVLQLTMNVAR"
     misc_feature    complement(245272..245907)
                     /note="HMMPfam hit to PF01545, Cation_efflux, score
                     1.1e-29"
     misc_feature    complement(join(245341..245394,245404..245472,
                     245533..245601,245659..245727,245764..245832,
                     245842..245910))
                     /note="6 probable transmembrane helices predicted for
                     TVA2607 by TMHMM2.0 at aa 12-34, 38-60, 73-95,
                     115-137,158-180 and 184-201"
     misc_feature    complement(245866..245943)
                     /note="Signal peptide predicted for TVA2607 by SignalP 2.0
                     HMM (Signal peptide probability 0.933) with cleavage site
                     probability 0.613 between residues 26 and 27"
     CDS             complement(246163..247041)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0199c"
                     /old_locus_tag="TVA2606"
                     /product="Transcriptional regulator, LysR family"
                     /note="user locus_tag: VANGcII0199c"
                     /protein_id="CDQ48096.1"
                     /translation="MNLSQIEAFFSVADTGSVSEAARQLECNRTKLSMAIKALEKELD
                     TALFVRTGNNLTLSEAGKAIYKDCESVLVTIARIKHTCTQISRGFNAEMWIARDDSLP
                     DALWQDFAHQLNNRFPATSFNLVLASSGDLANLIATHQVDFAFGVDYERINDPRITYQ
                     PLGKIRMMSVCKSDHPLTKISRVTDEELRRAMQAVMVYLNEKDNPELQPFSRRYIGFS
                     SFDYMLNTILTENAWGVLPEPLIRHFLREQKLTVIKHTYGLTQEDYCMFTATGMAEHP
                     GMNWLADKLRDYLFDF"
     misc_feature    complement(246172..246786)
                     /note="HMMPfam hit to PF03466, LysR_substrate, score
                     8.2e-06"
     misc_feature    complement(246856..247035)
                     /note="HMMPfam hit to PF00126, HTH_1, score 5.4e-17"
     misc_feature    complement(246931..246996)
                     /note="Predicted helix-turn-helix motif with score
                     1041.000, SD 2.73 at aa 16-37, sequence
                     GSVSEAARQLECNRTKLSMAIK"
     CDS             247201..247836
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0200"
                     /old_locus_tag="TVA2605"
                     /product="putative SAM-dependent methyltransferase"
                     /note="user locus_tag: VANGcII0200"
                     /protein_id="CDQ48097.1"
                     /translation="MVYSWENFPNTRSNTEAMMANEWDECAAQWEQDESTTLFAQNVF
                     QQLQKRVTLEGKHVLDFGCGTGLLSQMMSRHARDIVALDGSEAMIEELDKKELVNVEP
                     VVDFLTRGLVAQHPAFRKQFDLVVASSVCAFVPNLNEVFTIIHSLLDEHGVFIHWDWL
                     VEEDDPDYGLSQNQIETQLKSAGFSQVETAVAFEIKNSKGLAPVVMGIGRK"
     misc_feature    247375..247662
                     /note="HMMPfam hit to PF08242, Methyltransf_12, score
                     1.1e-12"
     CDS             complement(248155..249069)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0201c"
                     /old_locus_tag="TVA2604"
                     /product="Transcriptional regulator, LysR family"
                     /note="user locus_tag: VANGcII0201c"
                     /protein_id="CDQ48098.1"
                     /translation="MDYIHLSRISLKHLTALHVMLSTRSVTQTAAQLCISPSSISKNL
                     SQLRILLEDELFYRDGTHLIPTPFALQMGPTVHSILSSMNGLLHHSNFEPQHYQGKYR
                     LAMRESAFELFAPILTNVIKNHAPQASFTIYSKDHYGFDALQSGLIDFVILPHDISQP
                     PTRDKELVWEVIAHDEMVCLMRSDHALANEVLTIDHYLAQSHIGIMDKELAEPFFEQN
                     LAQSHRARHVPVVVADFGAAAILCKHTDSLFTCSKRWAEQAMQAKGLLVKPLPFNYGK
                     VAYSLVWNKPSMNDQALKWLCDQLKKPH"
     misc_feature    complement(248503..248790)
                     /note="HMMPfam hit to PF03466, LysR_substrate, score
                     1.3e-05"
     misc_feature    complement(248860..249039)
                     /note="HMMPfam hit to PF00126, HTH_1, score 4.3e-14"
     misc_feature    complement(248905..248997)
                     /note="PS00044 Bacterial regulatory proteins, lysR family
                     signature."
     misc_feature    complement(248935..249000)
                     /note="Predicted helix-turn-helix motif with score
                     1625.000, SD 4.72 at aa 24-45, sequence
                     RSVTQTAAQLCISPSSISKNLS"
     CDS             complement(249224..251212)
                     /transl_table=11
                     /gene="acs-2"
                     /locus_tag="VANGNB10_cII0202c"
                     /old_locus_tag="TVA2603"
                     /product="acetyl-CoA synthase"
                     /EC_number="6.2.1.1"
                     /note="user locus_tag: VANGcII0202c"
                     /protein_id="CDQ48099.1"
                     /translation="MFEENLTPHTPLWVPSQDRIKASNLNQFIEHINMQGEAIESYSQ
                     LHLWSVAERKQFWLEVWQFCDVIGFRGNCIYGEGIARWDDFTAARDTIWFPQAQLNYA
                     ENLLSYAFQQPEGIAVWFKNENGQSKKLTWQQLSDQVSIIQQWLKQNGVEKGDVVAGY
                     LPYMTETLVAMLATTSLGAVWTSTSPDFGVDSVVERFGQVQPKILFCCNGYTFNGKTH
                     LMEEKNGQIADAISSLHNICQIEYLHQRSLTADFNDAFSDWNAILASYLPRGLRYERV
                     SFNDPLFILYSSGTTGKPKCIAHSVGGTILNHLKEHQLHCDIQPGDRVFYYTTCGWMM
                     WNWHVSALASGATLVIYDGSPMYPQPGVLWDLAEEANITLFGTSAKYLEALQKTAYSP
                     SDYYPLSSLKTLCSTGSVLYPKQFDYVYANIKADLHLASISGGTDICGCFVLGNPISP
                     VYRGECQGAGLGLDVAVFNDLGQPVMQQRGELVCRNSFPNQPIGFWHDDGQRYHDAYW
                     SKFSGVWHHGDEVEWTDNGGIRFYGRSDTTLNPGGVRIGTAEIYQQVNSFPEIQDSVA
                     VGQKIDNDEQIILFVQLAPQCELNTLLVNTIKQRLRENCSPRHVPAQIHSISDVPRTK
                     SGKLVELAVKQVLHGETVKNLGAIANPHVLEEIHALFT"
     misc_feature    complement(249515..250822)
                     /note="HMMPfam hit to PF00501, AMP-binding, score 4.6e-65"
     misc_feature    complement(250328..250363)
                     /note="PS00455 Putative AMP-binding domain signature."
     misc_feature    complement(250562..250585)
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
     CDS             251468..252259
                     /transl_table=11
                     /gene="phhA"
                     /locus_tag="VANGNB10_cII0203"
                     /old_locus_tag="TVA2602"
                     /product="phenylalanine-4-hydroxylase"
                     /EC_number="1.14.16.1"
                     /note="user locus_tag: VANGcII0203"
                     /protein_id="CDQ48100.1"
                     /translation="MTQYHSKPLNSKGFIDWSNEEDRIWYDLIARQETVIEQRACQAY
                     LDGLAMLQLSKDQVPQLPDINRILQRETGWQVEPVPALINFDRFFALLAEKKFPVATF
                     LRSREEFDYLQEPDFFHEIFGHCAMLTHPDFASFTQVYGKLGANASPKQRAYLARLYW
                     FTVEFGLVQESDGVKIYGGGILSSPAETVYSLDNQTAIREKFDIQQVLRTPYRIDIMQ
                     PIYYVLDDLRDLYHLSQENLVQQVESAMQAGLLAPLFQPKEETHA"
     misc_feature    251807..252136
                     /note="HMMPfam hit to PF00351, Biopterin_H, score 3e-16"
     CDS             252252..252584
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0204"
                     /old_locus_tag="TVA2601"
                     /product="putative pterin-4-alpha-carbinolamine
                     dehydratase"
                     /EC_number="4.2.1.96"
                     /note="user locus_tag: VANGcII0204"
                     /protein_id="CDQ48101.1"
                     /translation="MLEELRCEACSLDALALSIPEQQQLLTELEGWSIVVRDDIPQLE
                     KVYVFKNFKLAWAFSNQVAQLAEAEFHHPSLLLEWGKVTVTWWSHSIKGLHKNDFICA
                     AKCDGLID"
     misc_feature    252282..252581
                     /note="HMMPfam hit to PF01329, Pterin_4a, score 6.1e-33"
     CDS             252928..255246
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0205"
                     /old_locus_tag="TVA2600"
                     /product="Putative dipeptide
                     chemoreceptor,methyl-accepting protein"
                     /note="user locus_tag: VANGcII0205"
                     /protein_id="CDQ48102.1"
                     /translation="MKISTKIIAACTILCSVGVVISGGFVGWRASELSSQALYDRAAN
                     QLTSVREIKKSEITNYFKQIRLQIETLSSEVSTQEAMDSFTRSFSRYPAHRITPQDTD
                     ALERYYRDQFGRTYRQENNGSQPNELGAFAQLSEQGKALQARYIGVNPNELGSKHHLD
                     FDSLGSSYDEAHRRYHASFRRFLEAFGYYDIFLVDLSGNVVYTVFKELDFATNLSTGA
                     YQNSGLGHAFAKAKNLQEGQSYLEDFAPYYPSYEAAASFISAPIFKEQQRVGTLIFQM
                     PIDVINNIMTFGGSWADAGLGKSGETYLVGQDGLLRSQSRFLLEDPEQYFQTLTDIGV
                     EPATIEQIKTKGSAIGRQRIKTDAVRQALAGGQGLETIKDYRNVEVLSAYAPLDVLGQ
                     KWAILTEIDQSEALQDVSTLERSVLQTVLISIAVLVVLSLFISYIVGSGISKPIRSAS
                     LELHRINQENDLTARLSEKGKDEMAEVAVAFNQLFSSLQKTIEQFARATESLNGSTHR
                     MSSNMESTRGAVAEQSMRTESVAAAVNQMSASIGEVAQFASRAADYVKSANDTGSQSV
                     DVGEALGNEISLLSDEMRMAVEAIERLHSESNSIAEVLDVIQGIAEQTNLLALNAAIE
                     AARAGEQGRGFAVVADEVRSLAGRTQTSTEEIRKKIDSLQHEINSVSQGIEKANKTVV
                     KGVETCHLNTDMLAQIMSMLTELNDMNVQIAAATEEQKSVTDEISSSITSIADASLSV
                     SGQVNDVDGVLTDLSGQAETLNSEIAQFKYKA"
     misc_feature    252928..252993
                     /note="Signal peptide predicted for TVA2600 by SignalP 2.0
                     HMM (Signal peptide probability 0.975) with cleavage site
                     probability 0.831 between residues 22 and 23"
     misc_feature    join(252946..253014,254173..254241)
                     /note="2 probable transmembrane helices predicted for
                     TVA2600 by TMHMM2.0 at aa 7-29 and 416-438"
     misc_feature    253801..253824
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
     misc_feature    254185..254397
                     /note="HMMPfam hit to PF00672, HAMP, score 6e-15"
     misc_feature    254488..255240
                     /note="HMMPfam hit to PF00015, MCPsignal, score 4.9e-56"
     CDS             complement(255323..256717)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0206c"
                     /old_locus_tag="TVA2599"
                     /product="Putative multidrug exporter, MATE efflux family"
                     /note="user locus_tag: VANGcII0206c"
                     /protein_id="CDQ48103.1"
                     /translation="MLMTPFHQLDRQFWRKLIDIGVPVSLQSMLFSLLGVVDIFMVSQ
                     LGESATAAVGVGNRIFFFNLIVIVGASGAVSVLASQYFGAGNIEGIKRTLAQSWIVAL
                     LFTLPFMLLYLWIPQSVVSLVANDAQYVTLATDYLWITALSLFCTALVVPLESALRSV
                     GVAKLPTQVSILAIIINAVLNALLIFGLFGFPELGVVGAAIGTSISRGCQTMLLFWQV
                     KRHYAHLLPNRENWQQAKMKHHRQRYFKVARPMIIHDSAWAAGILIYNVIVGQLGVSE
                     LAIISLLSPIESVLISAFLGFAVAASILLGHEIGAQRYERAAQTSWWYVLTSCGLALL
                     LALFCFLAEPWIYALIEKSPLHDTQMAVNVCLVMAFGMVLRVFNMVGIGGVLKSGGDI
                     NYSIFIDLFGQWAIGIPLAYYTGLVLGWPLHWVMMVIMLEEAVKIILTTQRIYSKRWI
                     NNLVNETEPSTLQA"
     misc_feature    complement(join(255452..255520,255563..255631,
                     255692..255760,255788..255856,255869..255937,
                     256145..256213,256247..256315,256358..256426,
                     256487..256555,256592..256660))
                     /note="10 probable transmembrane helices predicted for
                     TVA2599 by TMHMM2.0 at aa 20-42, 55-77, 98-120,
                     135-157,169-191, 261-283, 288-310, 320-342, 363-385 and
                     400-422"
     misc_feature    complement(255479..255970)
                     /note="HMMPfam hit to PF01554, MatE, score 2.4e-19"
     misc_feature    complement(255731..255763)
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
     misc_feature    complement(256169..256651)
                     /note="HMMPfam hit to PF01554, MatE, score 4.7e-34"
     CDS             256812..257654
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0207"
                     /old_locus_tag="TVA2598"
                     /product="Putative AraC-family transcriptional regulatory
                     protein"
                     /note="user locus_tag: VANGcII0207"
                     /protein_id="CDQ48104.1"
                     /translation="MSDKQERYSISDKTHQEFIDQSRVLALEQSGIVQCGIATCREMF
                     SVYRKNQSVHMLLYTVKGKGWLTSGTDSYLLEPSSLIVVPAGVENGFGIEEEEWQVVW
                     IFLAPQRHWKNTVKEEIHYTLTPIAAVMYASIQALLRTLTLPAELGEQVGQRIVEQIE
                     IMLRAPIELPLSRTLLRLNRVFQRVQSQLHKDWTIENLAALFPCSQAHLHRLCQQHFG
                     HSPKAHLTRMRMEYAARLLVSTDWPIQHVGDIVGYPNPANFSTRFKVWSHCTPREFRK
                     KRND"
     misc_feature    257349..257489
                     /note="HMMPfam hit to PF00165, HTH_AraC, score 3.8e-07"
     misc_feature    257388..257453
                     /note="Predicted helix-turn-helix motif with score
                     1278.000, SD 3.54 at aa 193-214, sequence
                     WTIENLAALFPCSQAHLHRLCQ"
     misc_feature    257505..257639
                     /note="HMMPfam hit to PF00165, HTH_AraC, score 9.2e-06"
     CDS             257892..259439
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0208"
                     /old_locus_tag="TVA2597"
                     /product="putative response regulator"
                     /note="user locus_tag: VANGcII0208"
                     /protein_id="CDQ48105.1"
                     /translation="MDLFADFRQETQPKGEESHELSVENKPWRVLLVDDDEQMHQITR
                     LALRGFSFQGRPLELLSAMSGIEAKELIRTKQDIALALVDVVMETENAGLELVKYIRE
                     ECRNKIIRLVLRTGQAGQAPEDTVIQEYEIDDYKEKTELTTQKLRTLLYSMLRSYRDL
                     CLIEEQKEGLKRVIEASAKVQNTTTLQTYAESVLSQLTSLLKLHASAFYCIVQPKSEG
                     EGSCALTLAAIGGFVDFYSDCDFSRLPSEVAKRCLLALQTKMSHSYDDASVLYMTDSR
                     GVENLLYINLLERLSENDERLLEIYMHNIGLTFENLNLQLDLRETSRELVYNLANAVE
                     ARSKETGAHVQRVSLICEKLATLMTLPEQDIYMIKNASPLHDVGKVAIPDSILHKPGK
                     LDAQEWAIMQKHVEYGVDILSRSKRSLIIKAKEIAGSHHEKWDGSGYPNQLAGEGIPI
                     SGRITALADVFDALGSKRSYKDAWPEEAIKQEIVVQKGKHFDPMLVDLMLAHWDDFIA
                     IRDQHPD"
     misc_feature    258909..259283
                     /note="HMMPfam hit to PF01966, HD, score 6.9e-22"
     CDS             complement(259489..261450)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0209c"
                     /old_locus_tag="TVA2596"
                     /product="Putative sensor protein"
                     /EC_number="2.7.13.3"
                     /note="user locus_tag: VANGcII0209c"
                     /protein_id="CDQ48106.1"
                     /translation="MNKSRTFNESIDNPLSSRIGRRIIFFLVILSGAVTLMTTLAQTY
                     FDYDREFDDVAQRHHEIEFVHAELLAASLWNYDLLTLQQRLDGLVNLPKINYLEVTSD
                     SYQFSAGEKVTERLVAHRYPMLYINPKTEAKEQIGEIYVESNAQEIYNYLVKQFLLIL
                     VVNAIKTAFICYAILMIFHESVNRRVFAIAQYLRKYNPRHPPKPLKLPHKKWIMGHND
                     ELTWLADETNKITGNVTTLYSNIKLEQERLADFTDVSSDWLWETDSTDRLIYTSESMR
                     QALEISENSKPLLSEVDSLRDMKKLLQSITKHCSFSMCEETIIINDCKHYLMFQAVAR
                     YEEDMFLGLRGTAINITELKLAQLELQKLNQNLERQVAKRTCDLENSIEQLKATQTQL
                     IESEKLAALGGLVAGVAHEVNTPLGIAVTASSVIIEVTQELNTAFANQTLTSQQFSEL
                     MQRMNETNTMLESNLNRAAKLIRDFKQTAVDQVSESRSQFSIHQVLSALIASLHPETR
                     KIPVIPQLEGDVGLTMNSLPGVLTQIVSNLVMNSVNHAFSDEKNPIITIAFKQEGENI
                     LLEYKDNGCGVEPKLHHKIFEPFFTSKRGRGGSGLGLNLVFNLATQKLKGKLQFNSNV
                     GQGVHYVFTLPKALELSEVTLSSDQKKRH"
     misc_feature    complement(259540..259875)
                     /note="HMMPfam hit to PF02518, HATPase_c, score 9.8e-27"
     misc_feature    complement(260080..260253)
                     /note="HMMPfam hit to PF00512, HisKA, score 0.0097"
     misc_feature    complement(join(260917..260985,261316..261384))
                     /note="2 probable transmembrane helices predicted for
                     TVA2596 by TMHMM2.0 at aa 23-45 and 156-178"
     misc_feature    complement(261328..261450)
                     /note="Signal peptide predicted for TVA2596 by SignalP 2.0
                     HMM (Signal peptide probability 0.973) with cleavage site
                     probability 0.903 between residues 41 and 42"
     CDS             261564..262532
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0210"
                     /old_locus_tag="TVA2595"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0210"
                     /protein_id="CDQ48107.1"
                     /translation="MRWIWILCVISAPVMAGKVLLIESYEQSYEWDASYVSALKQSLT
                     PAHELHTFEMDTKRVPASRYSQIAEQAFSRYQQLKPQVVILGDDNALVYMLPKLYNEP
                     ISIVFLGINSNPRKFMAQYQGQAKVTGILERPLYVKTMGEIGRMLDKDKRKVLVLFDS
                     GSTASIALEFMQTQASMIEKNLGIATEIASVATEKEWQTRISTAKEQGFGAIVVGLYQ
                     TLVDESENNVPADTILTWTNQHTEVPLFGFWDFSIGAGKAAGGVVLAGRDQGEMAGKT
                     VLRILNNNEDASRIPIQIGQQGRAIYHQGEMSRWGLSVPEGWMKID"
     misc_feature    261564..261611
                     /note="Signal peptide predicted for TVA2595 by SignalP 2.0
                     HMM (Signal peptide probability 0.823) with cleavage site
                     probability 0.676 between residues 16 and 17"
     misc_feature    262029..262064
                     /note="PS00141 Eukaryotic and viral aspartyl proteases
                     active site."
     CDS             complement(262645..263850)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0211c"
                     /old_locus_tag="TVA2594"
                     /product="Putative multidrug resistance protein D"
                     /note="user locus_tag: VANGcII0211c"
                     /protein_id="CDQ48108.1"
                     /translation="MSASFPLVKLTFLIAILTAVGQMTQTMYVPSIGHMAGEFLVSPA
                     SLQAVMACYLIPYGLSQFVYGPLSDRLGRKPIIIAGLLIYIAGSLLALFAHQYDWFLV
                     GSFIQGLGIGCGGAMSRTLTRDCFSGAELHKANSLISMCVIFSPLIAPVLGGYLTESF
                     GWRSSYLFLSLFAIAVVITMMTSMVETLPKAARRHESVANSYRYVLSDKRFQGYLICL
                     VATFSGVAVFEAAAGVLLGGVLQLPATTVSLLFVLPIPGYLVGAALSSVIALNFNEKS
                     ALYVGLVAIALGSLVVFVPGVLGQTSALTLIGGATVYFLGAGILFPAATTGALTPLPY
                     HAGTGGAVLGGMQNLGAGLATLLASAIPAHDQMPLGALMLLMSVFAVVGLIRVYSKHD
                     PSNEMPLAV"
     misc_feature    complement(join(262687..262746,262789..262857,
                     262876..262944,262954..263022,263035..263103,
                     263146..263214,263296..263355,263383..263451,
                     263488..263556,263566..263625,263662..263721,
                     263764..263832))
                     /note="12 probable transmembrane helices predicted for
                     TVA2594 by TMHMM2.0 at aa 7-29, 44-63, 76-95,
                     99-121,134-156, 166-185, 213-235, 250-272, 277-299,
                     303-325,332-354 and 369-388"
     misc_feature    complement(262762..263811)
                     /note="HMMPfam hit to PF07690, MFS_1, score 1.6e-46"
     misc_feature    complement(263512..263544)
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
     misc_feature    complement(263695..263727)
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
     CDS             264561..265913
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0212"
                     /old_locus_tag="TVA2593"
                     /product="Putative chaperone/heat shock protein YegD"
                     /note="user locus_tag: VANGcII0212"
                     /protein_id="CDQ48109.1"
                     /translation="MFIGFDYGTANCSVAMMQDGQPTLLPIEGKSHYIPSTICAPTRE
                     SISEHLFRHHNITPSDKIGEQVLRRAINVNREESIELAAQDIAFGQAALDLYLQDPRD
                     IYYVKSPKSFLGAAGLRDVQVSFFEDLVCAMMVNIKHNAEQHLQRSIQDTVIGRPINF
                     HGRGGEEANRQAESILQRAAKRAGFQHISFQFEPVAAGLEYEATLVQDQTVLVVDIGG
                     GTTDCSLLKMGPSWRGRDDRTASLLAHSGQRVGGNDLDIYIAFKQLMSSFGLGSKAIS
                     GIDMPITQFWNPIAINNVEAQRDFYAQQNLAALKLLHKEAQQPEKLARLLKVYFETLG
                     YQIVRRAEEAKIALSDLTQCQVVLDLLSEQIEVQIEREQMIDAIESPKAKMVELVKEA
                     VEQGGVKPDVIFMTGGSARSPILRQAVEQQLPHVPVVSGNYFGSVTAGLARWAEICYR
                     "
     misc_feature    265179..265247
                     /note="HMMPfam hit to PF00012, HSP70, score 7.3e-05"
     misc_feature    265197..265238
                     /note="PS00329 Heat shock hsp70 proteins family signature
                     2."
     CDS             complement(265904..266857)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0213c"
                     /old_locus_tag="TVA2592"
                     /product="putative membrane protein (EamA-like transporter
                     family)"
                     /note="user locus_tag: VANGcII0213c"
                     /protein_id="CDQ48110.1"
                     /translation="MIYGYLAIGTTLLLWSGFFLSLKAGASGLLTPADIALTRFLLPA
                     LLLSPLVWRTRHQLQNIPIRYLIGLFIGCGLPYLLVTSHAMHYVPVSDGSALVPGVLP
                     LFVSGIAVLLFKQPLSRHRVTGLTLVVAGVGIFLYSSATDFESNRLTGHLMFLTGSLM
                     WAVFTICARVANLHALVSAGWVALLSTILLAVLIALGIVDSYLATHSFAHWPWKELAG
                     HTLLQGVGAGLIAAFTYLYAVSTLGAERSAAFGSATPVVATLLAIPVFGEMPTPLTWI
                     GLGLISLGSLVASNVLMKHDHSQYYRPPTHQKRSAKRSYQR"
     misc_feature    complement(join(265979..266047,266057..266116,
                     266135..266203,266261..266320,266339..266407,
                     266435..266494,266519..266578,266606..266665,
                     266702..266755,266798..266854))
                     /note="10 probable transmembrane helices predicted for
                     TVA2592 by TMHMM2.0 at aa 2-20, 35-52, 65-84,
                     94-113,122-141, 151-173, 180-199, 219-241, 248-267 and
                     271-293"
     misc_feature    complement(265988..266383)
                     /note="HMMPfam hit to PF00892, DUF6, score 2.9e-11"
     misc_feature    complement(266447..266821)
                     /note="HMMPfam hit to PF00892, DUF6, score 5.6e-08"
     misc_feature    complement(266780..266857)
                     /note="Signal peptide predicted for TVA2592 by SignalP 2.0
                     HMM (Signal peptide probability 0.953) with cleavage site
                     probability 0.829 between residues 26 and 27"
     CDS             267007..267462
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0214"
                     /old_locus_tag="TVA2591"
                     /product="Lrp/AsnC transcriptional regulator-like protein"
                     /note="user locus_tag: VANGcII0214"
                     /protein_id="CDQ48111.1"
                     /translation="MDRIDRRMLTLLQTEGRLSTAELAEKVGLSPSPCARRLKRLEES
                     GIIDGYQARLSRQAVGVGMTVFVEVSLNNHQAASIDSFEEAIKEMEEVISCHVVSGAY
                     DYLLEVVSANLSGYEAFTRQLQRLNNVKDMHTHLAMRQVKAATAMPIWV"
     misc_feature    267025..267150
                     /note="HMMPfam hit to PF01047, MarR, score 0.00019"
     misc_feature    267058..267123
                     /note="Predicted helix-turn-helix motif with score
                     1777.000, SD 5.24 at aa 18-39, sequence
                     LSTAELAEKVGLSPSPCARRLK"
     misc_feature    267061..267141
                     /note="PS00519 Bacterial regulatory proteins, asnC family
                     signature."
     misc_feature    267199..267426
                     /note="HMMPfam hit to PF01037, AsnC_trans_reg, score
                     1.4e-28"
     CDS             complement(267501..268706)
                     /transl_table=11
                     /gene="plp"
                     /locus_tag="VANGNB10_cII0215c"
                     /old_locus_tag="TVA2590"
                     /product="Putative Vah1-repressor, Plp (phospholipase
                     A2)."
                     /function="hemolysine"
                     /note="user locus_tag: VANGcII0215c"
                     /note="Similar to Vibrio anguillarum (Listonella
                     anguillarum) plp subname: full=plp UniProt:Q4ZHV5
                     (EMBL:EU650390) (416 aa) fasta scores: E()=1.3e-174, 98.5%
                     id in 401 aa. The plp gene of V. anguillarum encoding a
                     phospholipase with A2 activity is specific for
                     phosphatidylcholine and, therefore, able to lyse fish
                     erythrocytes, but not sheep erythrocytes. Mutation of plp
                     does not affect the virulence of V. anguillarum in rainbow
                     trout. Ref: Li et al. BMC Microbiology 2013, 13:271"
                     /protein_id="CDQ48112.1"
                     /translation="MAIAENTDTSSESVTAYGVMNTQNKQTYTYVRCWYRPAGNHDDP
                     ATDWEWALDEQGNDYTISGYWWSSVRFKNMFYTDTSQYEIKQRCEETLGVSHDSADIT
                     YFAADNRFSYNHSIWTNDKQNAKPVINKMVTIGDSLSDTGNIFNASQWKFPNPNSWFL
                     GHFSNGLVWTEYLAKMHDLPVYNWAIGGAAGRNQYIALTGVNDQVRSYLNYMTMAKNY
                     QPENTLFTLEFGLNDFMNYNREVYEVKADFSSAMIRLVDSGAKNIILLTLPDATKAPQ
                     FKYSTAEEIAKVSAKITTFNAFIQQQALYYQMQGVNIILFDAHNLFENLTANPQQYGF
                     ENATDACLNINRNSALDYLYRHSLTNDCAYHSSDKYVFWGVTHPTTAIHQLIANEIGK
                     NSLASFQFE"
     misc_feature    complement(267537..268316)
                     /note="HMMPfam hit to PF00657, Lipase_GDSL, score 4.1e-32"
     regulatory      269106..269111
                     /note="-35 signal, vah1 (Ref: doi:10.1128/IAI.00506-13)"
                     /regulatory_class="minus_35_signal"
     regulatory      269128..269133
                     /note="-10 signal, vah1 (Ref: doi:10.1128/IAI.00506-13)"
                     /regulatory_class="minus_10_signal"
     regulatory      269245..269250
                     /function="Putative ribosomal binding site (RBS)"
                     /note="Ref: doi:10.1128/IAI.00506-13"
                     /regulatory_class="other"
     CDS             269256..271478
                     /transl_table=11
                     /gene="vah1"
                     /locus_tag="VANGNB10_cII0216"
                     /old_locus_tag="TVA2589"
                     /product="Putative pore-forming hemolysin, Vah1"
                     /function="part of hemolysin gene cluster in Vibrio
                     anguillarum"
                     /note="user locus_tag: VANGcII0216"
                     /note="Similar to Vibrio anguillarum (Listonella
                     anguillarum) vah1 subname: full=vah1 UniProt:Q4ZHV4
                     (EMBL:EU650390) (771 aa) fasta scores: E()=0, 94.5% id in
                     740 aa"
                     /protein_id="CDQ48113.1"
                     /translation="MLINRRKALSAIAIMSGLVWNTAQADVYQPQGLAIEMFSELQDD
                     SQINYLNASYWLQEEVEPPALAQIRDDVLNQHLRYFVDFSMIEDESQKAEAKTRFRKK
                     LGLAFASDFLIISEHKGELLFTPLDDENDPNIRLLEAAKMTHSRQRRSTANALSSSVS
                     ETNSLPHVAFYLNVNRPITDNECTFNNSHLWDRGTRVFCDNPNISLIYRVNLERSLQY
                     GTIGSATPDAKIVRISLDDDTTGAGIHLNDRLDYRQSGADYLTLDAYFRDWSTDAIAQ
                     DYQFVFNSSNNKAQILKTFPRENLNAEYEVKEVSGFQLGVSGGVEVSADGPKGKLEAN
                     ASYNQSRWLTFKTHDYRVERSTNNAQNVSFKWNRSQYATAESMMNRSTDAIWVNTYPV
                     DTNRINPIGYASFVPKMDVIYKAAPNATGITEFTIDSSVNIRPIYNGAYKHYYVVGGH
                     QSYHGFENTTRRRVSKSASFTVDWEHPVFTGGRPVNLQLGSFNNRCVDVADNGVLSAS
                     SCDETKNSQSFIYDQLGRYVSANDIHQCLDGQSLGQLQTCSSSLSQRWEWVENSDKLS
                     NVFSHELLGHDKTSGELGLYADDNDQVSVRTITAYSNVFKSDNESVVFGFTSGSLALQ
                     DVGQAGILYIRHGAAIDAIGTQANATQGGGSGSLTEIDLKRVTQITVTSGEFKYGGNH
                     LLRMAFKLDDGSTKVVGSKGSAISTHDEVFELPAGSAIRQVKVWSEGWLADGIQFIIK
                     "
     misc_feature    269256..269330
                     /note="Signal peptide predicted for TVA2589 by SignalP 2.0
                     HMM (Signal peptide probability 1.000) with cleavage site
                     probability 0.992 between residues 25 and 26"
     misc_feature    269895..270683
                     /note="HMMPfam hit to PF07968, Leukocidin, score 2.3e-118"
     misc_feature    270702..270959
                     /note="HMMPfam hit to PF00652, Ricin_B_lectin, score
                     1.3e-09"
     CDS             271744..272685
                     /transl_table=11
                     /gene="llpA"
                     /gene_synonym="hlyC"
                     /locus_tag="VANGNB10_cII0217"
                     /old_locus_tag="TVA2588"
                     /product="Lactonizing lipase"
                     /EC_number="3.1.1.3"
                     /note="user locus_tag: VANGcII0217"
                     /protein_id="CDQ48114.1"
                     /translation="MKRTIIIAAFCLLSTTALAATSTVALSKAGYTQTQYPIVLVHGL
                     FGFDTLAGVDYFYGIPQSLTKDGAKVYVAQVSAINSSELRGEQLLQQVESLLAATGAQ
                     KVNLIGHSHGGPTARYVASVRPDLVASVTSIGGVNKGSIVADLVRGHIKEGSISEAIA
                     VKMAQGLAGLVGLLSGGSNLDQDPLASLEALTTQGSLAFNQHYPEGVPSSECSDGELL
                     ADNGVYYYSWTGSSTFTNLLDPTDAAMMLTGLVFNGPNDGLVGVCSTHLGKVIRDDYQ
                     MNHLDEINGLLGIHHLFETDPVTLYRQHANRLKLQGL"
     misc_feature    271744..271800
                     /note="Signal peptide predicted for TVA2588 by SignalP 2.0
                     HMM (Signal peptide probability 1.000) with cleavage site
                     probability 0.980 between residues 19 and 20"
     misc_feature    join(271756..271824,271852..271920)
                     /note="2 probable transmembrane helices predicted for
                     TVA2588 by TMHMM2.0 at aa 5-27 and 37-59"
     misc_feature    271882..272466
                     /note="HMMPfam hit to PF00561, Abhydrolase_1, score 5e-14"
     misc_feature    272053..272082
                     /note="PS00120 Lipases, serine active site."
     CDS             272755..273615
                     /transl_table=11
                     /gene="llpB"
                     /locus_tag="VANGNB10_cII0218"
                     /old_locus_tag="TVA2586"
                     /product="lactonizing lipase activator, LlpB"
                     /note="user locus_tag: VANGcII0218"
                     /note="The CDS contained a frameshift after codon 132 in
                     454-seq (near a homopolymeric tract), but seem not be a
                     psudogene according to a recent
                     PacBio-sequencing:..TTTTTTAACGT(T)GATCAGC..., i.e.
                     PacBio-seq contains an extra nt=T (like a geographical
                     sister isolate). Concluding not a pseudogene. CDS is 97.6%
                     identical to Vibrio anguillarum lactonizing lipase
                     activator LlpB (Q4ZHV2_VIBAN); 286 aa."
                     /protein_id="CDQ48115.1"
                     /translation="MKKPALFGFVVIILGSIGAVLFLQKPVSSQSALQTPSQQDTQID
                     SASSLDLIHYFISTLGESSLPEVELRIAQYAEQDEGVVIDPMLFEQFIQYKQALAELE
                     ANSSIANLDLATLAEINQQLLKIQSQFFNVDQQSMLFGEENALRNLALEKLRIKAQAV
                     DSYDEQLQWQTLLAQQPEYIQRSERNVQLLPALNASRHLSTQEQYLAWNELVGEQGAQ
                     RLTQLSEQREQFSQHLENYLQQRSAVLENTRLSEDEKNQQITQLRTQTFEVKQLKRVE
                     ALERLSDQSL"
     misc_feature    272755..272823
                     /note="Signal peptide predicted for TVA2587 by SignalP 2.0
                     HMM (Signal peptide probability 0.771) with cleavage site
                     probability 0.232 between residues 23 and 24"
     misc_feature    272764..272823
                     /note="1 probable transmembrane helix predicted for
                     TVA2587 by TMHMM2.0 at aa 4-23"
     misc_feature    272902..273146
                     /note="HMMPfam hit to PF03280, Lipase_chap, score 2e-08"
     misc_feature    273166..273606
                     /note="HMMPfam hit to PF03280, Lipase_chap, score 2.2e-26"
     CDS             complement(273689..276445)
                     /transl_table=11
                     /gene="empA-p"
                     /gene_synonym="epp"
                     /locus_tag="VANGNB10_cII0219c"
                     /old_locus_tag="TVA2585"
                     /product="EmpA processing protease;"
                     /function="Ref: The zinc metalloprotease EmpA is a
                     virulence factor for the fish pathogen Vibrio anguillarum.
                     Previous studies demonstrated that EmpA is secreted as a
                     46-kDa proenzyme that is activated extracellularly by the
                     removal of an 10-kDa propeptide. We hypothesized that a
                     specific protease is responsible for processing secreted
                     pro-EmpA into mature EmpA. To identify the protease
                     responsible for processing pro-EmpA, a minitransposon
                     mutagenesis (using mini-Tn10Km) clone bank of V.
                     anguillarum was screened for reduced protease activity due
                     to insertions in undescribed genes. One mutant with
                     reduced protease activity was identified. The region
                     containing the mini-Tn10Km was cloned, sequenced, and
                     found to contain epp, an open reading frame encoding a
                     putative protease. Further characterization of epp was
                     done using strain M101,created by single-crossover
                     insertional mutagenesis. Protease activity was absent in
                     M101 cultures even when empA protease activity was induced
                     by salmon gastrointestinal mucus. When the epp mutation
                     was complemented with a wild-type copy of epp (M102),
                     protease activity was restored. Western blot analysis of
                     sterile filtered culture supernatants from wild-type
                     (M93Sm) cells,M101 cells, and M102 cells revealed that
                     only pro-EmpA was present in M101supernatants; both
                     pro-EmpA and mature EmpA were detected in M93Sm and M102
                     supernatants. When sterile filtered culture supernatants
                     from the empA mutant strain (M99) and M101 were mixed,
                     protease activity was restored. Western blot analysis
                     revealed that pro-EmpA in M101 culture supernatant was
                     processed to mature EmpA only after mixing with M99
                     culture supernatant. These data show that Epp is the
                     EmpA-processing protease."
                     /note="user locus_tag: VANGcII0219c"
                     /note="Similar to Vibrio anguillarum (Listonella
                     anguillarum) epp subname: full=empa processing protease
                     UniProt:B5LBF9 (EMBL:EU650390) (918 aa) fasta scores:
                     E()=0, 99.3% id in 918 aa, and to Vibrio anguillarum
                     (Listonella anguillarum) epp subname: full=empa processing
                     protease UniProt:B5LBF9 (EMBL:EU650390) (918 aa) fasta
                     scores: E()=0, 99.3% id in 918 aa"
                     /protein_id="CDQ48116.1"
                     /translation="MKHIRKTLLASAMVTLFNVSAYAHTPIDLGVVNEDKLIEMLVRN
                     GVVDANATDAIKRDALDRYLEQKIKSGFHGDAQFGKQALEQRARVLKTIEKQKGHQKA
                     SVFALDISTKRTDKVLALLIDFPDLPWNDNRLTKEHTEMLYASYNPPHYQDLLFSDAG
                     YAGPNGENFISMRQYYESESGQSYSVAGQAAGWYRASKNAAFYGGNSATTDKDMNAQE
                     LVREALNQLAQDPSINLADYDIEDRYDYNGNGNFREPDGVIDHLMVFHASVGEEAGGG
                     VLGPDAIWSHRYNLGQPYVLQGTKSTLPDRFNGQYAAFDYTMQPIDAAAGVCAHEYGH
                     DLGLPDEYDTQYTGKGEPVSYWSIMSSGSWAGKIGGTQPTAFSSWSKQFLQKAVGGRW
                     INDDQISIAELEKNPRVFTLFQTTDNARPNMVKIDLPLKRVDGVKPYQGSSAFYSNRG
                     DDLKNSMSRKLSIPTGEQATLNFKAWYQIEKDYDFARVLINGKAIAGNITTMDDPYNT
                     GLVPAIAGQSDGWVDAIFDVSQWAGQEVTLSFDYVTDGGLAMEGLYLDNLQLEVDGQQ
                     TLIDDAEGTSTFAFKGYTTNNGFHEAPHYYLLQWRSHNDVDQGLANIKRMGQLMTFEP
                     GLLVWYVDESYTDNWVGNHPGEGWLGVVDADQNALVWSKTGEAAQTRFQVRDATFSLQ
                     DQTPLRLVAADGDVLEDTSLIGNGNFSDGADYSSPLVPDAGRKLTEFGLMIDILNQGQ
                     DNEYGVIRLSKVSEQNQAPVANFELKTDGLSVSAFNYSYDEDGELVSYAWDFGNGQMS
                     SEMAPSWSYTKAGQYTVSLTVTDDKGATNTTTRTTQVEVPNALPQASAKYIHLGRWVT
                     MWSTSSDSDGRIVDTEWTLPNGKIKRGKLFTAIFPSSGKHEVKIKVMDDKGATVTNTI
                     VVNL"
     misc_feature    complement(273698..273922)
                     /note="HMMPfam hit to PF00801, PKD, score 7.4e-15"
     misc_feature    complement(273941..274153)
                     /note="HMMPfam hit to PF00801, PKD, score 7.4e-16"
     misc_feature    complement(274205..276142)
                     /note="HMMPfam hit to PF05547, Peptidase_M6, score 0"
     misc_feature    complement(275438..275467)
                     /note="PS00142 Neutral zinc metallopeptidases,
                     zinc-binding region signature."
     misc_feature    complement(276377..276445)
                     /note="Signal peptide predicted for TVA2585 by SignalP 2.0
                     HMM (Signal peptide probability 1.000) with cleavage site
                     probability 1.000 between residues 23 and 24"
     CDS             complement(276641..276886)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0220c"
                     /old_locus_tag="TVA2584"
                     /product="Putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0220c"
                     /note="BlastN-run: hypothetical protein VFA_002342 [Vibrio
                     furnissii CIP 102972] Length=81"
                     /protein_id="CDQ48117.1"
                     /translation="MKHLIYFLLISYSSISLAQSSVDDERLLASLIERGVICEGLTSE
                     QQQQALALYLQRKHHKEKSLNSTTHQEEACISPPKSD"
     misc_feature    complement(276833..276886)
                     /note="Signal peptide predicted for TVA2584 by SignalP 2.0
                     HMM (Signal peptide probability 0.963) with cleavage site
                     probability 0.886 between residues 18 and 19"
     CDS             277393..278154
                     /transl_table=11
                     /gene="gat"
                     /locus_tag="VANGNB10_cII0221"
                     /old_locus_tag="TVA2583"
                     /product="Glutamine amidotransferase"
                     /note="user locus_tag: VANGcII0221"
                     /note="Similar to Vibrio anguillarum (Listonella
                     anguillarum) gat subname: full=gat UniProt:B5LBG0
                     (EMBL:EU650390) (253 aa) fasta scores: E()=3.1e-113, 99.6%
                     id in 253 aa"
                     /protein_id="CDQ48118.1"
                     /translation="MCRWLAYQGTPIYLDQLVYQPEHSLVHQSLEARKAVTRVNADGF
                     GLGWYTERTTPGQFHEVLPAWGDENLRSLTHHIRSHRFMAHVRSSTGTQVSRSNCHPF
                     ILDHWMFLHNGQIGEFEKVKFALERQLPESLYVKRVGTTDSELIFLLMMSNGLRSQPV
                     QAITTTIGQIAQALAEKQIVTPFKASICISDGQDFWLVRYSSDGNPPTVFSKSEGDNM
                     VVASEPLDSESGWQMIEPQTITHVIGAQCTVYPIT"
     misc_feature    277426..278064
                     /note="HMMPfam hit to PF00310, GATase_2, score 0.00012"
     CDS             278344..280734
                     /transl_table=11
                     /gene="expA"
                     /locus_tag="VANGNB10_cII0222"
                     /old_locus_tag="TVA2582"
                     /product="Excreted protease A"
                     /note="user locus_tag: VANGcII0222"
                     /note="Similar to Vibrio anguillarum (Listonella
                     anguillarum) expa subname: full=expa UniProt:B5LBG1
                     (EMBL:EU650390) (868 aa) fasta scores: E()=0, 97.6% id in
                     795 aa"
                     /protein_id="CDQ48119.1"
                     /translation="MRIAPVPSIHSPRLKPNALLLALSLAGLPSFSYASDACQFSDIT
                     QAQEPILAIKNAQPACYNSWFYTDSKAILGLYSENSIDSINRALALEVSQYQGTEAQA
                     KSIANLGEFIRAAYYVRYGVKQEFGDYSDQLSNAIADTINQFMLSPYSLSLGREQVAA
                     MSSLTLMVDNVKRLPSTMANFIVLLDAFNPQTAQDVQFVDGLNNLFRSMSGHASRDDF
                     YQDIEAHPEYLETLYRFATEHDWALGTNADFILYNAVRETGRLLVSPYPNTKTRVIAI
                     LEKVLERYPLGGRSDKLWIASVEMLSYYAPETLEALNLTQAKQQLEQRIMPNHHQCDG
                     PAIIRSQGLTPQQAEQACGILNEKEADFHAVANTGFTPVADDLNQQVEVVVFDSNESY
                     VSYSNFLFGNTTNNGGQYLEGNPADANNTARFVAYRYAQDEALSILNLEHEYVHYLDG
                     RYNQYGSFSLNLSEGHIVWWLEGFAEYMHYKKGYQAAVDLIAEKKLSLTQVLATTYQN
                     DTNQIYRWGYLAVRFMLENHPNEVDQLLALSRSGDFKAWAEQVKRIGKSLDSEFSTWL
                     DTLTTDSGNPEDPTVPPIQPEDTMNHLALGQSVTLSGEQYSEQLYYIDVPDNVSELSI
                     NISGDGDADLYLSYEKIAHYYDYQITNFELHSNETIALEKQANGTVLPGRYYFSITGR
                     EAYQRVELNTKVSYAITDNTQKPSDDLAPVVLENRQPMTLGIHQTRYAAIYVPEGMSS
                     VKVWLQPIDEMAAHNVDLYAESEHWPTLTHFDQASKRADSYEYIELPVTRLCPFHA"
     misc_feature    278344..278445
                     /note="Signal peptide predicted for TVA2582 by SignalP 2.0
                     HMM (Signal peptide probability 1.000) with cleavage site
                     probability 0.929 between residues 34 and 35"
     misc_feature    278455..279006
                     /note="HMMPfam hit to PF08453, Peptidase_M9_N, score
                     4.4e-17"
     misc_feature    279172..280038
                     /note="HMMPfam hit to PF01752, Peptidase_M9, score
                     2.9e-151"
     misc_feature    279658..279687
                     /note="PS00142 Neutral zinc metallopeptidases,
                     zinc-binding region signature."
     CDS             281023..282204
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0223"
                     /old_locus_tag="TVA2581"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0223"
                     /note="Conserved protein also in Vchol: MXZO-3"
                     /protein_id="CDQ48120.1"
                     /translation="MRYITPVSLLLVATIMGCNSEEATTSSTSQSNADAIAQQKRALA
                     LQLSESYAELETTLKTEISAQNLSISVSTLFEEQPDSDFSQQMVVADAQIRSMKGIED
                     FTEQLLQLRIADASMIKEWQEGQSPLFAFEPKGNDASWQYIEAFDVYGLVHQLDVYQM
                     PDVPVFVVDSNSEVELRAGLQAMRAQMNALGQSTTLTTVESGSVAAQAMARSSDNSAE
                     PISTTVLKKIRLADDKEPWISGAAEIYAIVTGINPSRDEPTIDLVEMPYLDYDKQDYF
                     PNQVMIQWSRYRWGAADLILMEQDDGTDYKELAKLLVKVAEEVLKLIPDPEVQAYAII
                     PQITGKIIDAIPDGLLVNDDDYVDVFYTLMQDTSYVDHPGASGNAVATFEPLTINPTR
                     P"
     misc_feature    281023..281082
                     /note="Signal peptide predicted for TVA2581 by SignalP 2.0
                     HMM (Signal peptide probability 0.964) with cleavage site
                     probability 0.547 between residues 20 and 21"
     misc_feature    281044..281076
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
     CDS             282400..283311
                     /transl_table=11
                     /gene="vctP"
                     /locus_tag="VANGNB10_cII0224"
                     /old_locus_tag="TVA2580"
                     /product="Ferric (periplamic) anguibactin-binding protein"
                     /note="user locus_tag: VANGcII0224"
                     /note="Cfr IPR002491"
                     /protein_id="CDQ48121.1"
                     /translation="MKSLFSLAALGLLTSFTLSAKTVSVNHQLGTTTIEQNPQRVVVI
                     GLGALDTLDRFGIEPVAVSKVTELPNYLAKYNSDTYAPAGSLFEPDFETIYMQKPDVI
                     VIGPRAATSYDELSKIAPTIVFAADASQGYWQSTQQQWRNLGKVFAIEDQVEAKIEDL
                     DKQFQALRSFNQNNQIDALTVMSSGGNITAFGPESRFSAVYKDFGFKTTVDSIKATRH
                     GDLISYEFIREHDPKTLLIIDRDTLVNKGQSHTRQEFENDLIKATAAYKNKSMAFLDL
                     NAWYLSISGVTATEQMISDVRNAVHIH"
     misc_feature    282400..282459
                     /note="Signal peptide predicted for TVA2580 by SignalP 2.0
                     HMM (Signal peptide probability 1.000) with cleavage site
                     probability 0.974 between residues 20 and 21"
     misc_feature    282511..283233
                     /note="HMMPfam hit to PF01497, Peripla_BP_2, score
                     1.6e-34"
     CDS             283339..284274
                     /transl_table=11
                     /gene="vctD"
                     /locus_tag="VANGNB10_cII0225"
                     /old_locus_tag="TVA2579"
                     /product="Ferric vibriobactin enterobactin ABC
                     transporter,permease protein"
                     /note="user locus_tag: VANGcII0225"
                     /protein_id="CDQ48122.1"
                     /translation="MKKLLLALLVVSLSSLFVGVGNLSLMALLQGDAHAWQLLFTSRL
                     PRLLAIVLAGAGLSIAGLIMQQISQNRFAAPSTSGTIECAMLGYVLSLVFFGHGESLW
                     LIFSVSIAGTLLFVQLIQRVQFKNAIFVPLIGIIFGNVVESAASFIAYKYDAIQNLSS
                     WTVANFANLLKGDFELLYIAIPVALFSYLYAARISAVGMGKDFAVNLGLNYQQVLVIG
                     VCLVSVMSATVVMIVGQLPFLGLIVPNLVSHYYGDNLRKNIPRTAIFGALLVLLCDLG
                     GRLIIFPYEVPISMIISILGGSVFIVLLLRGQRHG"
     misc_feature    283426..284256
                     /note="HMMPfam hit to PF01032, FecCD, score 6.2e-46"
     misc_feature    join(283474..283542,283618..283686,283720..283788,
                     283858..283926,283945..284013,284023..284091,
                     284125..284184,284194..284253)
                     /note="8 probable transmembrane helices predicted for
                     TVA2579 by TMHMM2.0 at aa 21-43, 69-91, 103-125,
                     149-171,178-200, 204-226, 238-257 and 261-280"
     misc_feature    284267..284380
                     /note="Signal peptide predicted for TVA2578 by SignalP 2.0
                     HMM (Signal peptide probability 0.971) with cleavage site
                     probability 0.708 between residues 38 and 39"
     CDS             284297..285247
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0226"
                     /old_locus_tag="TVA2578"
                     /product="ferric anguibactin transport system permease
                     protein fatc"
                     /note="user locus_tag: VANGcII0226"
                     /protein_id="CDQ48123.1"
                     /translation="MRDHTKLWLLVLASLLFAGLFIGVGLNADNYHYFLSRRVPKVLA
                     MVLAGIAIAQSSLAFQTITHNRILTPSIMGFDSLYLFVQVLVVTLFGGLSSYALNAYL
                     NFSLSVAAMLLFSSLLFAFYFRKQQSNLMVLLLLGVILGQLFSSISSFLIMLMDPNDF
                     SSVQSNMFASFNNVKVELVYWVTPLLLLVCFGLFRLHRVLDVLWLDNDNAVSLGVDVR
                     RVTHHVLMLSAVLIAISTALVGPVMFFGLLVTNLTREWFRSYQHRTLLIGCSAMAVCA
                     LLSGQWVVEKVFQFETTLSVVINFIGGLYFLSLLLRNKMV"
     misc_feature    join(284309..284377,284414..284482,284510..284578,
                     284597..284665,284693..284761,284822..284890,
                     284984..285052,285089..285148,285176..285229)
                     /note="9 probable transmembrane helices predicted for
                     TVA2578 by TMHMM2.0 at aa 15-37, 50-72, 82-104,
                     111-133,143-165, 186-208, 240-262, 275-294 and 304-321"
     misc_feature    284369..285232
                     /note="HMMPfam hit to PF01032, FecCD, score 4.6e-46"
     CDS             285254..286015
                     /transl_table=11
                     /gene="vctC"
                     /locus_tag="VANGNB10_cII0227"
                     /old_locus_tag="TVA2577"
                     /product="Ferric vibriobactin enterobactin ABC
                     transporter,ATP-binding protein"
                     /note="user locus_tag: VANGcII0227"
                     /protein_id="CDQ48124.1"
                     /translation="MIQLDKLTKVFGQQAVVDKACAQFEKGKVTSIIGPNGAGKSTLL
                     SMASRLVSRDSGKVWIESKELVEWDTKALAKKLSVLRQANTLTMRFTVKELVAFGRFP
                     YSQGKLTANDHAMIEQSIEYLDLKAIEDKYLDELSGGQRQLAFIAMVIAQDTDYIFLD
                     EPLNNLDIKHSLQIMATIQRLAHELNKAVVVVIHDINFASCYSDSIIALKRGQVVATG
                     TVQEVIQSSVLSDIYETPFNVLEIESKRICMYYTH"
     misc_feature    285332..285889
                     /note="HMMPfam hit to PF00005, ABC_tran, score 6.3e-44"
     misc_feature    285353..285376
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
     misc_feature    285659..285703
                     /note="PS00211 ABC transporters family signature."
     CDS             286348..287541
                     /transl_table=11
                     /gene="ackA2"
                     /locus_tag="VANGNB10_cII0228"
                     /old_locus_tag="TVA2576"
                     /product="acetate kinase 2"
                     /EC_number="2.7.2.1"
                     /note="user locus_tag: VANGcII0228"
                     /protein_id="CDQ48125.1"
                     /translation="MSNSFVLVINSGSSSLKFAVIDSNTGDAVLSGLGEFFGLDDARM
                     SWKFNGEKANCAIQGEANHHLLAVAKLVELVKSYGLIDDVVAIGHRVVHGGEKFTKTV
                     KLDEKIVNEVEALSDLAPLHNKAHAIGMRAAMLAFPELPQFAVFDTAFHQTMPAKAYT
                     GAIAKELYTEFGIRRYGFHGTSHYFVSREAAKMINKPVEESSFISVHLGNGASVCAIK
                     DGQSVDTSMGFTPLSGLMMGTRCGDLDPGIIEFLLKKGWTQEQVFNSLNKASGFLGVS
                     GLTSDARGILEAMEQGHEGATLAFQVFTYRVAKYIASYLAALDSLDGIIFTGGIGENA
                     LPIRREILRNLKILGFVEDEQGNEQARFGNAGIIAKSDMLNAVALVVPTNEEFVIAQQ
                     SVELL"
     misc_feature    286363..286398
                     /note="PS01075 Acetate and butyrate kinases family
                     signature 1."
     misc_feature    286363..287520
                     /note="HMMPfam hit to PF00871, Acetate_kinase, score
                     2.1e-175"
     CDS             complement(287850..289100)
                     /transl_table=11
                     /gene="tyrS1"
                     /locus_tag="VANGNB10_cII0229c"
                     /old_locus_tag="TVA2575"
                     /product="Tyrosyl-tRNA synthetase 1"
                     /EC_number="6.1.1.1"
                     /note="user locus_tag: VANGcII0229c"
                     /note="ref: P0AGJ9_Ecoli"
                     /protein_id="CDQ48126.1"
                     /translation="MTFIQELQTRGLIAQASDLDQIQQQLNQPQTVYCGFDPTAGSLH
                     IGHLVPLIMLKRFQDAGHQALALIGGATGMIGDPSFKAVERSLNTEETVASWVKDLTT
                     QIEQLLAPHLSKPMTIVNNAEWMRDINVIDFFRDVGKHFSVNNMISRESVKQRLQRPE
                     QGISFTEFSYSLLQSYDFSVLNRNHGCCLQIGGNDQWGNIVSGIDLTRRQNGEQVFGL
                     TLPLITKSDGTKFGKTEGGAVWLDPEKTSPYMFYQFWLSTEDTDVYNLLRYYTFLTCE
                     EIDQIEWQDKSSNGKPEAQKILAQNMTRFVHGESGLLSAERITQALFTNSLEKLSYSE
                     LKQLELDGIPSIESTQQDIVELLVESGLAKSKRIARELIEDNAISVNGEKITPDNSLL
                     GFPLFDQYWLIKRGKKHFGLVKRK"
     misc_feature    complement(287940..288035)
                     /note="HMMPfam hit to PF01479, S4, score 8e-06"
     misc_feature    complement(288129..289028)
                     /note="HMMPfam hit to PF00579, tRNA-synt_1b, score 1e-108"
     misc_feature    complement(288957..288989)
                     /note="PS00178 Aminoacyl-transfer RNA synthetases class-I
                     signature."
     CDS             complement(289193..289993)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0230c"
                     /old_locus_tag="TVA2574"
                     /product="transcriptional regulator, LuxR family"
                     /note="user locus_tag: VANGcII0230c"
                     /protein_id="CDQ48127.1"
                     /translation="MTKSQFNNLLADSISSLKSPSFTPNLMAFIASLVNYDCAVILGL
                     RTDKHPIYLYDSIKNNRELLFDRYLTSAFQDDPFYKMLTINEQQGVFSLKDVAKRDMD
                     YQTYCNQFYLQTGWKDELSILIKVEATRWVLIYLGCTHEDNLFSPLNVKTLKSYFSVI
                     QSLCQQHWKQTEFLLAEPVFSPESYSVKKRKFIEDGLHSFGKDLLSTREKQIARLILQ
                     GLDTKEIAKQLDITEGTVKNHRKRIYAQLRVSSLSELFQIFLNHIITH"
     misc_feature    complement(289217..289390)
                     /note="HMMPfam hit to PF00196, GerE, score 6.1e-22"
     misc_feature    complement(289271..289336)
                     /note="Predicted helix-turn-helix motif with score
                     1535.000, SD 4.42 at aa 220-241, sequence
                     LDTKEIAKQLDITEGTVKNHRK"
     CDS             290359..292053
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0231"
                     /old_locus_tag="TVA2573"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0231"
                     /note="Similar to Pseudomonas fluorescens (strain
                     Pf-5/ATCC BAA-477) subname: full=uncharacterized protein
                     UniProt:Q4KF44 (EMBL:CP000076) (581 aa) fasta scores:
                     E()=3e-22, 28.8% id in 548 aa"
                     /protein_id="CDQ48128.1"
                     /translation="MLNLKSEAIKTCVSGLADNVRAENIEYESYIKLYSGTENILNIN
                     NRNNTIIYGRRGSGKTHLLKALQEKIAIDLYSNKNFPIYIDIRRIVPLLSSEQGSQEI
                     NSILIFKYLMQELAHTLILNINHICGINEFDSVNDQVLKLKELDLLDKFKSIYLEFDG
                     RKFVKPTSLTVSEEEIKSLGGSAKISRNPELSAKKDLQTKVSGDKKMNSYISILDITN
                     EIENILESLSLRRITLIIDEWSEIEMSTQIYLAEILKKSFSAIPVTLKIAAIPNRTNL
                     GIKTEEKFFGLEDGGDIFGYPLDMRYVFEVNKSETRNFFNDLIYKHLYSIDPSSIDGL
                     LKDNKTEKDKIINLFFANVAMNEILVASAGIPRDFMNLFIDSYDKFLLSSGSSSKRIS
                     VKNLRSANSEWYETDKKEQIDKHPIERQLLTEIVKEVIENKKSIHFLVQEKHTKNKHM
                     QNLIDFRVMYLRKKGYSHKDHSGTSYNVFSIDYGCYNSLNISKNKLDASTLENLNLKE
                     LREIRRISLEDSFFQKFLMEIGEAFSCPHCNRPIDTNHLAYIKQRLCNNCYEKIQG"
     misc_feature    290515..290538
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
     misc_feature    291091..291156
                     /note="Predicted helix-turn-helix motif with score
                     1023.000, SD 2.67 at aa 245-266, sequence
                     STQIYLAEILKKSFSAIPVTLK"
     misc_feature    complement(292146..294319)
                     /note="Dbl sequence in chr2; p38b; tidl contig014; rev"
     CDS             complement(292382..292555)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0232c"
                     /old_locus_tag="TVA2977B"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0232c"
                     /note="Cfr PCR200, seq2056 (partial seq; eg from p132)"
                     /protein_id="CDQ48129.1"
                     /translation="MGDIQAYPVPYVAQNISLDAHYSAESASITKEYCPTSFRLSLPF
                     WPQRINHFRCFII"
     CDS             292734..294206
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0233"
                     /product="Putative RNA-directed DNA polymerase (reverse
                     transcriptase)"
                     /note="user locus_tag: VANGcII0233"
                     /note="Contains groupII Intron (maturase-spesific:
                     IPR013597): This region is found mainly in various
                     bacterial and archaeal species, but a few members of this
                     family are expressed by fungal and chlamydomonal species.
                     It has been implicated in the binding of intron RNA during
                     reverse transcription and splicing; cfr TVA2946
                     (pre_p38b)"
                     /protein_id="CDQ48130.1"
                     /translation="MVASSEVSASPNGTQWQSIDWKAVESHVLKLQMRIAKATREGKH
                     SKAKSLQWILTHSRSAKLLAVKRVSQNKGSNTPGIDGVIWNTDARRMTAVDQLNRKGY
                     RAKPLRRIYIPKKNGKLRPLGIPCMIDRAQQALYLLALEPISETIADPNSYGFRPNRS
                     TADAIAQCFKCLCLKRSGRWVLEGDIKACFDKIGHEWLLEHVQIDKRMLKQWLGSGYI
                     DKGLFYRTSEGTPQGGIISPTLMLLTLAGLEKLVKEVAKKSGERVNFIGYADDFVITG
                     SSKDVLVNEVKPRVIDFLKERGLTLSEEKTHITHIDEGFDFLGFNLRKYKGKLLIKPS
                     KSNVLSFLGNLRELIKKHATMPVNDLIRLLNPKLKGWANYYRHCVAKRTFGYLGHQIF
                     WLLWRWAVRRHPTKPKDWVRRKYYMNRSGGWQFHGWQKIANMDCHYNLIQIAKTPIKR
                     HVKIRSAATPFDPLYQDYLAKRKPKKESRHSWFDPALTAI"
     CDS             294679..295245
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0234"
                     /old_locus_tag="TVA3252"
                     /product="Putative membrane protein"
                     /note="user locus_tag: VANGcII0234"
                     /protein_id="CDQ48131.1"
                     /translation="MVDKTQILFESLRRTDSYTLAADQKASFCLAAAVTFLGIYSTLF
                     YSVITDDNAVISATLTIAILGLVLLPWIVFFYTIKTIFSPNLKPSEKESIISFASIAS
                     NTPSLEQFKLYYESININNDMFVNNINEDILENHWICSEICFNKMKNFKKSLHWLWVA
                     LSISLIGLATMVYFIEHHEFTKFLSICK"
     misc_feature    join(294754..294822,294835..294903,295135..295203)
                     /note="3 probable transmembrane helices predicted for
                     TVA3252 by TMHMM2.0 at aa 26-48, 53-75 and 153-175"
     CDS             complement(295276..296685)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0235c"
                     /old_locus_tag="TVA3251"
                     /product="putative adenylyl cyclase class-3/4/guanylyl
                     cyclase"
                     /note="user locus_tag: VANGcII0235c"
                     /protein_id="CDQ48132.1"
                     /translation="MSAKSLEEITKGYFSDIRDGLESKRSKRIIGNENYSTESFDELF
                     ESVDLYKSASVSRRLKAESSGELTAPEEYTYQNALRPWFNKVGLNQSKVGPHPDFAHL
                     KDSGEVEFHHIVTMFVDIKRSSRLSLLMPLQDAYVVKNRILQACVDVIRALDGYPHRL
                     MGDAVMAFFGGKGNCPEDAIANALNASSALKLILTETVFPELNKLIGKDVNLGVRVGL
                     DYGSRKEVVWANYGYGDASEVTALGIPVDLASKAQSQARTNTAMLGQGILDYVDFPDR
                     YSEIKTVGKNKSEERYILPNMSDENGIPINRRCRLLKMEMYQDLLPVPLNWKTLGSSR
                     LTYRDNIKFKCYYRKSDSDGWEEYKSVSYFLEKDMQLKFELEVLNPNELSSLYPLNAK
                     FIKNNHGKEALQNEENGLTDTKVRQIDKPTDMYQSSIVLDFPEGTAYRGLHTMEVSLS
                     PKSNLNVVIYSDIIGVFIK"
     repeat_region   296810..299190
                     /rpt_family="IS66"
                     /note="NB10_ISVa5 (2.381 bp; complete); three-orf
                     IS-element"
     CDS             296890..297207
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0236"
                     /product="transposase, ISVa5 (orfA; IS66-family)"
                     /note="user locus_tag: VANGcII0236"
                     /note="Transposase, ISVa5 (IS66-family; 105aa)"
                     /protein_id="CDQ48133.1"
                     /translation="MAKRRTNLEWQSLFEQYESSSVTQRAFCEEHGLSLSTFFAKRRQ
                     LQTVNQSEFVGFVKAEIVEKTTKYQAQIATANMTLLINDVELSIPQGTPATYLAELIG
                     ALS"
     CDS             297204..297557
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0237"
                     /product="transposase, ISVa5 (orfB; IS66-family)"
                     /note="user locus_tag: VANGcII0237"
                     /note="Transposase, ISVa5 (IS66-family; 117aa)"
                     /protein_id="CDQ48134.1"
                     /translation="MKGMLSAPDIYLYRESVDFRKSINGLAAIIENDTDLPLGSGALF
                     LFTNKQRDKIKVLYWDKTGFALWYKRLEKAKYKWPSKEKNQVFTLTQFELDRLLSGFT
                     IIGHEPVKINDFTMS"
     CDS             297617..299158
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0238"
                     /product="transposase, ISVa5 (orfC; IS66-family)"
                     /note="user locus_tag: VANGcII0238"
                     /note="Transposase, ISVa5 (IS66-family; 513aa)"
                     /protein_id="CDQ48135.1"
                     /translation="MEKTPNINPESQDIAELQAMVKALMLSQEQKESQWQQERQSLLE
                     QLKLAFDRQFAKRSEALKPYDESQGDLFNEAECEAVKEEEVEVTTTITTKKRGKRKPL
                     PKTLPREVIELDLDDHEKQCSCCNHGLHKIGEDRSEKLEFTPAVLKVLEYVRPKYACR
                     QCEKTGDSSHIVQKPSPQSLIPKSFATESLLANIILGKYQYAMPLYRQESLFTQSGIE
                     LSRTTMARWVIQVSEKFAPLYAALKKYLLQQVVVQADETPLNVLKEEKKCYMWLYCSG
                     ADSPEAALPNVKNIALYDYQNSRARACPIAFLGDYNGYLQTDGYAAYDGLHQVTNVGC
                     LAHARRKFMDAKKLQGKGKSGKADKALAKIQKLYGIESRLKGAPAEERKAERQALAKP
                     ILDELYQWMTTQKVIGSSPLGKAIKYTLGQWSKLTRYIDDGHLSIDNNRAERAIKPLV
                     IGRKNWLFSNTPNGADASAMLYSIIETAKANGLILYDYLVKCMKELAKAEPDIDALLP
                     WNFKH"
     CDS             complement(299783..300820)
                     /transl_table=11
                     /gene="rsgA2"
                     /locus_tag="VANGNB10_cII0239c"
                     /old_locus_tag="TVA2875"
                     /product="Putative ribosome biogenesis GTPase RsgA2"
                     /note="user locus_tag: VANGcII0239c"
                     /protein_id="CDQ48136.1"
                     /translation="MNAPSLLELGMRPFFQQQLSLEELENGSLGRIIEHHKSEVVLMS
                     DNGTLRLNLPPKLEAVCVGDWVVFDHERILRVLERQSLFQRKAAGSTLKRQLIAANID
                     CVFIVSSFNEDFSLNRIERYLALANEAGAQAVIVLTKADLCPDPDDIREQVQKLDPLL
                     SVHCVNALDSQDVSVLENYCQKGKTIAFLGSSGVGKSTLVNSLLGRHEMETGHIREQD
                     SKGRHTTTHRAIKWLPRGGLLMDTPGMRELQLSDVKEGIQLTFADIESLASQCRFSDC
                     LHENEPCCAVREAVERGELSSRRLNNYKKLLREEAHNSATLAERRAKDRAFTKMVSSV
                     QEKARSAKKFR"
     misc_feature    complement(299897..300736)
                     /note="HMMPfam hit to PF03193, DUF258, score 4.3e-117"
     misc_feature    complement(300230..300253)
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
     CDS             complement(300830..301081)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0240c"
                     /old_locus_tag="TVA2874"
                     /product="putative acetyltransferase-fragment"
                     /note="user locus_tag: VANGcII0240c"
                     /protein_id="CDQ48137.1"
                     /translation="MKYALYKQEQTQEIITLFNDTFSDSEGKEEGALIAKLVEDFLTL
                     PTQDDDLYVFIAQSLVGGVIPHVAGKPTCLPALDNPYYW"
     CDS             complement(301086..302267)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0241c"
                     /old_locus_tag="TVA2873"
                     /product="putative transcriptional regulator"
                     /note="user locus_tag: VANGcII0241c"
                     /protein_id="CDQ48138.1"
                     /translation="MYLISELASKAGISRTTLLYYEKLGLINGQRLDNGYRYYSENDS
                     QRLFLIQQLQSAGLSLKECEQCLDAKLSRSLLENRLTQLNHEIDKKIHARELLLALLG
                     ERPQRELHHSLSQSAPSAYLNWLSTQGYSEKEALRLKWLSKDMNEHESYMKDFMTVFA
                     TLERWGPGSHKDSLKAISLMSPQTMTDILDIGCGTGTSTLLLAGNSTAHITAVDNEPI
                     AIEQLNKKIQNAQLHERISPVCASMTELPFQAKSFDAIWAEGCVYIMGMENALKQWKP
                     LLKDNGVLMVSDLVWLTDSPNEETKQYWLADYPDIQSIPKRLALFKKHGYDVIEHFSL
                     GVDAWQNYWQPLQDRVEELQAVMPASQALLDINKEISIYQRFATKDFTYQYFILKLAK
                     R"
     misc_feature    complement(301410..301703)
                     /note="HMMPfam hit to PF08241, Methyltransf_11, score
                     2.7e-17"
     misc_feature    complement(302151..302261)
                     /note="HMMPfam hit to PF00376, MerR, score 7.8e-10"
     misc_feature    complement(302199..302264)
                     /note="Predicted helix-turn-helix motif with score
                     1355.000, SD 3.80 at aa 2-23, sequence
                     YLISELASKAGISRTTLLYYEK"
     CDS             302816..304516
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0242"
                     /old_locus_tag="TVA2872"
                     /product="Putative methyl-accepting chemotaxis protein"
                     /note="user locus_tag: VANGcII0242"
                     /protein_id="CDQ48139.1"
                     /translation="MQWIKDLSITQKMISLITLMLCLIVGVASFSAVKMNRIALEIEE
                     IADESIPLIRLTSDITIKQLESSIVLEKAFRLAKIPVEGNSQALKDLTQKTENIAKVL
                     ESELTQAKQILSDAKKHRQAKGVDQESQNRYQTFEALERSYHQYEVALFQLLKRLNSN
                     EPVEQLAPQVLVLEKMQEAFNTEIEHFLRDLEQKTATSILITEDEEHRALQGTITLAV
                     VSIIFGLVMGTLLSRQIVRSVLKVRNIAAKMANGHFDQHIVPESKDEIGQLTQSMNTM
                     ADSLSKTVGEVIQRANSIAGLVTELNVLAENNRKAMLVQQESTQQVAAAMEQMASTIT
                     EVASNAEGAAESTTRADNSVKAACETTDVTQKISHQLVINAANSQKMILELQDSTHKI
                     QNFVSVVDSISEQTNLLALNAAIEAARAGEQGRGFAVVADEVRALASRSQEATHEISS
                     LIQVLVNKAQIAAKSIEDNDQQISESSTLVDSAKAQLYSIAGALDELMQSNLQVASAS
                     EQQAVSAEEVSQNLLGIRDSGDKVLVSTEETANASNDLSQQANDLKALMSQFSVRKLA
                     "
     misc_feature    302816..302908
                     /note="Signal peptide predicted for TVA2872 by SignalP 2.0
                     HMM (Signal peptide probability 0.988) with cleavage site
                     probability 0.711 between residues 31 and 32"
     misc_feature    302852..302911
                     /note="1 probable transmembrane helix predicted for
                     TVA2872 by TMHMM2.0 at aa 13-32"
     misc_feature    303452..303661
                     /note="HMMPfam hit to PF00672, HAMP, score 1.7e-16"
     misc_feature    303758..304504
                     /note="HMMPfam hit to PF00015, MCPsignal, score 8.3e-61"
     CDS             complement(304584..305414)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0243c"
                     /old_locus_tag="TVA2871"
                     /product="Membrane protein TerC, possibly involved in
                     tellurium resistance"
                     /note="user locus_tag: VANGcII0243c"
                     /protein_id="CDQ48140.1"
                     /translation="MLELFLLPETWAIFATLLALEVVLGVDNVVFISVLCERLPVQQR
                     PLARNLGILLAVIARIGLVFSISWLMSLTAPIVVWFSNELSGRDFILIFGGAFLLFKA
                     AKELWNWLMPDEHSHTTTVSAGLAVVLLQIVAVDAVFSMDSVITAVGLTNDIPIMVAA
                     ILASAVIMILTAARINALVTRYPGFKTLALLFLMMLGGLLIAEGVELHINKGYVYFAM
                     AFGLAMEICHIQWAKKQAIQIKQLRPLKLYTSTSKLHTSKPYSLKRPMPLLRSKSSAH
                     "
     misc_feature    complement(join(304722..304781,304809..304862,
                     304881..304949,304977..305045,305082..305150,
                     305193..305261,305319..305387))
                     /note="7 probable transmembrane helices predicted for
                     TVA2871 by TMHMM2.0 at aa 10-32, 52-74, 89-111,
                     124-146,156-178, 185-202 and 212-231"
     misc_feature    complement(305049..305378)
                     /note="HMMPfam hit to PF03741, TerC, score 1.4e-31"
     CDS             complement(305681..306403)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0244c"
                     /old_locus_tag="TVA2870"
                     /product="Putative ParB-like nuclease"
                     /note="user locus_tag: VANGcII0244c"
                     /protein_id="CDQ48141.1"
                     /translation="MLSKGWILLAAAIISQGAWALAPCGPDSGIGDWCSLDINQLHPT
                     QAGVGQQQVDKTQAKLATKSPAQLKKYMKKKKIPVIVDADGQYWLVDRHHLTKALWQQ
                     GVKEVTVHILAHLDNKENFWQDMQGNHWTWLRDEKGAPLTPDQLPVHISKLPDYPYRS
                     LAGELQDAGYYSKHEQVYFVEFAWASWLGEQMNWVLVNASTLPERLEQAAQLACSSAA
                     KALPGYPGEQCSTMRHLINTAN"
     misc_feature    complement(305831..306310)
                     /note="HMMPfam hit to PF08857, ParBc_2, score 4.5e-56"
     misc_feature    complement(306344..306403)
                     /note="Signal peptide predicted for TVA2870 by SignalP 2.0
                     HMM (Signal peptide probability 0.997) with cleavage site
                     probability 0.986 between residues 20 and 21"
     CDS             complement(306904..307488)
                     /transl_table=11
                     /gene="mdaB"
                     /locus_tag="VANGNB10_cII0245c"
                     /old_locus_tag="TVA2869"
                     /product="modulator of drug activity B"
                     /note="user locus_tag: VANGcII0245c"
                     /note="Similar to Escherichia coli O157:H7 mdab recname:
                     full=modulator of drug activity b UniProt:P0AEY7
                     (EMBL:AE005174) (193 aa) fasta scores: E()=1.1e-57, 65.6%
                     id in 192 aa"
                     /protein_id="CDQ48142.1"
                     /translation="MSNILIVNGGKQFAHSAGALNNSLVELAESYLTELNHDVKVSEV
                     DTGYDIETEIEKWLWSDVVIHQNPAWWMGIPWIVKKYIDDVFTIGHGRLYQSDGRTRS
                     DSNKNYGSGGLIQGKKYMLSVTWNAPQEAFTDPSQFFEGVGVDGVYLPFHKAHQFLGM
                     SPLRTFMCNDVIKNPQIENDFERYKAHLKEVFSS"
     misc_feature    complement(306910..307485)
                     /note="HMMPfam hit to PF02525, Flavodoxin_2, score 1e-65"
     CDS             complement(307490..308290)
                     /transl_table=11
                     /gene="dkgB"
                     /gene_synonym="yafB"
                     /locus_tag="VANGNB10_cII0246c"
                     /old_locus_tag="TVA2868"
                     /product="2,5-diketo-D-gluconate reductase B"
                     /EC_number="1.1.1.274"
                     /note="user locus_tag: VANGcII0246c"
                     /note="Similar to Escherichia coli (strain K12) dkgb
                     recname: full=2,5-diketo-d-gluconic acid reductase b
                     short=2,5-dkg reductase b short=2,5-dkgr b short=25dkgr-b
                     ec=1.1.1.274 altname: full=akr5d UniProt:P30863
                     (EMBL:AP009048) (267 aa) fasta scores: E()=1.5e-66, 65.2%
                     id in 267 aa"
                     /protein_id="CDQ48143.1"
                     /translation="MTVPSFGVGTFRLEGEVVKNSVLNALEVGYRVIDTAQIYGNEVS
                     IGEALVESGIPREELYITTKIWVDNMSKAKLIPSLKESLEKLQTDYVDLTLIHWPGKN
                     ENVEEYMQALLEAKSLGLTKEIGVSNFNIELLDKAFDAVGKENIATNQIELSPYLQNQ
                     KLVSYMLEKGIKVTSYMTLAYGEVLKEPLIIDIAGKYKVTPAQIVLAWALAKEFAVIP
                     SSTKRENLISNLQAQQIQLTSEDLDLIDGLERNGRQVSPDGLAPKWDD"
     misc_feature    complement(307541..308290)
                     /note="HMMPfam hit to PF00248, Aldo_ket_red, score
                     3.3e-86"
     misc_feature    complement(307904..307957)
                     /note="PS00062 Aldo/keto reductase family signature 2."
     CDS             308401..309306
                     /transl_table=11
                     /gene="yafC"
                     /locus_tag="VANGNB10_cII0247"
                     /old_locus_tag="TVA2867"
                     /product="Putative LysR-family transcriptional regulator"
                     /note="user locus_tag: VANGcII0247"
                     /note="Bare on Vibrio blant refs"
                     /protein_id="CDQ48144.1"
                     /translation="MKSTLDEMKALVAVVDTGTVRGAAEILSVTPAAVSRTISRLETK
                     LETTLLSRTTRRLSVTSEGRGYLKRVRRILEDVDLAEERLRIQKDKPSGLLRINAATP
                     FAIHGLAPCISHYQALYPDVEIELNTSEENIDLVGKQTDIAIRIGELKDSTLRAVFLG
                     SSRIRIVASPEYLEEFGAPSRIDELSSHRLLGFRKPEILKNWPLMDENDKVFKATSNL
                     RADNGEVIRHLALSGAGIACLSDFMTYRDRKNGSLVELFKDSSLRIEQPIHAIYYKNS
                     ATSLRISSFIEFIKSNLKIDNNEFM"
     misc_feature    308413..308592
                     /note="HMMPfam hit to PF00126, HTH_1, score 8.5e-16"
     misc_feature    308452..308517
                     /note="Predicted helix-turn-helix motif with score
                     1225.000, SD 3.36 at aa 18-39, sequence
                     GTVRGAAEILSVTPAAVSRTIS"
     misc_feature    308455..308547
                     /note="PS00044 Bacterial regulatory proteins, lysR family
                     signature."
     misc_feature    308662..309282
                     /note="HMMPfam hit to PF03466, LysR_substrate, score
                     6.9e-38"
     misc_feature    309082..309114
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
     CDS             complement(310017..310970)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0248c"
                     /old_locus_tag="TVA2866"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0248c"
                     /protein_id="CDQ48145.1"
                     /translation="MMQLHNEPNLIGLPSEFNAVYTLGEMGGRPQLKMTVNGQPITFN
                     IFYAHIHRKESIKSYLKRRPKANDILFCNHLSDYLRQLCHDSNINYADDSGNVRVMTG
                     DICIFIGNRPPIKQNKSHQFMTIGIMKCLFALFAEKDLINETYANIASKADISVGMVT
                     KAMKYLIENNHIAKSKRQRRFLNEPELRYEWLKSYGHILARYHQVTTYPPVDNWKDIL
                     LQPGDVWGGEVAATQLTKYNHPHELLLFSRHQPVKYSIGHKELPPLKVIKPFWGKSLK
                     IGQPALALLTIAELLLSKDARNREVAYLINDKYGEFNTLPL"
     CDS             complement(311827..312819)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0249c"
                     /old_locus_tag="TVA2865"
                     /product="membrane protein (function unknown)"
                     /note="user locus_tag: VANGcII0249c"
                     /protein_id="CDQ48146.1"
                     /translation="MYHSAANPIIRVAVFPVLLLFWQYVYGTDLPLLAPAMCAVFLTT
                     THEPPPVIMVFVMGGILFITAWFQALMSELLIDYVHVYYLFLFGIFYWCMERTKKNSQ
                     DVFAILLIVSTAMIAVFTQQKGISVEQIPMALLKNIFIAGFTAYLAYLLFPRGEPLAI
                     SMPPVNSTTKYLLDWQTLLKAIIVMTMMVCTIQLDLEQSTIITIIVALMIKDPDPSIG
                     KDYGLRRLLTTYASVLYAIPPLIMSLLQVNLVGTVGVAVVSALFMGIHAVTKKASYNS
                     IQLMYSSYVVLVFYGITSTSISAISDDLVRFTSVFAAVLIGIMSLIILYPRTRT"
     misc_feature    complement(join(311842..311910,311920..311979,
                     312016..312075,312085..312144,312364..312432,
                     312460..312510,312544..312597,312607..312675,
                     312694..312762))
                     /note="9 probable transmembrane helices predicted for
                     TVA2865 by TMHMM2.0 at aa 20-42, 49-71, 75-92,
                     104-120,130-152, 226-245, 249-268, 281-300 and 304-326"
     CDS             complement(312809..313915)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0250c"
                     /old_locus_tag="TVA2864"
                     /product="Secretion protein HlyD family protein (putative
                     multidrug resistance protein A)"
                     /note="user locus_tag: VANGcII0250c"
                     /protein_id="CDQ48147.1"
                     /translation="MSDNNVQTSAEQSDKKISQARSFTYYIFALVAALWLYTLWADRM
                     TPMTDQARVNGQLIRISPEVSGPISQVLITNNSIVKAGDELVTIDPRPFELAVKAAKF
                     DLQQAAQSYEADSAAISVAQANEVAARVKVNNAKKNVERNRVLANKGTISQAVMDNII
                     AELDTAQAGLAQASSALEKAKQEFGPRGIDNPEIQSVLNRQEQALLNLNHTKLTAPAN
                     GVITNMDVAVGDYAAAGQPLLTFINNNNLWLTAMVRENSLAHLKPGDKVKIVFDANPG
                     EVYEGKISSIGWGSSGNGSLAQDASNGLMTSPTSSSKAQRFPVNIEFTSLPADLNLRY
                     GGRAVVGFYPDESYLGERLQDLWIWAWSYISYVS"
     misc_feature    complement(312896..313750)
                     /note="HMMPfam hit to PF00529, HlyD, score 4.1e-22"
     misc_feature    complement(313793..313852)
                     /note="1 probable transmembrane helix predicted for
                     TVA2864 by TMHMM2.0 at aa 22-41"
     CDS             complement(313935..314429)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0251c"
                     /old_locus_tag="TVA2863"
                     /product="putative uncharacterized membrane protein"
                     /note="user locus_tag: VANGcII0251c"
                     /protein_id="CDQ48148.1"
                     /translation="MDIKVKDSLIGGVINGVINGYIASHHFKGMDSVPMSLNVITNSE
                     VTVWGQAVSLTFGLGIILSLITSKLFIHQLNKSHPQHISQLQSGFWSHLVPIAVTHAA
                     ALFGWFVAIAVIWTKYAGEVMVSSSSAVALVGLFAFIITIAVEVRTKKSIIYKKINLL
                     EQPQ"
     misc_feature    complement(join(313998..314066,314085..314153,
                     314229..314297))
                     /note="3 probable transmembrane helices predicted for
                     TVA2863 by TMHMM2.0 at aa 45-67, 93-115 and 122-144"
     CDS             314576..315256
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0252"
                     /old_locus_tag="TVA2862"
                     /product="ion transport 2 domain protein"
                     /note="user locus_tag: VANGcII0252"
                     /protein_id="CDQ48149.1"
                     /translation="MKLDKALSNISEKNNFIYLTLALIMLLIAAALVQLLQDNVIEYV
                     IQGIMVVIFIVCFVSLRFDRKWTHFLRGLAVVWIAAIAAKHIFNIKEMSILMLSLTFV
                     FFSGTFQSLVRKILFSGQIDTNKLIGSVALFLLLGLMWAVAYLLLLELDPFAFRGLEA
                     IPWEDNFSHSAYFSFVTLTTLGYGDISPVTPIAKTLVYLESVVGVFYMAVVVSSLVSS
                     NLGRNTPR"
     misc_feature    314576..314674
                     /note="Signal peptide predicted for TVA2862 by SignalP 2.0
                     HMM (Signal peptide probability 0.980) with cleavage site
                     probability 0.474 between residues 33 and 34"
     misc_feature    join(314621..314674,314702..314755,314774..314842,
                     314855..314914,314951..315019,315161..315229)
                     /note="6 probable transmembrane helices predicted for
                     TVA2862 by TMHMM2.0 at aa 16-33, 43-60, 67-89,
                     94-113,126-148 and 196-218"
     misc_feature    314969..315238
                     /note="HMMPfam hit to PF07885, Ion_trans_2, score 2.5e-16"
     CDS             complement(315574..318453)
                     /transl_table=11
                     /gene="gcvP"
                     /locus_tag="VANGNB10_cII0253c"
                     /old_locus_tag="TVA2861"
                     /product="glycine dehydrogenase (decarboxylating)"
                     /EC_number="1.4.4.2"
                     /note="user locus_tag: VANGcII0253c"
                     /protein_id="CDQ48150.1"
                     /translation="MTELLHSPLLSQLSTKNEFVARHNGPNSADQQKMLNVINAESLA
                     ALIEQTVPAQIRLESPMSLAAPKSEADMLSAMKVFANQNQIKRTFIGQGYYNTFTPNV
                     ILRNVLENPGWYTAYTPYQPEISQGRLESLLNYQQMVMDLTAMDIANASLLDEATAAG
                     EAMTLCKRAGKSKSNVFFVADDVHPQTIEVVKTRAEFIGFEVQIGALDSLPEQDVFGA
                     LLQYPSTTGEVRDLSDLIAKAQANKILVTVATDLLASTLLKPAGEMGADVVIGSAQRF
                     GVPMGYGGPHAAFMATREAHKRTMPGRVIGVSIDAKGNPALRMAMQTREQHIRREKAT
                     SNICTAQALLANMASFYAVYHGAEGLRTIARRTHHMTAILAAGLTQAGYELVHNSFFD
                     TITLKSATQTQALYAKAQQADINLRRFDDQLGISLDETTTTADLETLFAVFDIKQSVS
                     ALSAEIAANEFAAIPEHCRRQSRFLTHPVFNTYHSETQMMRYLKKLENKDFSLTHGMI
                     PLGSCTMKLNAAAEMIPVTWPQFGSIHPFAPKEQAAGYAALAKDLKEKLCEITGYDAF
                     SLQPNSGASGEYAGLVAIQRYHKSRGEGHRNVCLIPSSAHGTNPATASMVSMKVVVVK
                     CDNNGNVDIADLADKIEKHKENLSSIMITYPSTHGVYEEQVKEVCNMVHAAGGQVYLD
                     GANMNAQVGLTNPGFIGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKSHLAPFLPGHIE
                     GGVEGSDHAVSAADLGSASILPISWAYIAMMGAEGLTTATQVAILNANYVMERLRPHY
                     PILYRGNNGRVAHECIIDIRPLKEATGISEEDIAKRLMDYGFHAPTMSFPVAGTLMIE
                     PTESEDLAELDRFCEAMIAIRAEMEKVQSGEWPLADNPLVNAPHTQSDLASEAWAHPY
                     SRETACFPSAHTKASKYWPTVSRVDNVYGDRNLVCSCPSIDNYQE"
     misc_feature    complement(317125..318393)
                     /note="HMMPfam hit to PF02347, GDC-P, score 1.6e-245"
     CDS             complement(318535..318915)
                     /transl_table=11
                     /gene="gcvH"
                     /locus_tag="VANGNB10_cII0254c"
                     /old_locus_tag="TVA2860"
                     /product="glycine cleavage system H protein"
                     /note="user locus_tag: VANGcII0254c"
                     /note="Similar to Vibrio parahaemolyticus serotype O3:K6
                     (strain RIMD 2210633) gcvh recname: full=glycine cleavage
                     system h protein UniProt:Q87I04 (126 aa) fasta scores:
                     E()=3.7e-42, 84.9% id in 126 aa"
                     /protein_id="CDQ48151.1"
                     /translation="MDNTLKFADSHEWVRDNGDGTVTIGISEHAQEMLGDVVFVDLPE
                     VDTEIDAGDSFSLVESVKAASDIYAPITGVIVEINEELEDSPELINEEPYEGGWIVKV
                     KMSDASELDNLKNAEEYQNSIEED"
     misc_feature    complement(318538..318903)
                     /note="HMMPfam hit to PF01597, GCV_H, score 2.8e-70"
     CDS             complement(318973..320280)
                     /transl_table=11
                     /gene="glyA2"
                     /locus_tag="VANGNB10_cII0255c"
                     /old_locus_tag="TVA2859"
                     /product="serine hydroxymethyltransferase 2"
                     /EC_number="2.1.2.1"
                     /note="user locus_tag: VANGcII0255c"
                     /note="Similar to Vibrio parahaemolyticus glya2 recname:
                     full=serine hydroxymethyltransferase 2 short=serine
                     methylase 2 short=shmt 2 ec=2.1.2.1 UniProt:Q87I03
                     (EMBL:BA000032) (431 aa) fasta scores: E()=1.3e-160, 90.0%
                     id in 431 aa"
                     /protein_id="CDQ48152.1"
                     /translation="MNANVNKSYPNHCLESFFSTNLAATDDAVFAGIQAEYVRQNEQI
                     ELIASENIVSKAVMQAQGTCLTNKYAEGYPGRRYYGGCEHVDTVETIAIERAKSLFHC
                     QYANVQPHSGAQANGAVMLALLQPGDTILGMSLDAGGHLTHGARPALSGKWFNAIQYG
                     VDSTTLEINYDDVRSLALEHQPKMIIAGGSAIPRVIDFAKFRAIADEVGALLMVDMAH
                     IAGLVATGAHPSPLPHAHVVTTTTHKTLRGPRGGMVLTNSEEISKKINSAAFPGLQGG
                     PLMHVIAAKAVALGEALGPEFHRYIDSVIDNAKVLAEVLQTRGCDIVTGGTDTHLMLV
                     DLRPKGLKGNIAEQALERAGITCNKNGIPFDTEKPMITSGIRLGTPAGTSRGFGREEF
                     KLIGEWIGDVLDGLVVSPEGNSDVEQRVRKQVKALCQRFPLYQ"
     misc_feature    complement(319084..320217)
                     /note="HMMPfam hit to PF00464, SHMT, score 9.4e-253"
     misc_feature    complement(319525..319575)
                     /note="PS00096 Serine hydroxymethyltransferase
                     pyridoxal-phosphate attachment site."
     misc_feature    complement(319813..319851)
                     /note="PS00213 Lipocalin signature."
     CDS             320673..321296
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0256"
                     /old_locus_tag="TVA2858"
                     /product="putative DNA-binding (regulator) protein"
                     /note="user locus_tag: VANGcII0256"
                     /protein_id="CDQ48153.1"
                     /translation="MSEDIYDEYPSLTLAKEIGEQTIEPLKLGQRIKEIRSKLGITLE
                     EASQRTGLARSTLSKIENEQISPTYQAMQKLAHGLQIDMPQLFEPPKKIVATGRRDIS
                     RIGQGKPHPTPTYEHELLATQLSNKKMMPFKSRVRARAFEEYSDWVRHDGEEFLLILT
                     GEVLFYSEFYEPVLLAEGDSVYYDANMGHMLVSVSEEDALILWVTAK"
     misc_feature    320766..320930
                     /note="HMMPfam hit to PF01381, HTH_3, score 1.5e-13"
     misc_feature    320793..320858
                     /note="Predicted helix-turn-helix motif with score
                     1909.000, SD 5.69 at aa 41-62, sequence
                     ITLEEASQRTGLARSTLSKIEN"
     misc_feature    321066..321287
                     /note="HMMPfam hit to PF07883, Cupin_2, score 1.3e-07"
     CDS             321588..322721
                     /transl_table=11
                     /gene="gcvT"
                     /locus_tag="VANGNB10_cII0257"
                     /old_locus_tag="TVA2857"
                     /product="glycine cleavage system T protein"
                     /EC_number="2.1.2.10"
                     /note="user locus_tag: VANGcII0257"
                     /protein_id="CDQ48154.1"
                     /translation="MTQEHANQTLLTTPLHALHIEVGAKMVPFAGYDMPVQYPLGVKK
                     EHLHTREAAGLFDVSHMGQLRLHGANAAQALESLVPVDIIDLPAGKQRYAFFTNAQGG
                     IMDDLMVANLDDHLFVVVNAACKAQDIAHLQAHLPQGVELEVIDDRALLALQGPKAAE
                     VLTRLQPQVMTMHFMDIQLMDIDGAQCIVSRSGYTGEDGYEISVPAEQAEALARKLTA
                     YEEVEWIGLGARDSLRLECGLCLYGHDLDTTTTPVEASLLWAISKVRRAEGERAGGFP
                     GADIILGQIESKDVARKRVGLVGLTKAPVREGTELFAADGQHIGVVTSGTAGPTAGKP
                     VSMAYIRADLSAIGTEIFADVRGKMLPMVVEKMPFVAQRYYRG"
     misc_feature    321750..322367
                     /note="HMMPfam hit to PF01571, GCV_T, score 1.3e-91"
     misc_feature    322404..322688
                     /note="HMMPfam hit to PF08669, GCV_T_C, score 8.4e-24"
     CDS             322814..323788
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0258"
                     /old_locus_tag="TVA2856"
                     /product="Putative exported serine protease, trypsin
                     elastase"
                     /note="user locus_tag: VANGcII0258"
                     /protein_id="CDQ48155.1"
                     /translation="MMNKWVVLLSSLAFSGNVFAVDAQPYIVNGTDASVTEFPSIASL
                     FFDQIAYNGSYGKGSYCGASLLNNQYVLTAAHCVYGNSAYQLFTSVVPKLQIETNFPF
                     NILEKARVAEIYYPSTYNNTTLLDDIAILKLETPLTIVSSADYLTRPTTNLDSTYRSL
                     SETFIAVGHGNTSSNIDTKTYLQKTNLAYVANSSCIYSSTAVPDTNLCMSGSISALTS
                     LKNATCQGDSGGPLFWHNGGNYIQVGITSFGPNTKCGDPLITAPSVFTEILDYSTWIE
                     SVLLGSEPPKFVATEAKRQAYLNPPSDSGGSFGWWSLLLMFIPFIRRR"
     misc_feature    322814..322873
                     /note="Signal peptide predicted for TVA2856 by SignalP 2.0
                     HMM (Signal peptide probability 1.000) with cleavage site
                     probability 0.999 between residues 20 and 21"
     misc_feature    322892..323638
                     /note="HMMPfam hit to PF00089, Trypsin, score 2.3e-38"
     misc_feature    323477..323512
                     /note="PS00135 Serine proteases, trypsin family, serine
                     active site."
     CDS             323917..325011
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0259"
                     /old_locus_tag="tva2855b"
                     /product="putative trypsin-like serine protease (peptidase
                     S1)"
                     /note="user locus_tag: VANGcII0259"
                     /note="Contains a trypsin-like cystein/serine peptidase
                     domain (IPR001254, IPR009003)"
                     /protein_id="CDQ48156.1"
                     /translation="MYKWILFSAMLSANAYAVDFQPYIVNGSDTSSATYPSFASLLYQ
                     SSTQSSSNSFCGASIINSQFILTAAHCIYGKKDTMLYTVVVPQLDNVADFPYGNIQIS
                     RAAAFYYPSTYINSSSALWRDDIAIIKLETPLNVADYSALLNTQLNNDYPAGNNYKAI
                     GHGYVAGNVPNANKQLQETTLTFVSNAVCSAFYGPTLTSKQICFDGAVSGAYKNSTCS
                     GDSGGPVYWFNGSQYIQIGLTSFGPSLCGDTNQPITSVFTELYDYQSWIQRVLTGAEA
                     PKYYVATQNGVRVLIDTQTVAPQEESGGSLSILGLTLLLLFRFRAHNNFGSSVVVIKN
                     LLGSQRHLLCGDSVCRLLYVKQRIDAVPVQ"
     CDS             complement(324862..327624)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0260c"
                     /old_locus_tag="TVA2855"
                     /product="Putative zinc protease (LuxS/M16
                     peptidase-like)"
                     /note="user locus_tag: VANGcII0260c"
                     /protein_id="CDQ48157.1"
                     /translation="MKIYRLLFVSCLFLLGCASNQAFTPIKEDPYWASAELANGMKYH
                     IYPNQKEPVSIRLIVHAAAFQENNQQQGYAHFLEHMAFNGSAHYAGNDAIKTFEQSGV
                     SFGPDINAYTAYQETVYKLDLPDNQAVEPALVWFRDIADGIELTPTSVENEKRVIMGE
                     FRFSRKEEKSYAQNVYEHMIANTLYAQHDPLGTKESVNQATAEGIADFYRTWYQPQLT
                     EIVIAGNITLEQATALIEKHFASWEKGSTPMPTRNHSITANNTDFVGYIGANDSPNIS
                     LFIDRGEQKIASREQQAQWWLDDIAQQLIQQRLSSNFSDANLPALWIYSQTIPFETQR
                     YSFAEVGFPVDSREASQNLFFSTLAALRDHGVSEQEFQAIFRQYQEMLANFDNNWQKA
                     TAIDLVEEKTLARTLDQPIQSHLDRRSTLTEFISTTNSAMLDKHLRKLLSSDYQINIG
                     LDKSEDKELVVATLPTLKTLFAQKGQPPLLQEVNQAFVTPTQIGAILSESQPQESMDI
                     TTWMLSNGVEVWYRRDTNAGEKVYASLASLGGKASLEPDLRKASEVLIPSAIRGGIGN
                     FSGSQLDNHLRRHGIILNPYIDFTSHGISLESFKDELAEAFAALYTAMTAINIDDSHL
                     QLTKQEFKQNRDTFLRSPIGQMALAINRNSYLPNTTHWLYEGSDINTVSVEQLMQTHD
                     DLFKKNRGFKLFITADIKPAELKPLLRTYVASLTFSSAPEVDYRIDYRADFQPRIDMA
                     INDEKSSAYLARVISNDPEHKSATTIFMDDMLWRVANRRMVSQVREQLGLDYAPNAFS
                     VSADSEPHNDWLFSVDISSNDVDTAEQAIDKLIDGLSVEITEEETLTAAKQLIADLKP
                     LKDDPKQMNWFIQRYSLHGYGIDALFNIEQTANRITAQEMTLRAKQIFNHHNRRTKII
                     MRPKAK"
     misc_feature    complement(325075..325614)
                     /note="HMMPfam hit to PF05193, Peptidase_M16_C, score
                     5.5e-12"
     misc_feature    complement(326491..327030)
                     /note="HMMPfam hit to PF05193, Peptidase_M16_C, score
                     1.8e-14"
     misc_feature    complement(327244..327468)
                     /note="HMMPfam hit to PF00675, Peptidase_M16, score
                     4.3e-16"
     CDS             complement(327910..328593)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0261c"
                     /old_locus_tag="TVA2854"
                     /product="inner membrane protein"
                     /note="user locus_tag: VANGcII0261c"
                     /protein_id="CDQ48158.1"
                     /translation="MNTFLSIFSALWHQDLFALQQVDLSLLYLCIGLLIFVESAFIPA
                     APLPCDSVIVLCGSLAAVGVLNLYAIIGVLVFAGWLGSAIAFYQGHQLKEWRLVSTWL
                     NKVSEKQWRTTDNLIQRYGLLAMFMGRFLPVVRSLLPMVMGLRNAVTPTRFLLVSPLS
                     ALAWILFLVGSGLGISLLPDKLAKIANHALILAPLMTLLIAISTVLVGWLMRKRSLQK
                     APRISEESQ"
     misc_feature    complement(join(327958..328026,328069..328137,
                     328345..328413,328456..328524))
                     /note="4 probable transmembrane helices predicted for
                     TVA2854 by TMHMM2.0 at aa 24-46, 61-83, 153-175 and
                     190-212"
     misc_feature    complement(328072..328431)
                     /note="HMMPfam hit to PF09335, SNARE_assoc, score 0.00025"
     CDS             complement(328647..329024)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0262c"
                     /old_locus_tag="TVA2853"
                     /product="putative uncharacterized (membrane) protein"
                     /note="user locus_tag: VANGcII0262c"
                     /protein_id="CDQ48159.1"
                     /translation="MIQSLMFAFLFSLLSLFSSLNLNATQSFSASESTTIQHVHFSSH
                     LFFVDRDAAILTTRHETPRVSGLRLISDDDEKTSAETTLLSYILSTTAFVVICSLYIG
                     QSTHVFVRKALQFSNLYSRFAHA"
     misc_feature    complement(join(328719..328778,328938..329006))
                     /note="2 probable transmembrane helices predicted for
                     TVA2853 by TMHMM2.0 at aa 7-29 and 83-102"
     misc_feature    complement(328953..329024)
                     /note="Signal peptide predicted for TVA2853 by SignalP 2.0
                     HMM (Signal peptide probability 1.000) with cleavage site
                     probability 0.688 between residues 24 and 25"
     CDS             complement(329166..330908)
                     /transl_table=11
                     /gene="fruA"
                     /locus_tag="VANGNB10_cII0263c"
                     /old_locus_tag="TVA2852"
                     /product="PTS system, fructose-specific IIBC component"
                     /EC_number="2.7.1.69"
                     /note="user locus_tag: VANGcII0263c"
                     /protein_id="CDQ48160.1"
                     /translation="MKIAIITACPSGVANSIIAAGLLEQAAKSLNWTAVVECHSSIIQ
                     GHTLSSSEIDNADVVVIARNTPIDTTRFIGKKVYQSDISACTSDPVTFLNSAISAATI
                     LTEQEAKTVSAPVVTQAAKKIVAITACPTGVAHTFMAAEALENHAKHLGHQIKVETRG
                     SVGAKNQLTAQEIADADLVIIAADIEVPLDRFNGKKLYKTSTGLALKKTEQEITNAFN
                     QASIYTQSSASNNNQTEEKKGVYKHLMTGVSHMLPVVVAGGLIIALSFVFGIEAFKEQ
                     GTLAAALMTIGGGSAFALMIPVMAGFIAFSIADRPGLAPGLIGGMLASSTGAGFLGGI
                     VAGFIAGYAAKFIADKVSLPQSMEALKPILIIPFVASLFTGLVMIYIVGGPVSSIMAA
                     MTEFLNNMGSANAVLLGVILGAMMCFDLGGPINKAAYTFGVGLLASQTYAPMAAIMAA
                     GMVPALGMGLATFLARDKFEAGEREAGKASFVLGLCFISEGAIPFAAKDPMRVIPACM
                     AGGALTGALSMLFGAKLMAPHGGLFVLLIPNAITPVLMYLIAIAAGTAVTGFGYAFLK
                     NRAKASESSTAAAI"
     misc_feature    complement(join(329214..329282,329340..329408,
                     329517..329585,329643..329696,329757..329825,
                     329883..329951,329988..330056,330099..330167))
                     /note="8 probable transmembrane helices predicted for
                     TVA2852 by TMHMM2.0 at aa 248-270, 285-307,
                     320-342,362-384, 405-422, 442-464, 501-523 and 543-565"
     misc_feature    complement(329379..330176)
                     /note="HMMPfam hit to PF02378, PTS_EIIC, score 1.9e-19"
     misc_feature    complement(330240..330545)
                     /note="HMMPfam hit to PF02379, PTS_IIB_fruc, score
                     3.3e-60"
     misc_feature    complement(330600..330905)
                     /note="HMMPfam hit to PF02379, PTS_IIB_fruc, score
                     9.3e-11"
     misc_feature    complement(330852..330908)
                     /note="Signal peptide predicted for TVA2852 by SignalP 2.0
                     HMM (Signal peptide probability 0.687) with cleavage site
                     probability 0.566 between residues 19 and 20"
     CDS             complement(330927..331880)
                     /transl_table=11
                     /gene="fruK"
                     /locus_tag="VANGNB10_cII0264c"
                     /old_locus_tag="TVA2851"
                     /product="1-phosphofructokinase"
                     /EC_number="2.7.1.56"
                     /note="user locus_tag: VANGcII0264c"
                     /protein_id="CDQ48161.1"
                     /translation="MTNKVVTITLNPALDLTGSLDVLNVGSVSLVKQGSLHAAGKGVN
                     VAKVLSDLGAKVTVTGFLGRDNQELFCQLFDQMAAIDEFVRVDGATRINVKLVEQSGE
                     VSDINFPGVEVTPLAIEQFERTLERLAADHDYFVLAGSLPQGISPALCASWIEKLHSM
                     GKKVLFDSSRDALKAGLDAKPWLIKPNDEELSQFVGRELHTPEQCQAAAAQLAEKGIE
                     NIVVSMGANGVMWLNQHQWLHAKPPRMQVVSTVGAGDTLVAGLCWGHMQQMEKTELLT
                     FATALSALAVTQVGVGMSNRKQLETLQQQIQLQPVSLSANS"
     misc_feature    complement(330987..331859)
                     /note="HMMPfam hit to PF00294, PfkB, score 4.8e-55"
     misc_feature    complement(331692..331766)
                     /note="PS00583 pfkB family of carbohydrate kinases
                     signature 1."
     CDS             complement(331891..333033)
                     /transl_table=11
                     /gene="fruB"
                     /locus_tag="VANGNB10_cII0265c"
                     /old_locus_tag="TVA2850"
                     /product="Phosphotransferase system, fructose-specific
                     IIA/FPR component"
                     /note="user locus_tag: VANGcII0265c"
                     /protein_id="CDQ48162.1"
                     /translation="MLQLNSNNITLGQSPTNKQEAIRAIAADLTNKGFVEAGYVDGML
                     NREAQNSTFLGNGIAIPHGTTDTRQLVKQTGIAVHHFPNGVDWGNDATVYVAIGIAAK
                     SDEHLGILKQLTQVLSADGVEEKLKQASSANDVIALLNGEVQFEPDFDASLIQLLFPA
                     SDMVQMSAVAGGLLRNTGCADNEFVAELVTKEPTHLGKGLWLISSDKAVKRTGISFVS
                     TANACEYNQLNVKALIAIAACNNAHQNILDKLTQLVLQQQQETLLNANAAQLLAFFSN
                     DNEQAPAKDESAASKVAVFKIKNAHGLHARPGAMLVAEAKKFEANIKVSNLDGDGKTA
                     NAKSLMKVIALGVKHGHQLQFSAEGPDAEQALESIGKAIASGLGEG"
     misc_feature    complement(331906..332166)
                     /note="HMMPfam hit to PF00381, PTS-HPr, score 2.5e-40"
     misc_feature    complement(331996..332043)
                     /note="PS00589 PTS HPR component serine phosphorylation
                     site signature."
     misc_feature    complement(332107..332130)
                     /note="PS00369 PTS HPR component histidine phosphorylation
                     site signature."
     misc_feature    complement(332608..333030)
                     /note="HMMPfam hit to PF00359, PTS_EIIA_2, score 1.4e-55"
     misc_feature    complement(332845..332895)
                     /note="PS00372 PTS EIIA domains phosphorylation site
                     signature 2."
     CDS             333407..334390
                     /transl_table=11
                     /gene="fruR"
                     /locus_tag="VANGNB10_cII0266"
                     /old_locus_tag="TVA2849"
                     /product="fructose repressor (catabolite
                     repressor/activator)"
                     /note="user locus_tag: VANGcII0266"
                     /note="Similar to Escherichia coli (strain K12) frur
                     recname: full=fructose repressor altname: full=catabolite
                     repressor/activator UniProt:P0ACP1 (EMBL:AP009048) (334
                     aa) fasta scores: E()=2.7e-51, 43.3% id in 330 aa"
                     /protein_id="CDQ48163.1"
                     /translation="MTLDEIAKLAGVSKTTASYVINGKAQKYRISEKTQQKVMAVVDA
                     HNYRPDHAASALRAGNSRSFGLIIPDLENTSYARLAKLLEQNSRQAGYQILIACSDDD
                     PHTEMSVVDALVSRRIDALFVASAIPHASEFYLKLQHSGTPVIAIDRPLDDEFFACVI
                     SEDFNAAFELTHSLLTPEIKTVGLVGALPELNISQERQLGFEAALRAKTVHSVIGYGA
                     HFNREEGKRVVNEWIANNSMPDAIVATSYTLLEGILDVLFENPSLMNRVKLSTFGDNR
                     LLDFLPIKINSLPQQFELIADSALALALNASAKRYQAGIELVPRKLKVRIY"
     misc_feature    333407..333472
                     /note="Predicted helix-turn-helix motif with score
                     1930.000, SD 5.76 at aa 1-22, sequence
                     MTLDEIAKLAGVSKTTASYVIN"
     misc_feature    333407..333484
                     /note="HMMPfam hit to PF00356, LacI, score 5.2e-11"
     misc_feature    333413..333469
                     /note="PS00356 Bacterial regulatory proteins, lacI family
                     signature."
     misc_feature    333587..333931
                     /note="HMMPfam hit to PF00532, Peripla_BP_1, score
                     3.7e-05"
     CDS             334533..335675
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0267"
                     /old_locus_tag="TVA2848"
                     /product="putative exonuclease SbcD"
                     /note="user locus_tag: VANGcII0267"
                     /protein_id="CDQ48164.1"
                     /translation="MKFLHTSDWHLGRQFHNVSLLDDQRAVLNQLIVYLQCNRVDALI
                     IAGDIYDRSVPPTAAIELMDDIVNRVCNELSIPLIMIPGNHDGAKRLGFAAKQMQHSG
                     LHIISNFEQMMQPVVLKSAIAGEVAFYGMPYNDPEVVRHHFGESVTSHDEAHQYLIEK
                     IISQWNPSQRHVMIGHCFVDGAIESDSERPLSIGGSDRVSHQHFVPFDYVALGHLHQP
                     QKKGEEYIRYSGSLMKYSFSEQHHKKGATLVEFDEQGFASATHVPLTAPHSMRIIEGE
                     LLEIIEQGKTDPHNHDYLLVRLTDKHAILDPMEKLRQSYPNVLHLEKPGMLVGVDQAM
                     GRARLARGEVDMFRDFFLEAKQEALTAAQEQAVIDVIQALKPGAQV"
     misc_feature    334533..335186
                     /note="HMMPfam hit to PF00149, Metallophos, score 8.5e-14"
     CDS             335675..338716
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0268"
                     /old_locus_tag="TVA2847"
                     /product="Putative exonuclease SbcC"
                     /note="user locus_tag: VANGcII0268"
                     /protein_id="CDQ48165.1"
                     /translation="MRPIQLTLQAFGPFAHKEVVDFTALGASPLFLINGPTGAGKSSL
                     LDAICYALYGETTGSERTGDQMRCDYADPHTLTEISYQFELGGRIYQVDRSPDQEVPK
                     KRGEGSTKKSHAASLFEWVDGEMKLLANKPNPVGKAMVELIGLDVKQFRQVMVIPQGK
                     FRELLTANSKEREQIFGQLFQTHIYSQIERALFEKAAGIRKAKEEFDHQIKGALDVVN
                     ATSESHLEACIAELSPQLTAAHAAYLDAQQKFDAASSEQKAAQTLAKQFQEQRQLVQL
                     KADHDAQSSVIDAVKAQRHQALQATRLDSPYYELQSSQRQLEAANQEKVEKEQALTQS
                     QQQWQQAKAAQEDAAEKVKIVPNLMQQIYDLNLIKTKLVEREHHQKALQQALSEVELA
                     TQNRHNLRTAVEQFEQQIMLKRQECERVSQQLAELKGQRLELETIKQQIDRLLKLQQL
                     EQRLATEQAALSYSQQQFELAQRATLDAKQQADKLELIWHTNQAAELARTLDQGDECP
                     VCGSCDHPKLARYTGETVTKAQVQQARAIQQNKLATEQEALKQQQLRATQYARLEQEM
                     ASLRESLSGNTQSLVQLQQAQSDLEHSIAHLESLNPEQLAQQLAKLELQLAQAKQNAE
                     TQQHKVEQATLTVAKEQTEVSALSQGIPELYQDSLHLHQSLTQLELQLANLNHLDAET
                     KARFNQANADFSGAKAALAAAVEHQIHWQNAFTQSQQQWHSALIESQFDDTEHYLQAR
                     LSSQQIEQLEKQIKQFDERSTTLNAQLQTLASELSEKSEPNLAEYASAVEAVAMLQQS
                     ALDQWSTLRSKMDALTSVKEKIAILHIKNEALEQEYQVFGTLSDIANGKTGAKVSLHR
                     FVLGVLLDDVLIQASMRLQIMSKGRYLLKRKEDRAKGNVGSGLDLMVEDGYTGKWRDV
                     ATLSGGESFMAALSLALGLSDVVQSYSGGIKLDTLFIDEGFGSLDPESLDLAIQTLVD
                     LQQGGRTIGIISHVSELKEQIALRIDVDVARNNGSSIRLVA"
     misc_feature    335777..335800
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
     CDS             338856..340907
                     /transl_table=11
                     /gene="cqsS"
                     /gene_synonym="luxN?"
                     /locus_tag="VANGNB10_cII0269"
                     /old_locus_tag="TVA2846"
                     /product="sensor protein"
                     /product="CAI-1 autoinducer sensor kinase/phosphatase CqsS
                     (cholerae quorum-sensing sensor)"
                     /EC_number="2.7.13.3"
                     /note="user locus_tag: VANGcII0269"
                     /note="Similar to Vibrio cholerae serotype O1 (strain ATCC
                     39541/Ogawa 395/O395) luxn recname: full=sensor protein
                     ec=2.7.13.3 UniProt:A5F0E8 (EMBL:CP000626) (686 aa) fasta
                     scores: E()=3.3e-148, 56.4% id in 683 aa, and to Vibrio
                     cholerae cqss orderedlocusnames=vc_a0522 UniProt:CAI-1
                     (686 aa) fasta scores: E()=1.8e-126, 56.2% id in 683 aa"
                     /protein_id="CDQ48166.1"
                     /translation="MDVVKKIYQYAEPNLTLVGWMGFIGFPLYYYVWTYLFPQPYESM
                     ELRAICAILFAGIIFRNSTPKHLQHYLPYYYLFSIGFCLPFFFGYMMLMNDWSTIWAM
                     SFMASIFLHILLVHETKVMLIQAAIALACAYFVTYGVMDAELRVMVEWPYVPIFLFTY
                     IFGNLFYFRNQIEHEAKVSIAKSFGAGIAHEMRNPLSALKASIEVMGSVLPNPTASKS
                     ESYTLPSKDLELIAGLLRDADEVIRSGNETIDLLLTSIDQNRVSTSTFKKHAVKPVIE
                     EALRSFSYKRPEDRQAVTLKVVDDFDFLGSSTLLKYVLYNLLKNAFYYQNNDMFNIHI
                     TLKSSENCHQITVKDNGVGIEPHLLDDIFKDFYTFGKNGSYGLGLPFCRKVMHAFGGD
                     IICRSELGEWTEFTLTFPEYDSQAVANIKLDLMKAKSLLYIGKTSIVNRYLSEKSFYL
                     GFQLNVLEPESALRREEFEFEFDLIFVDLQTLDETPDYLTKLEPKLHFTQAKVCYLYD
                     QNQRYALTMERHLTIYPIEKHKLLLDGSAIIDELLFETEELIADKNVIPLKQYDYEKR
                     ILLVDDNHSLRSFTALLLEKQGYEVLQASDGELALQMLANNSIDLVLMDIEMPIMDGI
                     SATLSIRSSTASYSKVPIIGHTGDNSPSTIEKIRTSGMNDYVLKPADKTLLLKKLSHW
                     I"
     misc_feature    join(338892..338960,339063..339122,339141..339200,
                     339213..339272,339291..339359)
                     /note="5 probable transmembrane helices predicted for
                     TVA2846 by TMHMM2.0 at aa 13-35, 70-89, 96-115, 120-139
                     and 146-168"
     misc_feature    339216..339248
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
     misc_feature    339768..340091
                     /note="HMMPfam hit to PF02518, HATPase_c, score 3.1e-26"
     misc_feature    340548..340895
                     /note="HMMPfam hit to PF00072, Response_reg, score 4e-31"
     CDS             complement(340994..342175)
                     /transl_table=11
                     /gene="cqsA"
                     /locus_tag="VANGNB10_cII0270c"
                     /old_locus_tag="TVA2845"
                     /product="Aminotransferase, class I/classII (CqsA)"
                     /product="CAI-1 autoinducer synthase (cholerae
                     quorum-sensing autoinducer)"
                     /note="user locus_tag: VANGcII0270c"
                     /note="Similar to Vibrio parahaemolyticus subname:
                     full=aminotransferase, class ii UniProt:Q87I95
                     (EMBL:BA000032) (393 aa) fasta scores: E()=6.2e-101, 60.2%
                     id in 392 aa, and to Vibrio cholerae cqsa
                     orderedlocusnames=vc_a0523 UniProt:CAI-1 (389 aa) fasta
                     scores: E()=1.5e-113, 68.5% id in 387 aa"
                     /protein_id="CDQ48167.1"
                     /translation="MNSRKWKHELPASIQSRIDYFINDLINANANGKHLVLGKRPTKN
                     DIVLQSNDYLSLADHPLIKARLKNAIDKTHDSVFMSAIFLQDEESKPSLETKFAEFVG
                     FDSCLLSQSGWNANTALLQAVCGPQSNVYIDFFAHMSMWEGARYANANIHPFMHNNCE
                     HLQKLIARHGPGLIVVDSIYSTIGTIAPLTDLVTIAKEYGCAILVDESHSLGTHGEKG
                     AGLVSELGLTAEVDFITASLAKTFAYRAGAIWANNNVNHCIPFVGYPAIFSSTILPYE
                     VEALEATLDIIKSADSKRTQLHRNAHTLRRGLNSIGLSVRSESQIIALETGDERNTEK
                     VRDYLEENQIFGAVFCRPATSKNKNIIRLSLNSNVTDSQIDTILTVCERAQNDSSLYF
                     K"
     misc_feature    complement(341231..342049)
                     /note="HMMPfam hit to PF00155, Aminotran_1_2, score 3e-19"
     CDS             complement(342375..343349)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0271c"
                     /old_locus_tag="TVA2844"
                     /product="C4-dicarboxylate transporter/malic acid
                     transport protein (Tellurite resistance protein)"
                     /note="user locus_tag: VANGcII0271c"
                     /protein_id="CDQ48168.1"
                     /translation="MMTWSLSLNWKRLIQVQSTPPSQAALALGVISLGHAWALYIPSV
                     GLIIRPYLALLGALLLLPVLLKYLTSFKTFMEDIRHPLSGSLMAPMSMTLLILSDYLA
                     LISPLIAYPIWFTALLLHFTMMLLFFSFQAMNFKISHIVPSWFLYPVGLISSSLAGTQ
                     FGHTVFSETLVSVCIAIYFFMLPLVLYRLVFAGMLPKRARPTLAIMAAPINLTLATYL
                     VNFPHPDPILTGALAGIAITMTLLIYLCYIRLLRLKFQPSIAAVTFPSVISAIAMHRL
                     TTFFEGQYPQWHWLHQFGLFELTIATFLVVWVSIGYIKMYWPELFANK"
     misc_feature    complement(join(342417..342485,342528..342587,
                     342606..342674,342687..342743,342777..342845,
                     342873..342941,342960..343028,343041..343109,
                     343146..343214,343227..343280))
                     /note="10 probable transmembrane helices predicted for
                     TVA2844 by TMHMM2.0 at aa 17-34, 39-61, 74-96,
                     101-123,130-152, 162-184, 196-214, 219-241, 248-267 and
                     282-304"
     misc_feature    complement(342534..343289)
                     /note="HMMPfam hit to PF03595, C4dic_mal_tran, score
                     1.9e-73"
     misc_feature    complement(343224..343310)
                     /note="PS00402 Binding-protein-dependent transport systems
                     inner membrane comp. sign."
     misc_feature    complement(343236..343328)
                     /note="Signal peptide predicted for TVA2844 by SignalP 2.0
                     HMM (Signal peptide probability 0.728) with cleavage site
                     probability 0.472 between residues 31 and 32"
     CDS             complement(343498..344895)
                     /transl_table=11
                     /gene="clcA"
                     /locus_tag="VANGNB10_cII0272c"
                     /old_locus_tag="TVA2843"
                     /product="H(+)/Cl(-) exchange transporter clcA"
                     /note="user locus_tag: VANGcII0272c"
                     /note="Similar to Escherichia coli (strain K12) clca
                     recname: full=h(+)/cl(-) exchange transporter clca
                     altname: full=clc-ec1 UniProt:P37019 (EMBL:AP009048) (473
                     aa) fasta scores: E()=1.1e-93, 56.2% id in 443 aa"
                     /protein_id="CDQ48169.1"
                     /translation="MTKRERLKQSLLAKVPKDTINQFLSKDKTPLSILFLSLIVGILA
                     GIVGTYFEAAVHLVSETRTEWLKSEIGNILPLWLAAFLISAALAFIGYFLVHRFAPEA
                     AGSGIPEIEGAMDGMRPVRWWRVLPVKFFGGMGALGSGMVLGREGPTVQMGGAIGRMV
                     SDIFRIKNDDTRHSLLASGAAGGLAAAFNAPLAGIMFVIEEMRPQFRYTLISVRAVIV
                     SAVAANIVFRVINGQHAVIQMPQYQAPELASLWLFLLLGGLFGIFGVLFNRLITLSQD
                     IFARIHRNDRKRYLLTGSLLGGCFGLTLLYIPELTGGGISLIPNITNGDYGAAILLLL
                     FIGRIFTTLICFGSGAPGGIFAPMLALGTLFGYAFGLIAQELLPQLAIDPGMFAIAGM
                     GALFAATVRAPITGILLVIEMTNNYYLILPLIITSLGAVIFAQLLGGQPIYSQLLHRT
                     LKNAKLQQQDLPPKE"
     misc_feature    complement(join(343579..343647,343666..343734,
                     343777..343845,343849..343917,343960..344028,
                     344089..344157,344200..344268,344302..344370,
                     344464..344532,344611..344679,344737..344805))
                     /note="11 probable transmembrane helices predicted for
                     TVA2843 by TMHMM2.0 at aa 31-53, 73-95, 122-144,
                     176-198,210-232, 247-269, 290-312, 327-349, 351-373,
                     388-410 and 417-439"
     misc_feature    complement(343582..344649)
                     /note="HMMPfam hit to PF00654, Voltage_CLC, score
                     6.5e-102"
     misc_feature    complement(343999..344031)
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
     CDS             345388..346374
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0273"
                     /old_locus_tag="TVA2842"
                     /product="putative cobalamin (vitamin B12) biosynthesis
                     protein"
                     /note="user locus_tag: VANGcII0273"
                     /protein_id="CDQ48170.1"
                     /translation="MTKKVPTNIITGFLGVGKTTAILNLLKNKPADEKWAVLVNEFGE
                     IGIDGAMMSDQGALIKEVPGGCMCCTAGVPMSVGINALLRQKPDRLLIEPTGLGHPKQ
                     VVATLTSDQYAPYVDLKATITLVDPRNLRNEKYTSNQNFNDQLASGDVVIGNKVDQCT
                     SADVDAFNDWVTDQSPAKIFSKLVKQGELPLELLDIERLHGAASTHIEAHHHHHASLE
                     PQFALQPGKAFVRKENRGQGYFSCGWLIGAEYHFDFDELFSMLSALTAERVKAVVNTD
                     KGCYAFNINQGVVSVNEMSLEGFESRLEVIDSQLMPWDQLEAVLLKLAGISQ"
     misc_feature    345403..345933
                     /note="HMMPfam hit to PF02492, cobW, score 1.9e-60"
     misc_feature    345421..345444
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
     misc_feature    346108..346359
                     /note="HMMPfam hit to PF07683, CobW_C, score 1.5e-05"
     CDS             complement(346491..347210)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0274c"
                     /old_locus_tag="TVA2841"
                     /product="ABC transporter, ATP-binding protein"
                     /note="user locus_tag: VANGcII0274c"
                     /protein_id="CDQ48171.1"
                     /translation="MNKQNLPNLVQLTNISKHYRSGEELVKALDGVSLSIQTGEFLSI
                     LGPSGSGKSTLMNILGCLDVPTSGEYQLDDKAVASLSSHQLAHIRNQKIGFVFQSFNL
                     LEYANALDNVALPLVYRGVKLKERRARAATLLEKVGLGDRMQHKPNQLSGGQKQRVAI
                     ARALVNDPQIILADEPTGALDSKSGAEIEALFNELHQEGRTLIVVTHDLALAKRTHRI
                     VNIKDGQILSDERVDHATRQP"
     misc_feature    complement(346539..347096)
                     /note="HMMPfam hit to PF00005, ABC_tran, score 1.8e-58"
     misc_feature    complement(346719..346763)
                     /note="PS00211 ABC transporters family signature."
     misc_feature    complement(347052..347075)
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
     CDS             complement(347203..348486)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0275c"
                     /old_locus_tag="TVA2840"
                     /product="Membrane protein, putatative permease protein"
                     /note="user locus_tag: VANGcII0275c"
                     /note="selfmatch (e-17) versus CDS:tva2840"
                     /protein_id="CDQ48172.1"
                     /translation="MMLPIRQIYQEMAAEKLRLLLTILAVAWGTLCIATMLATGEGLR
                     QGLTRSSQSGNGNLLYVTGGYASQTAGRFFEGKALSLQADDVELVRALPFIQRAEVSA
                     QWDKRVSNQDNGTWQRPLAVNPEYQSLTGIEIAKGGRWINPLDNQQQRKVVVLGYNAA
                     VQLFNSEDGWSWLEPQKLSINPVGQLIKIGDENFTVIGVIAQTSAEVEQGTPIDYAVF
                     VPFRTWQRFNPNAAIAAINVQLNATVDREKAAQVIKQVIARKYGASASDTQLLQVEDM
                     LLRQKSMRRFLFGLQGFLGIIGLITLGVAGIGIANVMYATVKRSTRDIGVRMAVGATP
                     TTIKLHYLVQALLTMSLGGLAGLGSTYGLITLLRYAPLEGNMLFEQLGKPLPELSFSI
                     VFLVIAALAIVGVITAWFPANRAASITPLEALQSE"
     misc_feature    complement(347227..347790)
                     /note="HMMPfam hit to PF02687, FtsX, score 1.6e-32"
     misc_feature    complement(join(347257..347325,347383..347451,
                     347542..347610,348370..348438))
                     /note="4 probable transmembrane helices predicted for
                     TVA2840 by TMHMM2.0 at aa 17-39, 293-315, 346-368 and
                     388-410"
     CDS             complement(348489..349706)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0276c"
                     /old_locus_tag="TVA2839"
                     /product="Membrane protein, putatative permease protein"
                     /note="user locus_tag: VANGcII0276c"
                     /note="selfmatch (e-17) versus CDS:tva2840"
                     /protein_id="CDQ48173.1"
                     /translation="MISSLQQVVQTLLAHRLRSALAVIAIVWGIVSVLVLVALGEGFY
                     RVNTQSFALLMSDTQMAFPSQTTKPWQGLAARRAITLSEPEMRALAQHPNISALSVIY
                     GKWDAKVTNVKGRMLPGYVSGIDSQFLALRNLQLTAGSRGIHASDQQNHSRIAVVGWQ
                     LAQVGQLSIGDTIKVNTIPFSVVGITQQQEGGISINNENSQVMIPSSAFTDLWQSEPE
                     FFLVQPAAGIPAAVLRMNILSFFAKQKHFDPSDTEAINLPDFSSGAQFFNALFRGIQL
                     FLGASGAMTLAVGALGVANIMFLSVTERTREIGVRLAIGATPKIILRQFILEGGLLVA
                     LGAVFGMLLSYLVVLLLNYIGLPDWLGEPVITVPALGWSLLVTTLFALLAAYFPAKRA
                     ANLTPVIALSARA"
     misc_feature    complement(348516..349058)
                     /note="HMMPfam hit to PF02687, FtsX, score 2.1e-36"
     misc_feature    complement(join(348549..348617,348654..348722,
                     348810..348878,349578..349646))
                     /note="4 probable transmembrane helices predicted for
                     TVA2839 by TMHMM2.0 at aa 21-43, 277-299, 329-351 and
                     364-386"
     CDS             complement(349703..350989)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0277c"
                     /old_locus_tag="TVA2838"
                     /product="Putative outer membrane protein TolC"
                     /note="user locus_tag: VANGcII0277c"
                     /note="Putative type I secretion protein"
                     /protein_id="CDQ48174.1"
                     /translation="MTTKRPFQRNALAAALMTFCGAVTFSAHAITIEQAWQAAKAFDP
                     TYSQAQIQSQISETEVRSTKSALLPSFSLSADTSWDDDGNNTKGYSATLSQTIWDSAN
                     WAQLDQSQASYVASQLKVKTAHNELAATLLYAYLDLASAQGDLQLAEQKFVEGAKLLK
                     ITEQRYKAGKIRSTALEDMRANHVDEQADILSAQAALEEKKSALIALINQDPQHIDQI
                     KTTDLIEPPMQVSSETEWLKLAQNNSPELLAAQQEVAASEFGRDAAKAKYYPTLSGSV
                     SYQDNDQGRDGDLSAGLSLKIPLDLNGSTRATVDQAALQVLSAKQVLRKVDIEIKRKI
                     QSGFNQIHLDWRQVEMAQLQVRSREQALKSKQTVYESGMTEASDLIDAHNALFNSKNS
                     LQRRLYQYWKQRIGLLQAAGQLDDDVIASLSQALHS"
     misc_feature    complement(349754..350293)
                     /note="HMMPfam hit to PF02321, OEP, score 2.6e-25"
     misc_feature    complement(350363..350896)
                     /note="HMMPfam hit to PF02321, OEP, score 4.3e-23"
     misc_feature    complement(350894..350956)
                     /note="1 probable transmembrane helix predicted for
                     TVA2838 by TMHMM2.0 at aa 12-32"
     misc_feature    complement(350903..350989)
                     /note="Signal peptide predicted for TVA2838 by SignalP 2.0
                     HMM (Signal peptide probability 1.000) with cleavage site
                     probability 0.799 between residues 29 and 30"
     CDS             complement(350979..352112)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0278c"
                     /old_locus_tag="TVA2837"
                     /product="putative uncharacterized HlyD family secretion
                     protein"
                     /note="user locus_tag: VANGcII0278c"
                     /protein_id="CDQ48175.1"
                     /translation="MKKRWAIAVISAALISGGYYLTTNSNESLSAFPTLTVEQGNIAK
                     QAIAVGQIVPAHSVSIKSQIEGIVGEIYHRVGEQVTLGTPLIKVRPNPTPQALTDATT
                     ALMQSEASLDSAKQTLANLQQLVEQKIVPENYGELIQAKSELKSKQAEVQQKRQNLEL
                     IRSGEASVGDSKLTSTLVAPIDGTILNLKVEVGEPIISTASSQAATEMMSIADMNDMI
                     FKGSVSEHDAAQLAAGMAVNLTLAPYPEAEISGVLSKVAVQSDKLNNPSDTKTTSFDN
                     GFEVEINQIRFPDNMVIRSGFSATAQITLKSVENVITIPERALRFSGEKPEVLIPDQS
                     EQGYQVRAVTLGLSDGINVEVIAGLSADDVIIDNSLFGGKDDH"
     misc_feature    complement(351645..351947)
                     /note="HMMPfam hit to PF00529, HlyD, score 6.1e-07"
     misc_feature    complement(352047..352100)
                     /note="1 probable transmembrane helix predicted for
                     TVA2837 by TMHMM2.0 at aa 5-22"
     misc_feature    complement(352050..352112)
                     /note="Signal peptide predicted for TVA2837 by SignalP 2.0
                     HMM (Signal peptide probability 0.976) with cleavage site
                     probability 0.416 between residues 21 and 22"
     CDS             complement(352349..353293)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0279c"
                     /old_locus_tag="TVA2836"
                     /product="Putative GTP-binding protein (GTPase)"
                     /note="user locus_tag: VANGcII0279c"
                     /protein_id="CDQ48176.1"
                     /translation="MVNNTIQWFPGHMHKARKEIEEVIPQVDVIIEVLDARIPFSSEN
                     PLISHLRGNKPCVKVLNKRDLADPEMTQLWIDHFEKEQGVKAMAVTTSNPQEVHKIME
                     LCRKLAPHREEVGKNIRTMIMGIPNVGKSTIINTLAGRAVAQTGNQPAVTRRQQRINL
                     QNGIVLSDTPGILWPKVENPHSGFRLAATGAVKDTAMEYEDVAFYTVEYLAQAYPERL
                     QERYQIDELPQSDVEWMEEIGRKRGALRPGGRIDLHKASEILLHELRQGILGQITLER
                     PEMITKELVEVEERAAREAEEKAAKKVERRKRYLRNKR"
     misc_feature    complement(352595..352942)
                     /note="HMMPfam hit to PF01926, MMR_HSR1, score 1.1e-19"
     misc_feature    complement(352901..352924)
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
     CDS             353827..354663
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0280"
                     /old_locus_tag="TVA2835"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0280"
                     /protein_id="CDQ48177.1"
                     /translation="MILSWFQQQQNHRYWLVDRKLHKQALQQNGGFGFEEAVPLFYGA
                     MFTEVMPLSPWLIPVSESVLSLPEALLEQGIGLSSHAVGDEVLQHLRSLLIAGLEGEE
                     VMFRFYDRSVIIAMLARMDQSEVNQFLGNINQLAALGDGDQGHDRDQGHLVTFNNTSH
                     APFNAQQGSWWVIKAHHLDKQENLPLLKANLESWLWQHFPKAMDQHLTQGRDIASMLT
                     PFLSAAEQTLTYRVMSAAIAAIMGNEYLAQPSMIELIKDNQNEEIKYALHALSRQLQH
                     EG"
     CDS             354666..356576
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0281"
                     /old_locus_tag="TVA2834"
                     /product="putative uncharacterized lipase class 3 protein"
                     /note="user locus_tag: VANGcII0281"
                     /protein_id="CDQ48178.1"
                     /translation="MDSFNHCVQCNPEKNWLELEFMSENDEPIDGLAVTITNKITSNT
                     HTQTTSAGKVLFANIAAGEWRASVSQASLLSEVEKYASRKEGQESPVKIRASAELDAA
                     EQNPKRYHSTTIGDFWDEAPQDEFLQEHHKGIDTNASAEKAGFSLSHNQSYVFEIKAL
                     RSYMPVIIDTDEFSLVNSYTFALLSKLAYATDKKSIDLKSEADSTGSIGTVINQFKSR
                     QLPIQSGNQKVRWLVEEIPYSRALNFKYYDNRQKHAQGYILFNEEIAIVSVRGTEPSF
                     YDKDSVIDPNSKFIITKVANGIDAVLNSPGINDLVKTDLDAAQIAPNEFGGAYVHQGF
                     YQYSMALWENTLLADDILKNHATKRFYLCGHSLGGAGALLLSALIKDSLHPSVLRLYT
                     YGMPRTGTRSFVTQYQDILHYRHVNNHDGVAQIPMTWANTDITEGLDKWDVFSSGITL
                     IKKMLTDNDDDNYLHHGHLSQLLTYQKPDQILLTPRQTQVTMLDMAKLAINDSVSLVN
                     NLSEVSIAEHGMDHYVPNLWQQLLALSNESLMTHYQKAISALDQEIATLQQNYLTVKQ
                     TWARSIGDGTPAMGIGRLMSEMNSINKLIDNRNQIRGELKQIVSDPQRLPLAKLLIAQ
                     QTLPDEIKEQLQ"
     misc_feature    355557..355955
                     /note="HMMPfam hit to PF01764, Lipase_3, score 8.7e-20"
     CDS             356573..357295
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0282"
                     /old_locus_tag="TVA2833"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0282"
                     /protein_id="CDQ48179.1"
                     /translation="MKLLNSLTRKKRISIILLFIVLVFLGYDYYKSTQPNIWGDEPDE
                     SYIKITGKKPKDAKVDAWARWGASGDECKARTFSFSNVKWSKGANVDLHVTHDFSTDP
                     SRYELRIPYQKYHDALNCDVILGDIVVQAYNGYGSAGFAQLRISPAGKEYYNRPIDFK
                     FSIAAKDCEPYYSEKFNRWTKGFGCYYYVDEKMKSQDQEFNAYDVYYDFSKFNNDTVI
                     HYDILAGENYRSEPLDKEKGPQ"
     misc_feature    356609..356662
                     /note="1 probable transmembrane helix predicted for
                     TVA2833 by TMHMM2.0 at aa 13-30"
     CDS             357295..358029
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0283"
                     /old_locus_tag="TVA2832"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0283"
                     /protein_id="CDQ48180.1"
                     /translation="MKFIANTNRKKRISIIVLFIALFFLGSDYYQTSQPNILGDEPDE
                     SYITISGKKPIDAYLEVWTHFWVTGDECEAYSYDLFGQKSHKGGKISQKITHNFAKDD
                     SRYEFRIPYQTYKNEQNCIVELRDFSIQAYNKFDTVGFAQLRVSPAGNEYYNRSIELG
                     SSIEAKNCRARYYEDLDEWSTGLACSFYTNGKMKDKKDLVEFNAYTAYYDFSKFNNDT
                     VIHYDILAGENYRSEPLVQEQVAVAQ"
     CDS             complement(358030..358374)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0284c"
                     /old_locus_tag="TVA2831"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0284c"
                     /protein_id="CDQ48181.1"
                     /translation="MVFSEEDRQALYNVWMSQKAKMHLTQMEMAKRLNLTQLEFSHLL
                     RGDSSLSMTFISQFCRHLHIEPHRVLPSLKQTATSEVKAICLKNRISVDGDIQHVSIE
                     GNQVIIEYIHYA"
     misc_feature    complement(358240..358305)
                     /note="Predicted helix-turn-helix motif with score
                     1326.000, SD 3.70 at aa 24-45, sequence
                     LTQMEMAKRLNLTQLEFSHLLR"
     CDS             359050..359598
                     /transl_table=11
                     /operon="srl"
                     /gene="srlA"
                     /gene_synonym="gutA"
                     /gene_synonym="sbl"
                     /locus_tag="VANGNB10_cII0285"
                     /old_locus_tag="TVA2830"
                     /product="glucitol/sorbitol permease IIC component"
                     /note="user locus_tag: VANGcII0285"
                     /note="selfmatch (e-49) versus CDS:tva2824; Similar to
                     Escherichia coli (strain K12) srla synonyms=guta, sbl
                     UniProt:Glucitol/sorbitol (187 aa) fasta scores:
                     E()=5.8e-62, 81.8% id in 181 aa. Ref_gene_sequence_
                     EcoliK12: <http://biocyc.org/ECOLI/NEW-IMAGE?type=GENE-IN-
                     MAP&objec t=EG10969>"
                     /protein_id="CDQ48182.1"
                     /translation="MEWIIHGAEWFIGLFQKGGEVFTGMVTGILPLLIALLVAMNALI
                     RLVGQERVEKLAQSSAGNPISRYLILPVIGTFIFCNPMTLSLGRFLPERYKPSYYAAA
                     SYSCHSMNGLFPHINPGELFVYLGIASGLTTLGLPLGPLAVSYLLVGMVTNFFRGWVT
                     DFTTTMVERQQGVQLERQVHVG"
     operon          359050..365216
                     /operon="srl"
     misc_feature    359110..359574
                     /note="HMMPfam hit to PF03608, EII-GUT, score 1.7e-112"
     misc_feature    join(359122..359190,359251..359319,359428..359496)
                     /note="3 probable transmembrane helices predicted for
                     TVA2830 by TMHMM2.0 at aa 5-27, 48-70 and 107-129"
     misc_feature    359335..359367
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
     CDS             359612..360607
                     /transl_table=11
                     /operon="srl"
                     /gene="srlE"
                     /gene_synonym="gutA"
                     /locus_tag="VANGNB10_cII0286"
                     /old_locus_tag="TVA2829"
                     /product="Phosphotransferase
                     system,glucitol/sorbitol-specific IIBC component"
                     /note="user locus_tag: VANGcII0286"
                     /note="selfmatch (e-88) versus CDS:tva2823"
                     /protein_id="CDQ48183.1"
                     /translation="MTKVLRIQKGSGGWGGPLELPIEADKKVFYITGGTRPAIVDRIV
                     ELTGYEAVDGFKTSVPDEDIGVAVIDCGGTLRCGLYPKKRIPTVNIHATGKSGPLAEF
                     ITEDIYVSGVRERDIQLVGSEGGAMQPPPLRDELSNENLATNKYDTSKKLTQQSDSLL
                     ARIGIGMGSVMAIFYQAGREAIDTILKTILPFMAFVSMLIGVIIASGLGDVIAHVLTP
                     LAQNPLGLVTLALICSFPLLSPFLGPGAVIAQVIGVLVGTQIGLGNIPPHLALPALFA
                     INAQAACDFIPVGLGMAEAKPRTVEIGVPSVLYSRFLTGAPTVLLAWFVSLFIYQ"
     misc_feature    359618..360160
                     /note="HMMPfam hit to PF03612, EIIBC-GUT_N, score
                     3.9e-112"
     misc_feature    join(360083..360142,360185..360253,360287..360355,
                     360530..360598)
                     /note="4 probable transmembrane helices predicted for
                     TVA2829 by TMHMM2.0 at aa 158-177, 192-214, 226-248 and
                     307-329"
     misc_feature    360323..360601
                     /note="HMMPfam hit to PF07663, EIIBC-GUT_C, score 2.9e-55"
     CDS             360618..360980
                     /transl_table=11
                     /operon="srl"
                     /gene="srlB"
                     /locus_tag="VANGNB10_cII0287"
                     /old_locus_tag="TVA2828"
                     /product="glucitol/sorbitol-specific phosphotransferase
                     enzyme IIA component"
                     /note="user locus_tag: VANGcII0287"
                     /note="selfmatch (e-19) versus CDS:tva2828"
                     /protein_id="CDQ48184.1"
                     /translation="MSPLYQVKIESIGEFANSALEDDMMIIFSNIAPKDAAEYCFIHS
                     HDALKGNIKPGGVMQLGRYQYPITAVGEVVNQNLAELGHITIRFDALVEAEYPGCLHV
                     NGERPQQVRCGDEIVFLN"
     misc_feature    360618..360968
                     /note="HMMPfam hit to PF03829, PTSIIA_gutA, score 2.1e-48"
     CDS             361039..361818
                     /transl_table=11
                     /operon="srl"
                     /gene="srlD"
                     /gene_synonym="gutD"
                     /locus_tag="VANGNB10_cII0288"
                     /old_locus_tag="TVA2827"
                     /product="sorbitol-6-phosphate dehydrogenase (Short-chain
                     dehydrogenase/reductase SDR)"
                     /note="user locus_tag: VANGcII0288"
                     /note="100% aa-similar to EG10971_SrlD (T-coffee regular)"
                     /protein_id="CDQ48185.1"
                     /translation="MSKVALVVGGGQTLGEFLCLGLANEGYRVAVADLNGCSAEKVAN
                     RINQEYGQATALGVEVDATKEQSVVNMVRQIDEFFGRIDLLVYSAGVAQAGKIDGFPL
                     TAWQLSIDVNLTGYFLCAREVSKVMIREQRGGRIIQINSKSGKVGSKHNSGYSAAKFG
                     GVGLTQSLALDLAEHKITVHSLMLGNLLKSPMFQSLLPQYAKKLGVPESEVEQIYIDK
                     VPLKAGCEYQDVLNVLKFYASDEAAYCTGQSINITGGQVMF"
     misc_feature    361045..361557
                     /note="HMMPfam hit to PF00106, adh_short, score 2e-21"
     misc_feature    361459..361545
                     /note="PS00061 Short-chain dehydrogenases/reductases
                     family signature."
     CDS             361914..362270
                     /transl_table=11
                     /operon="srl"
                     /gene="slrM"
                     /gene_synonym="gutM"
                     /locus_tag="VANGNB10_cII0289"
                     /old_locus_tag="TVA2826"
                     /product="glucitol/sorbitol operon activator"
                     /note="user locus_tag: VANGcII0289"
                     /protein_id="CDQ48186.1"
                     /translation="MDSTTVLIYFAAGAWMIQIVLGYLQIRSFNRMLQSMTHKGKVKI
                     GRTQSRWKPRTVLVLVEDEDQHVVDAQVMKGISVFARPKTLDQLIGQSLPIPESLIFQ
                     LDSNVQEALNVAISRQ"
     misc_feature    362019..362246
                     /note="HMMPfam hit to PF06923, GutM, score 9.4e-10"
     CDS             362353..363129
                     /transl_table=11
                     /operon="srl"
                     /gene="srlR"
                     /gene_synonym="gutR"
                     /locus_tag="VANGNB10_cII0290"
                     /old_locus_tag="TVA2825"
                     /product="Putative glucitol/sorbitol operon
                     transcriptional repressor"
                     /note="user locus_tag: VANGcII0290"
                     /protein_id="CDQ48187.1"
                     /translation="MNLDNRRAQLLDYLRVNGKTSVNDLADTFETSGATIRSDLRSLE
                     EEGLVIRRYGAAEACIANSVILEDRSMDEKQTVNLERKCLIAKAASQLVKDGDSIILD
                     CGSTTLQMVPHFEQVMSLTLMTNSIHIVNAVANLDAEHTVLVPGGTYRRKSASFHGTL
                     AEQAFKQFSFDKLFIGADGFDLAQGTTTYNEAYQVSQAMCQAANQIIVVTDSSKFGRR
                     SPNVVVPLDKIDIVVTDNLIAAEDRTYLEEKGIQVITVGS"
     misc_feature    362368..362538
                     /note="HMMPfam hit to PF08220, HTH_DeoR, score 1.4e-14"
     misc_feature    362587..363057
                     /note="HMMPfam hit to PF00455, DeoR, score 4.9e-62"
     CDS             363322..363885
                     /transl_table=11
                     /operon="srl"
                     /gene="srlA-2"
                     /gene_synonym="gutA-2"
                     /locus_tag="VANGNB10_cII0291"
                     /old_locus_tag="TVA2824"
                     /product="Phosphotransferase
                     system,glucitol/sorbitol-specific IIC component"
                     /EC_number="2.7.1.69"
                     /note="user locus_tag: VANGcII0291"
                     /note="selfmatch (e-50) versus CDS:tva2830"
                     /protein_id="CDQ48188.1"
                     /translation="MDWIIEGVEWFIGLFEKGGEVFSEMVAQVLPVLICLLVAMNALI
                     RFIGQQRIEVLAQKSASNPISRYLLLPTVGTFVFCNPMVLSLGRFLPEKYKPSYYASA
                     SYSCHTMNGMFPHVNPSELFIYLGIAAGITQQGLSLGPLAISYLLVGLVTNFLRGWVT
                     DMTTMFVARQQGVVFSDKVDLNVVEEK"
     misc_feature    363322..363846
                     /note="HMMPfam hit to PF03608, EII-GUT, score 2.3e-115"
     misc_feature    join(363394..363462,363520..363588,363733..363801)
                     /note="3 probable transmembrane helices predicted for
                     TVA2824 by TMHMM2.0 at aa 25-47, 67-89 and 138-160"
     misc_feature    363607..363639
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
     CDS             363885..364853
                     /transl_table=11
                     /operon="srl"
                     /gene="srlE-2"
                     /gene_synonym="gutA-2"
                     /locus_tag="VANGNB10_cII0292"
                     /old_locus_tag="TVA2823"
                     /product="Phosphotransferase
                     system,glucitol/sorbitol-specific IIBC component"
                     /note="user locus_tag: VANGcII0292"
                     /note="selfmatch (e-87) versus CDS:tva2829"
                     /protein_id="CDQ48189.1"
                     /translation="MTVLKVNRGQGGWGGPLFIPVEVDKKIIYITAGTRPHFIDEMVA
                     LTGMQAVNGFEHFVPDERVACVVIDCGGTLRCGLYPKKGIPTLNIHATGQSGPLAQYI
                     QEDIYASGIRSGCFSLVDAHKTTFCEPILSQPQSIDTTKKLSQQTDSLLAKVGIGMGS
                     VMATFNQAGRETIDTVLKTILPFMAFVSMLIGVILASGLGDLIAHTLEPLAGNPIGLL
                     TIALICSFPFLSPFLGPGAVIAQVIGVLIGTQIGMGNIPPHLALPALFAINAQAACDF
                     IPVGLGLADAKPETVQVGVPSVLYSRFLTGAPTVLIAWLISFFIYQ"
     misc_feature    363888..364406
                     /note="HMMPfam hit to PF03612, EIIBC-GUT_N, score 1.2e-85"
     misc_feature    join(364422..364490,364533..364628,364665..364733,
                     364776..364844)
                     /note="4 probable transmembrane helices predicted for
                     TVA2823 by TMHMM2.0 at aa 180-202, 217-248, 261-283 and
                     298-320"
     misc_feature    364569..364847
                     /note="HMMPfam hit to PF07663, EIIBC-GUT_C, score 1.6e-55"
     CDS             364860..365216
                     /transl_table=11
                     /operon="srl"
                     /gene="srlB-2"
                     /gene_synonym="gutB-2"
                     /locus_tag="VANGNB10_cII0293"
                     /old_locus_tag="TVA2822"
                     /product="Phosphotransferase
                     system,glucitol/sorbitol-specific IIA component"
                     /EC_number="2.7.1.69"
                     /note="user locus_tag: VANGcII0293"
                     /note="selfmatch (e-18) versus CDS:tva2828"
                     /protein_id="CDQ48190.1"
                     /translation="MLQYQTTILSAGDYAKDSLHDDMVILFGPSAPDAVKEYCFIHSG
                     SSLYGLIDHNTTLLIGDLGFVVTAVGSVANQNLAELGHVTLKFDGQRIPELPGTIHLL
                     GPKLEVLQHGDVLMFG"
     misc_feature    364860..365213
                     /note="HMMPfam hit to PF03829, PTSIIA_gutA, score 1.1e-33"
     CDS             complement(365350..366474)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0294c"
                     /old_locus_tag="TVA2821"
                     /product="ABC transporter-like, ATP-binding protein"
                     /note="user locus_tag: VANGcII0294c"
                     /protein_id="CDQ48191.1"
                     /translation="MATVSLRKIEKEYENGFKAVHGIDLDIHDGEFMVFVGPSGCAKS
                     TTLRMIAGLEGISGGEIRIGNQIVNDLPPKERGIAMVFQNYALYPHKTVFDNMAFGLK
                     MQKRPKDEIKQRVEEAAEKLEITELLYRKPKEMSGGQRQRVAVGRAIVRKPDVFLFDE
                     PLSNLDAKLRVSMRVKIAQLHQALKEEGTPATMIYVTHDQTEALTLGDRICVLNQGRI
                     MQVDTPANLYNYPANKFVASFIGSPAMNLVDTVIRSENEQLYIDIAANVRMFIPHEKQ
                     IALQQYINKPVCFGIRPEHIHLAAEHDTINTVEGTLTVVENMGNEKYLYFTVAGKELI
                     ARVNDQTITTAHIGKTMRFNLNTTFCHIFDFYNEQNLTNI"
     misc_feature    complement(365386..365610)
                     /note="HMMPfam hit to PF08402, TOBE_2, score 1.8e-06"
     misc_feature    complement(365827..366387)
                     /note="HMMPfam hit to PF00005, ABC_tran, score 2.5e-48"
     misc_feature    complement(366028..366072)
                     /note="PS00211 ABC transporters family signature."
     CDS             complement(366507..366989)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0295c"
                     /old_locus_tag="TVA2820"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0295c"
                     /protein_id="CDQ48192.1"
                     /translation="MKSSLLIAATLAVLLAGCASTTTQQNDSVQNVDPKFSQCDLPTL
                     EERGPIRPSIFVVGTFADGQWLHMDNRQMGYKGDGIYQVVSNEKAGNVSLQFATMSWN
                     PQYTAAGLTLTVGQVKELKRAGFAKNTVVMLPKDGQYVWTVQIADDKTPRLVMISECK
                     "
     misc_feature    complement(366921..366989)
                     /note="Signal peptide predicted for TVA2820 by SignalP 2.0
                     HMM (Signal peptide probability 1.000) with cleavage site
                     probability 0.377 between residues 23 and 24"
     misc_feature    complement(366936..366968)
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
     CDS             complement(367036..368046)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0296c"
                     /old_locus_tag="TVA2819"
                     /product="Putative UDP-N-acetylglucosamine
                     acyltransferase,LpxA-like"
                     /note="user locus_tag: VANGcII0296c"
                     /note="The CDS/protein has 8 hexapeptide repeats"
                     /protein_id="CDQ48193.1"
                     /translation="MIHVSEIAQLISGKIEGDASISIDTIRPVNAPQIAGGLAIVFSK
                     KDIHSISETTADVLIGPAAICSSTVKTKIIIEHLDANTLNKLLRYYKVQMYQLFDQGN
                     TATIDDVYIGKHCQIGENCHFMPGVKIMNGVTIGNNVAIHANTVIKEGTIIGNNVTID
                     SNNSIGNFSFEYMAVKDGAYQRVESIGRVVIHDDVEIGCNNTIDRGTLGDTVIGQGTK
                     IDNQIQIGHDCQIGKHCLLISQSGFAGHTTLGDHVVVHGQAGTAGHVTIGSYSVIKAK
                     SGVSHSFPEKSDLFGYPAKEAKAYYKNLAVLNKITQHFEIHKSKSTHRGWLSKLLQKK
                     IL"
     misc_feature    complement(367204..367257)
                     /note="HMMPfam hit to PF00132, Hexapep, score 22"
     misc_feature    complement(367258..367311)
                     /note="HMMPfam hit to PF00132, Hexapep, score 22"
     misc_feature    complement(367312..367365)
                     /note="HMMPfam hit to PF00132, Hexapep, score 39"
     misc_feature    complement(367366..367419)
                     /note="HMMPfam hit to PF00132, Hexapep, score 0.29"
     misc_feature    complement(367432..367485)
                     /note="HMMPfam hit to PF00132, Hexapep, score 3.2"
     misc_feature    complement(367546..367599)
                     /note="HMMPfam hit to PF00132, Hexapep, score 0.095"
     misc_feature    complement(367600..367653)
                     /note="HMMPfam hit to PF00132, Hexapep, score 0.0062"
     misc_feature    complement(367654..367707)
                     /note="HMMPfam hit to PF00132, Hexapep, score 0.017"
     CDS             complement(368066..369100)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0297c"
                     /old_locus_tag="TVA2818"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0297c"
                     /protein_id="CDQ48194.1"
                     /translation="MKRTLLAISVATAIAVSTPAFAASEHGLNPEDSFFDQALQFGGH
                     VGTSLEYEDKITNGFTGIDKKEKTTTHEAFGVYYNNAKWNMTALYALKIENREQHEGS
                     YHENEDGLKHLFSLNKGYDLSNGWATGLIYELEYTDSKVYSPYVSGLRKNLAEHSLRP
                     YLTYWNNEYSWGFYSNLEYLYSKEDKSEWGERTETGYSILFRPYKRFGNWELGLEMYY
                     QIKDNEDYQSNGNINEISDFTEKYIEPVVQYSFDDAGTLYVRARLGDNETNNASNSGG
                     GNANVDYFKDIRKATLGYEQAVGDSWLVKGEYEFANEVEEKSKLAGWEAKNESELTQH
                     TVYLQALYRF"
     misc_feature    complement(369035..369100)
                     /note="Signal peptide predicted for TVA2818 by SignalP 2.0
                     HMM (Signal peptide probability 1.000) with cleavage site
                     probability 1.000 between residues 22 and 23"
     CDS             369524..370738
                     /transl_table=11
                     /gene="mal?"
                     /locus_tag="VANGNB10_cII0298"
                     /old_locus_tag="TVA2817"
                     /product="putative extracellular solute-binding
                     protein,family 1"
                     /note="user locus_tag: VANGcII0298"
                     /protein_id="CDQ48195.1"
                     /translation="MKTVLAATLICSASIVSAETITPEIDSELLIWTDNTTLDYMKYA
                     ADQFNQDFGYKVKFTFRGLAPIDAASRMIQDGGSARVADVAEIEHDLLGRLVVAGGAM
                     ENLVSVDRMKHNFMPNAISAMQYGGASYGFPVSYATLALFYNKDLLPEAPKTFEALIR
                     FGEIFNNVKENKYALLWDVQNYYESRMFLTLYGAYEFGNKGTDAKDIGINSELAQKGL
                     LAMKTLQAANSSNPIDMRNPQVRRGLFSEGKVAAIIDGPWAIQGYAASGVNYGVMPIP
                     TLEGQQLRTFSTVRLAVVSTYSEYPKAAQLFADYIASDKMLMKRYEMTKSIPPVQSLM
                     EEIIVDADEATYAIIAQGFYSDAMPSIPEMGYLWSPMASAITAMWVNGKEPKSVLDHA
                     RAIIEEQIAFQE"
     misc_feature    369524..369577
                     /note="Signal peptide predicted for TVA2817 by SignalP 2.0
                     HMM (Signal peptide probability 1.000) with cleavage site
                     probability 0.989 between residues 18 and 19"
     misc_feature    369530..370477
                     /note="HMMPfam hit to PF01547, SBP_bac_1, score 7e-26"
     misc_feature    369920..369973
                     /note="PS01037 Bacterial extracellular solute-binding
                     proteins, family 1 signature."
     CDS             370741..372024
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0299"
                     /old_locus_tag="TVA2816"
                     /product="binding-protein-dependent transport systems
                     inner membrane component (ABC transporter permease)"
                     /note="user locus_tag: VANGcII0299"
                     /note="The CDS/protein has 8 predicted transmembrane
                     helices; IPR000515"
                     /protein_id="CDQ48196.1"
                     /translation="MLLAKTQNRLHFLSSMLIMGTTQLVHKHWVKGIFLFTVNVLFLF
                     ALPNLILALKGLVSLGDVVQVRQGFQVIQGDNSIHMLVEGVIAVILMLCFITTYILNV
                     KDAQSCELCKLNIRGQIQSIYNKHFAFIVLSPALIVTIAFITLPIAITVLVSFTNYSA
                     PHHIPPKNLVDWVGLRNFWTLFELKIWSNTFFGVALWTVGWAVTATICTCGFGFLLAL
                     ALENRNIQAKKLWRFVFILPYAIPAFVTLLMFRLLLNGIGPVNATLNSWGVDSIAFLS
                     DPFTAKITVIAVSVWVGAPYFMLLIAGALTNIPRDLYEASEVDGASKFQQFQEITLPM
                     VLHQVAPSLVMTFAHNFNNFGAIFLLTEGGPINPEYRFAGHTDILITWIYKLTLDFQQ
                     YQIASVISIVIFLFLSVIAIWQFRRMKSFKDDVGM"
     misc_feature    370741..370821
                     /note="Signal peptide predicted for TVA2816 by SignalP 2.0
                     HMM (Signal peptide probability 0.630) with cleavage site
                     probability 0.625 between residues 27 and 28"
     misc_feature    join(370825..370893,370978..371046,371119..371187,
                     371332..371400,371437..371505,371587..371655,
                     371917..371985)
                     /note="7 probable transmembrane helices predicted for
                     TVA2816 by TMHMM2.0 at aa 29-51, 80-102, 127-149,
                     198-220,233-255, 283-305 and 393-415"
     misc_feature    371311..372009
                     /note="HMMPfam hit to PF00528, BPD_transp_1, score
                     8.9e-16"
     misc_feature    371653..371739
                     /note="PS00402 Binding-protein-dependent transport systems
                     inner membrane comp. sign."
     CDS             372027..372860
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0300"
                     /old_locus_tag="TVA2815"
                     /product="binding-protein-dependent transport systems
                     inner membrane component"
                     /note="user locus_tag: VANGcII0300"
                     /note="The CDS/protein has 6 predicted transmembrane
                     regions."
                     /protein_id="CDQ48197.1"
                     /translation="MNRLAEKLGTLLVYLFLLLNALLVLGPVAWTILASFKRGNNLFS
                     TSFSDITFTLDHYRALFTDTPYLDWYINTLILATANMGISLIVVTMTAYVFSRYRFKG
                     KRNVMMGILVLQMFPAFLSMTAIYILLSKMNLIDTYAGLLFVYVTGSLPFMTWLVKGY
                     FDALPTSLDEAAKIDGAGHMTIFLEIILPLARPILVFVALVSFTGPWMDFILPTLILR
                     SEEKMTLAIGIFSWISSNSAENFTLFAAGSLLVAIPITLLFVVTQKHITTGLVSGAVK
                     E"
     misc_feature    join(372060..372128,372243..372311,372345..372413,
                     372441..372509,372570..372638,372744..372812)
                     /note="6 probable transmembrane helices predicted for
                     TVA2815 by TMHMM2.0 at aa 12-34, 73-95, 107-129,
                     139-161,182-204 and 240-262"
     misc_feature    372234..372842
                     /note="HMMPfam hit to PF00528, BPD_transp_1, score 1e-09"
     misc_feature    372507..372593
                     /note="PS00402 Binding-protein-dependent transport systems
                     inner membrane comp. sign."
     CDS             372879..374678
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0301"
                     /old_locus_tag="TVA2814"
                     /product="glycosyl hydrolase, family 13"
                     /note="user locus_tag: VANGcII0301"
                     /protein_id="CDQ48198.1"
                     /translation="MITKSSLMHSAKSADSYAYDNATLHIRFRTAKGEVDNVSLWIGD
                     PYHWAEGGLDGGNLGGSDAHGWVGGNTVPMLFEGQTEYHDHWFAQFQPPKRRSRYGFI
                     LHGREGEKLLFGEKRCVDIRDPNIAEMELSNLSNFFCFPYLNPRDVLCTPNWVKETIW
                     YQIFPERFHNGMPDISPFDVQPWGSQPSSHNFMGGDLWGVIEKLDYLQELGVNGLYFC
                     PVFTANANHKYDTVDYFNVDPHFGGNEAFRALVKEAHRRKMKVMLDAVFNHVGDQHPF
                     WLDVVKNGAQSRYADWFWINRFPVYPDIPKEEWDFWDFNYETFGNVIEMPKLNTENEQ
                     CRQYLLSVALHWVEEFDIDGWRLDVANEVDHEFWRDFRRTVKSIKPDCYILGEIWHEG
                     MPWLRGDQYDSLMNYPLTQATTDYFALQAYDKETFMHAVTRSYLAYPKNVNEVMFNLL
                     ESHDTTRLLSLCANDKHKAKLAYLFMFTQVGSPCIYYGGEIGMDGCKGMGREDNRKCM
                     IWDESEQDLDFKAFIQWLIELRKNHPHWNEPSLNWHTVEHPSVLAYSRGEQTFFINNS
                     DSAISFMWQEQLMHLTAFGFNILGLCTASAWWR"
     misc_feature    372879..373310
                     /note="HMMPfam hit to PF02903, Alpha-amylase_N, score
                     1.3e-29"
     misc_feature    373362..374468
                     /note="HMMPfam hit to PF00128, Alpha-amylase, score
                     5.5e-110"
     CDS             374848..375672
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0302"
                     /old_locus_tag="TVA2813"
                     /product="Putative sugar-specific transcriptional
                     regulator TrmB family"
                     /note="user locus_tag: VANGcII0302"
                     /protein_id="CDQ48199.1"
                     /translation="MNKKRGEPVTELVTKLMGFGFTKTDALVYINLLKNGRSSGYKIA
                     KDISLSRSSVYSSIDNLYKNGCIFMSDGDTKEYEAKSPELIFSQIERQTIDNIQILKK
                     ELSRMMLQEEKEFIYNVTGFENLIQKAREMLALAQVEVYLNTDFHLELLEKEICDAIE
                     RGVRVITFSFNKLSVPHPKVELYSRSDQQEQRYPSHRFMLVVDMKQAVMFSHRQEALG
                     LYSNNRLLVKMIAEHIHSDIYLTEYEKLAPEKRCRIGTIHELDNDMVHDDSGSFTQ"
     misc_feature    374893..375096
                     /note="HMMPfam hit to PF01978, TrmB, score 4.6e-22"
     CDS             375859..376536
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0303"
                     /old_locus_tag="TVA2812"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0303"
                     /protein_id="CDQ48200.1"
                     /translation="MKKMLMFLLLLLGLAGSGAGYYFLYYLPEQEALQADSSSSNDEE
                     QVPTTEAVPKTALPPKPLVNDLYVDLARLGVREKPDAQAFVERVLYRGDKVKILERKA
                     GFGRITDYFVYEENGPEVAEWIPLDGLVEQAPLITAEERRKTVTQYIANSDNFKLYET
                     AFVQKTDELLKNETCVPEDFEELGGWVKSLKYQEREVYFVYCGGRKLANKIYFDIQSK
                     EIFYASH"
     misc_feature    375859..375912
                     /note="Signal peptide predicted for TVA2812 by SignalP 2.0
                     HMM (Signal peptide probability 0.998) with cleavage site
                     probability 0.352 between residues 18 and 19"
     misc_feature    375871..375939
                     /note="1 probable transmembrane helix predicted for
                     TVA2812 by TMHMM2.0 at aa 5-27"
     CDS             376629..377132
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0304"
                     /old_locus_tag="TVA2811"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0304"
                     /protein_id="CDQ48201.1"
                     /translation="MHWHFIKYVWFTLLAVVLPSQAFGYLIESETHSHAERKVILQHG
                     EKTSLTAIVHQQTLPQAIAIQQPISDQQDKQTAPPVSKSLHSDTSAAIVTASRWGVTS
                     RVVEYDGPTFVDNTPNYDVTVAPFRLYLFPVAELAAWQARPYSSNHRISGWKETNAMY
                     VALNSQY"
     misc_feature    376629..376700
                     /note="Signal peptide predicted for TVA2811 by SignalP 2.0
                     HMM (Signal peptide probability 0.953) with cleavage site
                     probability 0.706 between residues 24 and 25"
     CDS             377230..379068
                     /transl_table=11
                     /gene="secD"
                     /locus_tag="VANGNB10_cII0305"
                     /old_locus_tag="TVA2810"
                     /product="protein-export membrane protein SecD"
                     /note="user locus_tag: VANGcII0305"
                     /note="type II protein secretion"
                     /protein_id="CDQ48202.1"
                     /translation="MKKTQNKKASARLINHYSAWKYIVLAATLVVLALSAIPTWYGEQ
                     PSIQLQVSSKNETLNSVVELTHLLEKNDIAVQNIQQQGGKTTLVFADEVQQTHARELL
                     DGMIEKEDSITFSYVSVAPTWLTNLGFNPIKLGLDLRGGVQFLLNVDVDKAFQEQRDS
                     MIDTVKDKLRDERLRSVKVSSEGIDGFKVMSNSAEDLNKINAFLKETYSGWDIQRSSD
                     QLLIKPSKQNRVDFQSTTLQQNLKIMRDRIEELGITEAMVQRQGEHSIRIELPGVQDP
                     SQAKNVIGATASLAFYEAKSPSEAFTSQDIVLKDENGRNVVLTKRPVLTGDHIVNARA
                     GIDQVGMSEVNISLDHAGGKIMSDFSSKHIGKPMATVYREYTTNARGETERSEKVISV
                     ATIQSQLGSQFRITGAGSMEEAQQLALLLRAGSLTAPVTIVEERTIGASLGAENIQNG
                     FAALALGMALTLTFMALWYRRLGWVANAALLFNMVCLIGLIALLPGAVLTLPGIAGLV
                     LTVGMAVDTNVLIFERIKDKIAEGRSFAQAIDTGFSSAFSTILDANVTTMITAVILYS
                     IGNGPIQGFALTLGLGIMTSMFSGVFASRAVINLIWGRDARRDVRV"
     misc_feature    377230..377334
                     /note="Signal peptide predicted for TVA2810 by SignalP 2.0
                     HMM (Signal peptide probability 0.957) with cleavage site
                     probability 0.540 between residues 35 and 36"
     misc_feature    join(377287..377355,378568..378636,378649..378717,
                     378727..378795,378856..378924,378967..379035)
                     /note="6 probable transmembrane helices predicted for
                     TVA2810 by TMHMM2.0 at aa 20-42, 447-469, 474-496,
                     500-522,543-565 and 580-602"
     misc_feature    377596..377688
                     /note="HMMPfam hit to PF07549, Sec_GG, score 0.00023"
     misc_feature    378475..379041
                     /note="HMMPfam hit to PF02355, SecD_SecF, score 2.9e-07"
     CDS             379071..379973
                     /transl_table=11
                     /gene="secF"
                     /locus_tag="VANGNB10_cII0306"
                     /old_locus_tag="TVA2809"
                     /product="SecD/SecF/SecDF export membrane protein"
                     /note="user locus_tag: VANGcII0306"
                     /note="type II protein secretion"
                     /protein_id="CDQ48203.1"
                     /translation="MIDYLKNHIRPIRYITSVLSVTLMLISLVAFGVKGLNMGLDFTG
                     GMVTEVTVDKTLTNKELLQALKPTLGDSTMITKAGEEGRWVIRYALPESDQETPNIPT
                     LLSDVSEHVTVVSNSMVGSQVGQDLVEQGSLALMICLLCILGYLCFRFEWRLASGSLL
                     ALLHDVILVLGFFALTQMEFNLTVFAAVLAVLGYSLNDSIIIADRIRELLVAKQSTPT
                     KEITDQAVIATFSRTMVTSGTTLLTVSALWLMGGEPLEGFAIAMFIGIISGTWSSISI
                     GTVLPEWLKLEPKHYLPVVVDSAP"
     misc_feature    379071..379166
                     /note="Signal peptide predicted for TVA2809 by SignalP 2.0
                     HMM (Signal peptide probability 0.951) with cleavage site
                     probability 0.921 between residues 32 and 33"
     misc_feature    join(379104..379169,379449..379517,379530..379598,
                     379611..379679,379746..379814,379842..379910)
                     /note="6 probable transmembrane helices predicted for
                     TVA2809 by TMHMM2.0 at aa 12-33, 127-149, 154-176,
                     181-203,226-248 and 258-280"
     misc_feature    379158..379244
                     /note="HMMPfam hit to PF07549, Sec_GG, score 1.6e-05"
     misc_feature    379365..379931
                     /note="HMMPfam hit to PF02355, SecD_SecF, score 1.3e-56"
     CDS             complement(380221..380799)
                     /transl_table=11
                     /operon="nap"
                     /gene="napC"
                     /locus_tag="VANGNB10_cII0307c"
                     /old_locus_tag="TVA2808"
                     /product="cytochrome c-type protein NapC"
                     /note="user locus_tag: VANGcII0307c"
                     /protein_id="CDQ48204.1"
                     /translation="MKLLKAFWKRLTSPSKAAVGIVLFMGFAGGLLFWGAFNTGMEAT
                     NSEEFCSGCHAPIVAEIQETIHYSNRSGVRAICSDCHVPHEWTDKIIRKVQASKELFA
                     HVVLGTISTPEKFQARRAHLAEREWSRLKNNDSLECRNCHEFEYMDFSEQGPRSAKQH
                     STALASGEKTCVDCHKGIAHKLPDMQGVEGWQ"
     operon          complement(380221..384649)
                     /operon="nap"
     misc_feature    complement(380245..380763)
                     /note="HMMPfam hit to PF03264, Cytochrom_NNT, score
                     4.5e-88"
     misc_feature    complement(380674..380799)
                     /note="Signal peptide predicted for TVA2808 by SignalP 2.0
                     HMM (Signal peptide probability 0.951) with cleavage site
                     probability 0.309 between residues 42 and 43"
     misc_feature    complement(380689..380757)
                     /note="1 probable transmembrane helix predicted for
                     TVA2808 by TMHMM2.0 at aa 15-37"
     CDS             complement(380832..381287)
                     /transl_table=11
                     /operon="nap"
                     /gene="napB"
                     /locus_tag="VANGNB10_cII0308c"
                     /old_locus_tag="TVA2807"
                     /product="Nitrate reductase cytochrome c-type subunit
                     (NapB)"
                     /note="user locus_tag: VANGcII0308c"
                     /protein_id="CDQ48205.1"
                     /translation="MKKLLIALLSFGALFGQTVQAELNNPGGNGGLESLRGATQLEET
                     RPADDFKKYPRDQALESEYVYQPPLIPHNIRGYEVSLNANKCLACHSWKNAKEMGATK
                     ISVTHYVNREDAVLADVSPRRYFCLQCHVPQAIAKPLVENEFKSVDSLR"
     misc_feature    complement(380835..381278)
                     /note="HMMPfam hit to PF03892, NapB, score 7.1e-87"
     misc_feature    complement(381225..381287)
                     /note="Signal peptide predicted for TVA2807 by SignalP 2.0
                     HMM (Signal peptide probability 1.000) with cleavage site
                     probability 0.990 between residues 21 and 22"
     CDS             complement(381361..383850)
                     /transl_table=11
                     /operon="nap"
                     /gene="napA"
                     /locus_tag="VANGNB10_cII0309c"
                     /old_locus_tag="TVA2806"
                     /product="periplasmic nitrate reductase precursor NapA"
                     /EC_number="1.7.99.4"
                     /note="user locus_tag: VANGcII0309c"
                     /protein_id="CDQ48206.1"
                     /translation="MKMTRRAFVKANAAASAAAIAGITLPASATNLIASSDQTKITWD
                     KAPCRFCGTGCSVLIGTQNGKVVATQGDPEAPVNKGLNCIKGYFLSKIMYGKDRLTQP
                     LLRMKDGQYHKDGEFTPVSWDQAFDVMAEKWKQALKAKGPTSVGMFGSGQWTVMEGYA
                     AVKLMKAGFRSNNIDPNARHCMASAVVGFMRTFGIDEPMGCYDDFEHADAFVLWGSNM
                     AEMHPVLWTRITDRRLSHPHVKVNVLSTYYHRSFELADHGYIFHPQSDLAIANFIANY
                     IIQNDAVNWDFVNKHTHFKQATTDIGYGLRDEHPLQVKAKNANSGDVTAIDFEAYKAS
                     VAPYTVEKAAQMSGVAEDKLIALAKQYADPNTKVMSLWTMGMNQHTRGVWMQSLVYNL
                     HLLTGKIATPGNSPFSLTGQPSACGTAREVGTFSHRLPADMVVANPKHRAIAEKTWKL
                     PQGTIPEKPGFHAVQQDRMLKDGKLNAYWVQCNNNMQAGPNINEERLPGYRNPENFIV
                     VSDPYPTATAQAADLVLPTAMWVEKEGAYGNAERRTQAWYQQVGTVGEAKSDSWQVME
                     FSKRFKMEEVWPEELLAKAPQYRGKTLFDVLFRNGQVDQFPLEEARELNDDAHHFGFY
                     VQKGLFEEYASFGRGHGHDLAPYDTYHNVRGLRWPVVDGKETLWRFKEGSDPYAKKGS
                     DWDFYGKPDGKAWIISAPYEAPPESPDAEFDMWLCTGRVLEHWHTGTMTRRVPELYKA
                     VPDALCYIHPDDAKARGLRRGDEVLISNKRGEVRVRVETRGRNRPPHGLVFIPFFDAR
                     ILINKLILDATDPLSKQTDFKKCPVKITKVA"
     misc_feature    complement(381385..381711)
                     /note="HMMPfam hit to PF01568, Molydop_binding, score
                     1.8e-35"
     misc_feature    complement(382075..382098)
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
     misc_feature    complement(382141..383559)
                     /note="HMMPfam hit to PF00384, Molybdopterin, score
                     1.4e-137"
     misc_feature    complement(383566..383730)
                     /note="HMMPfam hit to PF04879, Molybdop_Fe4S4, score
                     8.8e-23"
     misc_feature    complement(383662..383715)
                     /note="PS00551 Prokaryotic molybdopterin oxidoreductases
                     signature 1."
     misc_feature    complement(383764..383850)
                     /note="Signal peptide predicted for TVA2806 by SignalP 2.0
                     HMM (Signal peptide probability 1.000) with cleavage site
                     probability 0.961 between residues 29 and 30"
     CDS             complement(383847..384152)
                     /transl_table=11
                     /operon="nap"
                     /gene="napD"
                     /locus_tag="VANGNB10_cII0310c"
                     /old_locus_tag="TVA2805"
                     /product="Periplasmic nitrate reductase component NapD"
                     /note="user locus_tag: VANGcII0310c"
                     /note="This is an uncharacterised protein involved in
                     formation of periplasmic nitrate reductase."
                     /protein_id="CDQ48207.1"
                     /translation="MSLNEVHISSLIVHVVPEHLAALKATIESFENAEVYGQSNEGKM
                     IVVLETENQGFVTDTIDAINNLPHVLSTALVYHQIESGLDDTDTNTGTQHSHIEDDV"
     misc_feature    complement(383907..384143)
                     /note="HMMPfam hit to PF03927, NapD, score 6.8e-31"
     CDS             complement(384155..384649)
                     /transl_table=11
                     /operon="nap"
                     /gene="napF"
                     /locus_tag="VANGNB10_cII0311c"
                     /old_locus_tag="TVA2804"
                     /product="ferredoxin-type protein NapF (nitrate
                     reductase)"
                     /note="user locus_tag: VANGcII0311c"
                     /protein_id="CDQ48208.1"
                     /translation="MVDLSKRRFFSRNQVDDTIVRLPWIAHPLSFSDECTRCGRCLDA
                     CETKIITLGDGGFPTIDFHIDECTFCYQCAQSCPEPIFAPRSTQPWLAKAELEESCLA
                     KRNVECRSCAESCEVSAITFNLVIGKVAQPNVDIDACNGCGACVSICPTSAIRVSNIN
                     NNER"
     misc_feature    complement(384185..384256)
                     /note="HMMPfam hit to PF00037, Fer4, score 2.9e-07"
     misc_feature    complement(384200..384235)
                     /note="PS00198 4Fe-4S ferredoxins, iron-sulfur binding
                     region signature."
     misc_feature    complement(384401..384472)
                     /note="HMMPfam hit to PF00037, Fer4, score 0.0013"
     misc_feature    complement(384416..384451)
                     /note="PS00198 4Fe-4S ferredoxins, iron-sulfur binding
                     region signature."
     misc_feature    complement(384497..384568)
                     /note="HMMPfam hit to PF00037, Fer4, score 0.00011"
     misc_feature    complement(384512..384547)
                     /note="PS00198 4Fe-4S ferredoxins, iron-sulfur binding
                     region signature."
     CDS             384865..386589
                     /transl_table=11
                     /gene="narQ"
                     /locus_tag="VANGNB10_cII0312"
                     /old_locus_tag="TVA2803"
                     /product="Signal transduction histidine
                     kinase,nitrate/nitrite-sensing protein"
                     /note="user locus_tag: VANGcII0312"
                     /protein_id="CDQ48209.1"
                     /translation="MRKRSKQSVTSTIAKAMVSILLLSVAITGYAIFTLASSLNDAEA
                     VNVAGSMRMQSYRLAHDIQSNSVDYSSHIYLFERSLYSPSMKALQRWPVPNDITKDYY
                     QLIIRWHELKSLLNSENKDRYLDEVAKFVSQIDRFVFKLQHFSEQKLIQLAWFGGMGL
                     GGVLCISLFVVHFIRKEVVGPLRSLVTASEQIQNRSFDVSLNVTSHNEMGILTRTFNK
                     MATDLGKLYLGLEQAVNEKTHKLQNANQALQVLYDCSQELTASRISQDNFQAILQHLV
                     TIEGVTFAQLEIGDDAGKSTRLSEGESNGFSLSPLLLSLDGMQLGYLYLQYSLPCPNS
                     ALIDNFVQILSRAIYYNQAQKQAEQLILMEERATIARELHDSLAQSLSYLKIQVSLLK
                     RVIGRAETPHAAEKKEQIILDIDQGLSGAYTQLRELLTTFRLTIKEGNFGQALKGMLE
                     ELGEQTTAEIVLNNNLSSIDLDAHQQVHLLQLIREATINAIKHAQANVIQVNCDELDD
                     QVMVTVKDDGVGFDQQRARLNHYGLSIMQERAARLHGAVSVTSAPNAGCEVILKYKRS
                     KDTNFDEM"
     misc_feature    384865..384972
                     /note="Signal peptide predicted for TVA2803 by SignalP 2.0
                     HMM (Signal peptide probability 0.998) with cleavage site
                     probability 0.762 between residues 36 and 37"
     misc_feature    join(384901..384969,385318..385386)
                     /note="2 probable transmembrane helices predicted for
                     TVA2803 by TMHMM2.0 at aa 13-35 and 152-174"
     misc_feature    385330..385539
                     /note="HMMPfam hit to PF00672, HAMP, score 4.2e-12"
     misc_feature    385957..386175
                     /note="HMMPfam hit to PF07730, HisKA_3, score 8.5e-18"
     misc_feature    386284..386562
                     /note="HMMPfam hit to PF02518, HATPase_c, score 1e-19"
     CDS             386594..387208
                     /transl_table=11
                     /gene="narP"
                     /locus_tag="VANGNB10_cII0313"
                     /old_locus_tag="TVA2802"
                     /product="Nitrate/nitrite response regulator protein"
                     /note="user locus_tag: VANGcII0313"
                     /protein_id="CDQ48210.1"
                     /translation="MLVDDHPLMRRGINQLLSFEDDFEVVAEACNGSEAIALAHDIEP
                     DLILLDLNMKGMSGLDTLTALRADESTATIVILTVSDSALDIEAMVKAGADGYLLKDT
                     EPDELVELLRQAATGVKAYSEFVTQYLAERHTHEDLFEALTDRETQILKEVAKGYRNK
                     QIADRLFISESTVKVHMKSLLKKLRVPSRTAATILYLERYSESK"
     misc_feature    386594..386929
                     /note="HMMPfam hit to PF00072, Response_reg, score
                     1.3e-35"
     misc_feature    387008..387181
                     /note="HMMPfam hit to PF00196, GerE, score 4.2e-24"
     misc_feature    387059..387142
                     /note="PS00622 Bacterial regulatory proteins, luxR family
                     signature."
     misc_feature    387062..387127
                     /note="Predicted helix-turn-helix motif with score
                     1620.000, SD 4.70 at aa 157-178, sequence
                     YRNKQIADRLFISESTVKVHMK"
     CDS             complement(387275..388642)
                     /transl_table=11
                     /gene="dcuC"
                     /locus_tag="VANGNB10_cII0314c"
                     /old_locus_tag="TVA2801"
                     /product="anaerobic C4-dicarboxylate transporter DcuC"
                     /note="user locus_tag: VANGcII0314c"
                     /protein_id="CDQ48211.1"
                     /translation="MLELLIGLAVTVAVGYFIVKGYKPAGVLLTAGIVLLLLTGTLGY
                     SVLPAKVPSTGNTVTDALEFVKYMLRYSGGGLGMQIMLLCGFASYMTHIGANNVVVKQ
                     FSKPLSVITSPYILLVAAYIVACLMSLAVSSATGLGVLLMATLFPMMVAMGISRPAAV
                     AVCASPAAIILSPTSGDVVIAAEKSGLPLHVFAVETVLPVSICAIIVMAIAAFFWNKY
                     LDKKDNTPMEKIDVSAIEVKAPAYYAALPFLPIVGVFLFNGETIQGLSLDIYTIVVGS
                     IFIGALVDFVTKRFKGKETLEDLESCYAGMAEAFKGVVMLLVAAGVFAQGLMSIGAID
                     NLLHLAETAGAGGIALMLILTGLTVAAAIATGSGNAPFYAFVELAPSLAAKLGVNPAF
                     LIIPMLQASNLGRTISPVSGVVVATAGMGHISPFEVVKRTSVPVILGLITVIIGTVIL
                     VPMTA"
     misc_feature    complement(join(387287..387346,387365..387433,
                     387461..387529,387548..387616,387644..387709,
                     387794..387862,387872..387925,387986..388054,
                     388097..388165,388178..388237,388250..388318,
                     388376..388444,388502..388570,388589..388633))
                     /note="14 probable transmembrane helices predicted for
                     TVA2801 by TMHMM2.0 at aa 4-18, 25-47, 67-89,
                     109-131,136-155, 160-182, 197-219, 240-257, 261-283,
                     312-333,343-365, 372-394, 404-426 and 433-452"
     misc_feature    complement(387287..388639)
                     /note="HMMPfam hit to PF03606, DcuC, score 3.9e-189"
     CDS             complement(388939..390066)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0315c"
                     /old_locus_tag="TVA2800"
                     /product="putative fatty acid desaturase"
                     /note="user locus_tag: VANGcII0315c"
                     /note="Similar to Cryptococcus curvatus Delta-9 fatty acid
                     desaturase UniProt:P79078 (555 aa) fasta scores:
                     E()=2.6e-45, 44.371% id in 302 aa"
                     /protein_id="CDQ48212.1"
                     /translation="MESASKPPLIWINIVIFSFSLGLATIAAPLYGWQFGYGMEHWLW
                     LMICFSFCNLSITAGYHRLWSHKTYEAHWALRLLFALGGAFALQNSALHWSSDHRVHH
                     KHVDNNDKDPYSAKRGFWFSHIGWMLRHYNKTTYDDYSNCRDLQKDKIVMWQHKYYVP
                     LALAMNLGVPLILGFIYHDILGMLLIVGALRLVLNHHTTFFINSLAHIWGSQPYTDKN
                     TARDNGILAFFTFGEGYHNYHHIFENDYRNGIYWWQYDPTKWLIKLCSWLGLAGKLRT
                     SPPLKVEKAKALMALSHAQKQIAALPNQQLVMASIQREFDALVIQLQEYYELKKQLIE
                     SKKNNMVRRYEHSLLMLRYRQVKQQLALQKSNWQLIVRQYS"
     misc_feature    complement(389290..389952)
                     /note="HMMPfam hit to PF00487, FA_desaturase, score
                     9.8e-58"
     misc_feature    complement(join(389524..389592,389878..389946,
                     389974..390042))
                     /note="3 probable transmembrane helices predicted for
                     TVA2800 by TMHMM2.0 at aa 9-31, 41-63 and 159-181"
     CDS             390241..390783
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0316"
                     /old_locus_tag="TVA2799"
                     /product="putative GCN5-related N-acetyltransferase"
                     /note="user locus_tag: VANGcII0316"
                     /protein_id="CDQ48213.1"
                     /translation="MEIKAAEYCDFERIAQLHAQSWRTHYQGILGKEYLDNDVLEDRL
                     LIWQTRLINPPFNQHVLLIEEGGLLCGFICAFGNHDFDKGSIIESLHIDENYRGRGIG
                     RQLIQEMAAWFEQYFPNSGVYLEVMADNKQAIEFYDYLAGRPKGERLWRSPCGQDIKE
                     WVYTWTSPTDLLASVSSTVD"
     misc_feature    390421..390669
                     /note="HMMPfam hit to PF00583, Acetyltransf_1, score
                     1.5e-12"
     repeat_region   391114..393594
                     /rpt_family="IS21"
                     /note="ISVch3, repeat region-fragment, complete
                     start/end,missing intermediate sequence in orfA (aa:
                     REMKQYGASRKALFDKLDKPALKPLPKQRYLYTETKRA); believed to be
                     right, also tested via PacBio-sequencing (+454)."
     CDS             391344..392231
                     /pseudo
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0317"
                     /old_locus_tag="TVA2798"
                     /product="transposase, ISVch3-orfA1 (N-terminus_fragment;
                     IS21 family)"
                     /note="user locus_tag: VANGcII0317"
     misc_feature    391410..391475
                     /note="Predicted helix-turn-helix motif with score
                     1186.000, SD 3.23 at aa 23-44, sequence
                     LSNRSIASCLKLGPSTISELLT"
     misc_feature    391746..392228
                     /note="HMMPfam hit to PF00665 (Integrase core domain),
                     rve,score 1.3e-15"
     misc_feature    391887..391910
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
     gene            392234..392764
                     /gene="ISVch3-orfA2"
                     /product="transposase, ISVch3-orfA2
                     (3end/C-terminus_fragment; IS21 family)"
     CDS             392736..393515
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0318"
                     /old_locus_tag="TVA2796"
                     /product="Transposase, ISVch3_aa2, (orfB; IS21-family)"
                     /note="user locus_tag: VANGcII0318"
                     /note="Complete transposase ISVch3_aa2; upstream
                     contiguous to an uncomplete fragment ISVch3_aa1"
                     /protein_id="CDQ48215.1"
                     /translation="MFVARTVITRRKDMNALNDQLKTLRLSHAAKALEQQQEQLTTYA
                     ELDFEERLSLLLESEILNRNQTKIQRLKRQAKLRVDAQPSQLIYKEGRNLNRKQMSEL
                     LTGGYLHKHQNILITGPTGAGKTYLGCALATSACDQQQTVRYYRLTRLLDDLTAGRLD
                     GSYQKQLQSLAKKALLILDDWGMEKLTQEHAGHLLEVLEDRYQNSSTIVISQLPVKEW
                     YNMIGNATVADALMDRLVHNSHRIELGGESMRKLAQSDHLE"
     misc_feature    392835..392927
                     /note="HMMPfam hit to PF08483, IstB_N, score 1.2e-11"
     misc_feature    392928..393374
                     /note="HMMPfam hit to PF01695, IstB, score 1.3e-67"
     misc_feature    393087..393110
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
     misc_feature    393111..393143
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
     repeat_region   393875..396255
                     /rpt_family="IS66"
                     /note="NB10_ISVa5 (2.381 bp; complete); three-orf
                     IS-element"
     CDS             393955..394272
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0319"
                     /product="transposase, ISVa5 (orfA; IS66-family)"
                     /note="user locus_tag: VANGcII0319"
                     /note="Transposase, ISVa5 (IS66-family; 105aa)"
                     /protein_id="CDQ48216.1"
                     /translation="MAKRRTNLEWQSLFEQYESSSVTQRAFCEEHGLSLSTFFAKRRQ
                     LQTVNQSEFVGFVKAEIVEKTTKYQAQIATANMTLLINDVELSIPQGTPATYLAELIG
                     ALS"
     CDS             394269..394622
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0320"
                     /product="transposase, ISVa5 (orfB; IS66-family)"
                     /note="user locus_tag: VANGcII0320"
                     /note="Transposase, ISVa5 (IS66-family; 117aa)"
                     /protein_id="CDQ48217.1"
                     /translation="MKGMLSAPDIYLYRESVDFRKSINGLAAIIENDTDLPLGSGALF
                     LFTNKQRDKIKVLYWDKTGFALWYKRLEKAKYKWPSKEKNQVFTLTQFELDRLLSGFT
                     IIGHEPVKINDFTMS"
     CDS             394682..396223
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0321"
                     /product="transposase, ISVa5 (orfC; IS66-family)"
                     /note="user locus_tag: VANGcII0321"
                     /note="Transposase, ISVa5 (IS66-family; 513aa)"
                     /protein_id="CDQ48218.1"
                     /translation="MEKTPNINPESQDIAELQAMVKALMLSQEQKESQWQQERQSLLE
                     QLKLAFDRQFAKRSEALKPYDESQGDLFNEAECEAVKEEEVEVTTTITTKKRGKRKPL
                     PKTLPREVIELDLDDHEKQCSCCNHGLHKIGEDRSEKLEFTPAVLKVLEYVRPKYACR
                     QCEKTGDSSHIVQKPSPQSLIPKSFATESLLANIILGKYQYAMPLYRQESLFTQSGIE
                     LSRTTMARWVIQVSEKFAPLYAALKKYLLQQVVVQADETPLNVLKEEKKCYMWLYCSG
                     ADSPEAALPNVKNIALYDYQNSRARACPIAFLGDYNGYLQTDGYAAYDGLHQVTNVGC
                     LAHARRKFMDAKKLQGKGKSGKADKALAKIQKLYGIESRLKGAPAEERKAERQALAKP
                     ILDELYQWMTTQKVIGSSPLGKAIKYTLGQWSKLTRYIDDGHLSIDNNRAERAIKPLV
                     IGRKNWLFSNTPNGADASAMLYSIIETAKANGLILYDYLVKCMKELAKAEPDIDALLP
                     WNFKH"
     CDS             396281..396415
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0322"
                     /old_locus_tag="TVA3221"
                     /product="putative transposase, ISVsa8 (fragment)"
                     /note="user locus_tag: VANGcII0322"
                     /note="The CDS seem to be truncated"
                     /protein_id="CDQ48219.1"
                     /translation="MERDPASSSIESLMRLLSSLDLELHIEDKSASREKAKFRDADDW
                     "
     CDS             complement(396801..397901)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0323c"
                     /old_locus_tag="TVA3220"
                     /product="Putative RNA-directed DNA polymerase (reverse
                     transcriptase), msDNA"
                     /note="user locus_tag: VANGcII0323c"
                     /note="RT_like superfamily"
                     /protein_id="CDQ48220.1"
                     /translation="MNKKVSDEFFNNAILKGNVALLDDFSTSVIERKSGADIFFEILK
                     DSDHKIVNDRITRFVLSKIPVNSSACGFVPGKSYYDFLRPHISGYYFLRLDIKKFFHS
                     ISVLEVKNLLSQYFSDDKKGAKYSALDIAYMSITHKVNNNFDDDDIKGKEILPIGFSS
                     SPVVSNIIFRRIDILIQKLCEDKGIVYSRYADDMLFSSSKSRYLHSEQFERDISIFVS
                     TLSLKLKKRKRKAVENTISLNGYVIQNTKLKKNLFFNVYKQDPIGSIRLSDKKLKHLK
                     KLSALLRKNRDSVYIMENIFQLNYNKFKRTYGENINFYIQYSDDQLQNKIKGYRSYLV
                     SLIKYNEKYGCVANNCIVKVKELVRVFESNIK"
     CDS             complement(398077..400194)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0324c"
                     /old_locus_tag="TVA3219"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0324c"
                     /note="The CDS contains: PS00017 ATP/GTP-binding site
                     motif A (P-loop)"
                     /protein_id="CDQ48221.1"
                     /translation="MTVQAIKITNLLSFDELVVNNLNDMNCIVGRNNVGKSNLLKVLK
                     FFYNKLEGKEELPPKLNSNYSYKGSISITFDMTRIFRIARKQPTNTYFAFIIRKLVPL
                     HKRSMFTLMRYDNDHTTYTLTLNIYNDGKVKWSTNDKQTLNLILYLFPFFHIEPRHMD
                     LHEWDSLWDLISRLKSFNLSKIDDQTIIDFFDKSINADGESSYKNYISELNSTISTKP
                     STQKEKLLSYIKAGLKGYRFEIDENDLKYHSDGTNSFHFIKTFLKILITISRREYITP
                     FVFIDEPELGLHPKMNEVLIHDIYNSYKYNNGRDHKVTRPRVFLTTHSPNIVKEIIKK
                     FRDYQRVFCFQKRSDSTTSIHTLNSTYDSESFINTFSDNEARLFFSDYILFVEGESEL
                     EVFGNMRLSEHFPHLRNIDIYKSSSNVIGERVNPSYSNSAIPYMFLFDADKAISVKGQ
                     PNSFELKLQKNGNYFNFWKKTLEAEFNKYKLGFSKKHKDKMENVKYLLSYDKKNLKVD
                     PTKQDFLKESDFDKIFSAVKKRLLEKNIYINRTTLEGCLIQKSSAEILYGWLDKKYGT
                     NTQSIITRINNSKFITEDMLIDYIRVIFNGKSKALTDYSHFNVEAYKQTMQKGNKVNG
                     NLRYTSRHAKLLMGLLEQATVKNKDLEKTDGWTTNFINYAVEYIETQSLHKNQTFGST
                     FKVYFPELYDIIRMLQPDSRGEI"
     misc_feature    complement(400084..400107)
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
     CDS             complement(400342..401142)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0325c"
                     /old_locus_tag="TVA3218"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0325c"
                     /protein_id="CDQ48222.1"
                     /translation="MERIEPFNAQTLEAACRVLADTERGLTGAELGYLIQDCKILDIS
                     PTMTKWKRLFNALVSAQNTYQVGNHLIMFINRALNPVNYARDKEKFEWRRSELNVVLS
                     FSGFHVREDGKTIRTDKETTLKGARERAGALRVKLEDRGAHTEVFKYCRAELLDENYF
                     HAALEAIKGIAQRIRDMSLLTTDGAELVNTAFSVKNPVLKINSLTTETEISEQKGFSN
                     MLVGLFGAVRNPVAHAPKMYWVMSEQDALDVLSTTSFIHRKLDIAVKA"
     CDS             402061..402441
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0326"
                     /old_locus_tag="TVA3217"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0326"
                     /protein_id="CDQ48223.1"
                     /translation="MKARIGIVSEDTIRKHMINVATGAVQQSEDIPKHWFTSLDEVSK
                     VLSIENIELMLLIAKEKPHSLRELANISKIDICELENTIKTLSSKGFVRIEKQGTASR
                     PIALFSDFEIVFGQELENELRGNR"
     CDS             complement(402923..403117)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0327c"
                     /old_locus_tag="tva3216b"
                     /product="putative uncharacterized (membrane associated)
                     protein"
                     /note="user locus_tag: VANGcII0327c"
                     /protein_id="CDQ48224.1"
                     /translation="MFIIGTQYYSIFLYGGPTKGGYTASILFFEDFFVDMLQLPGYVQ
                     FVALAFVLYLAFFCHPRLEK"
     CDS             complement(403221..403937)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0328c"
                     /old_locus_tag="TVA3216"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0328c"
                     /protein_id="CDQ48225.1"
                     /translation="MQAVTLSNRYISNGILKNQFIREVDRFEQCLVNDFESGKTSKDA
                     VLNALKKEQRNLIEQGKLIGQKGIGFVAGVMQVMAGAGMCYASAATLCFIGAPMAAHG
                     SNNIYENGKFFIDGDKNATGLVREGYQYVAKTLGYSKSHGDIAYYGADLAMSAYGVVA
                     KTTSVKNASNAYQIASKPNLKVMPWTKTRKAKQFKLFRYSSEDFLRGYQAASKGALSI
                     EALSDTNTLYSINEEVRHID"
     misc_feature    complement(403671..403739)
                     /note="1 probable transmembrane helix predicted for
                     TVA3216 by TMHMM2.0 at aa 67-89"
     CDS             complement(404003..404476)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0329c"
                     /old_locus_tag="TVA3215"
                     /product="Type VI sectretion system effector, Hcp1 family"
                     /note="user locus_tag: VANGcII0329c"
                     /note="IPR008514: This entry includes the virulence
                     protein Hcp1 from Pseudomonas aeruginosa, pathogenic
                     bacteria that can cause chronic lung infections in cystic
                     fibrosis patients. Hcp1 is a hexameric protein that forms
                     rings with a 40-angstrom internal diameter
                     (PUBMED:16763151). Hcp1 functions during chronic P.
                     aeruginosa infections, and can be detected in secretions
                     from infected cystic fibrosis patient. Hcp1 appears to be
                     part of a protein secretion apparatus that is required for
                     virulence. Several bacterial pathogens mediate
                     interactions with their hosts through protein secretion,
                     often involving Hcp1-like virulence loci, which are widely
                     distributed among pathogenic bacteria."
                     /protein_id="CDQ48226.1"
                     /translation="MAHTAYLKIIGKTQGLISQGCNTKDSIGNKAQDSHSDEITVLAC
                     NFSLSKHGGPAEVSITKPIDKASPLLGNSFSKQEHLQCSINFYRTNEQGYNEQFYTIE
                     LVDALISTLSFNQPNVLQSGDEDMSEELALSYRDIIWKHKLAGTEGYETWERLVK"
     misc_feature    complement(404051..404467)
                     /note="HMMPfam hit to PF05638, DUF796, score 7.4e-39"
     CDS             404754..404990
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0330"
                     /old_locus_tag="TVA3214"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0330"
                     /protein_id="CDQ48227.1"
                     /translation="MSKIQPSEKEWFEGITLSAVQAYELTTLTSRKLVLAQNDFLAEE
                     DKMRLVSYRFSDINEEDLMEGDEFFTELDSGKYD"
     misc_feature    404919..404957
                     /note="PS00018 EF-hand calcium-binding domain."
     CDS             complement(405289..405816)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0331c"
                     /old_locus_tag="TVA3213"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0331c"
                     /protein_id="CDQ48228.1"
                     /translation="MDIKTALQRLYKFDRQGIYVYTKSNLRRVFFDDSAEAFKQSLSR
                     LIKFGVLERACRGVYVFALSRHEGGYTIEYVTKSLRRGEYNYISLESALSEYGAISQI
                     PIDRLTVMTTGRKGTFKTAYGVIEFTHTERSGINILNNTILYDRPLRIATESAAIRDL
                     KRVGRNTHMLCNEFD"
     CDS             complement(405886..406884)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0332c"
                     /old_locus_tag="TVA3212"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0332c"
                     /protein_id="CDQ48229.1"
                     /translation="MARPKSYTDQDLIQIVQEISSQGDEVSTWRIKEQLGRGKLSTIK
                     RDLERLIDSGEIDTTRKEQNTAATENPVIASYELPIEVQNLLAQSEQEICKIIQRITT
                     SLNCQVHQHYENLMNARIHEFDTKTDLAIKAQAMAENTCAEMEVRLLKQIELNESLEE
                     KIEHLDELLMESRHQQSDLIKTNNQLTNSLKHTTEKLDSHQETINELKASLAKIEKGF
                     AAQAVQLEYSRNEAKSYELRLSEQIERHEQTVQKLNEALAELKSTQTALAESDTLLRK
                     VQAEHQALSVNNKFLETSLRQSQETITDLNTRNQKLEQQLSQRGEKSDTLSEPVIK"
     CDS             complement(406959..408476)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0333c"
                     /old_locus_tag="TVA3211"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0333c"
                     /note="Similar to Vibrio mimicus VM223 subname:
                     full=putative uncharacterized protein UniProt:Putative
                     (505 aa) blastp scores: E()=0.0"
                     /protein_id="CDQ48230.1"
                     /translation="MKTIHLYHSRVNYTSRQDDRRACEASLRHSLRITHRITEGGNFE
                     PFETKTSIQWLPELLPCNKIHVNGKITRLDPWGHEEKWRLLYQVAPAPKLHMHKKLQS
                     QRTSYKHKIKKAITSLLKAGNDEAAEFLNNILNTKGRCSYSKISRFKLLPMTYKAQRI
                     KMLEKYLDAHNQLVSFPNANNLYVQEGIFKIPAKWGVSNKLITTEEYIHFTEFFLKHH
                     FPEYPIFFVVAHDDERLVDEDTGAHTHYFLSAQNSVTGEFDLLKAQIAVVNSYIQDRH
                     PKIELLPKGGKLNRSQNKQFGEYFQRLVFNFANEHLLHSKGLHAELAPESERRSQQRK
                     QMNRESRLPKEERTYNFQNRLIEAQQAKLAELEQQTQIQKQLLDETVMQQSIVQGELM
                     MQEDQKEQNDQELTIQHQTITELRTERRKLERVLDSLKDGIIEPLSRFCQQVFLGLKA
                     QQSGQKKMVESFLDTTMKEMLMLPPHMQTRAKILLKSVDLEPNKMADRETQQLDK"
     CDS             complement(408574..409674)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0334c"
                     /old_locus_tag="TVA3210"
                     /product="phage integrase family protein"
                     /note="user locus_tag: VANGcII0334c"
                     /note="IPR002104 Integrase_cat-core_phage"
                     /protein_id="CDQ48231.1"
                     /translation="MTVKTMSSTQSFSHYLDIFIADGEYRKVKSTKNGEQPRINRLRK
                     IFGEEDLRSIKHSTLRMTIAGWHSHLKNKTINEHLTILRFVFSTGLADQSIDHNPMEN
                     IKNLLVEKTEPDPFTKTEIARLSNCNDVCPQVKNATALDILTGLRISELIALCWDDVD
                     WKNKKLYVRRACVLDVYKCPKTTDSVRDVDLNPLAISILKSQLKLTGKRRSKTVNVLQ
                     RDNKTLKQESLNFIFVNTKTNQPFTDAKEFTERFFKNYLMSAGVRHRGVGQLRHTFAS
                     QCLTAGINKEWLAQQMGHSDTKMIDRHYGKWIREDSSDCSLQAARHLQDSFGLLISDS
                     DIKLPSATKLALDPSQTFHLSQQQKSVMESAR"
     misc_feature    complement(408763..409248)
                     /note="HMMPfam hit to PF00589, Phage_integrase, score
                     2.9e-09"
     misc_feature    complement(409351..409380)
                     /note="PS00215 Mitochondrial energy transfer proteins
                     signature."
     CDS             complement(409983..410222)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0335c"
                     /old_locus_tag="TVA3209"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0335c"
                     /protein_id="CDQ48232.1"
                     /translation="MNSITKPKNITGERIKKTRLDKGLSQQDVERIATLRGMDLTRSK
                     LAKIETGMIRVTDEILHNLAVVLDVSVNVFFDDFS"
     CDS             410471..410680
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0336"
                     /old_locus_tag="TVA3208"
                     /product="putative uncharacterized (membrane associated)
                     protein"
                     /note="user locus_tag: VANGcII0336"
                     /protein_id="CDQ48233.1"
                     /translation="MGSAALYHSEVWKHDLNIAEWLVGGFFYVAGVFFVSGLVFLFIA
                     LIQTILDFDYYSFKKEVTSNLNKII"
     misc_feature    410540..410608
                     /note="1 probable transmembrane helix predicted for
                     TVA3208 by TMHMM2.0 at aa 24-46"
     CDS             complement(411451..413109)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0337c"
                     /old_locus_tag="TVA3207"
                     /product="Putative DNA (cytosine-5-)-methyltransferase"
                     /note="user locus_tag: VANGcII0337c"
                     /protein_id="CDQ48234.1"
                     /translation="MNQYTTLKGDQEFESYIEHCHQETNKLLKLLITIYDQKNLAIKF
                     QELGGEFCEISREKLNRWKADPVANPISLGDSSLKKLRSTLLPKKPAHWDNPNFTFLD
                     LFAGIGGLRKGFENVGGKCVFTSEWDEKARRTYLANHYVDESELPYFLNSEQEDGAKN
                     TSFMDITQITLSGDPEATELQQQASILKHIPKHDVLLAGFPCQPFSLAGVSKKNSLGR
                     AHGFECDTQGTLFFDVQKILEARQPKYFVLENVKNLKSHDKGKTFATIIRTLDQVGYW
                     VADITDVDSDIEEAIKVVRKRKPEPTIIDGMNFTPQHRERIVLVGVRKDLVEKNPEYK
                     KLSLKNIEVPQKRLRVSDILTNLSEEETKKYTLTPNLWNYLYHYALKHQSKGNGFGFG
                     LVDPSNPNAVTRTLSARYYKDGSEILINHQGIPEQYLADNREHGFRKNKERLEFSTNF
                     ADRYAKQNPECTEKQYKEMIKEGEAKYDQEHGRYAPEFDPLYKTPRRLTPRECARLMG
                     FEDVNDPYSEFRIVCADAPAYKQFGNSVVVPVFSAVAKLLTSYM"
     misc_feature    complement(411460..412542)
                     /note="HMMPfam hit to PF00145, DNA_methylase, score 9e-60"
     misc_feature    complement(411466..411522)
                     /note="PS00095 C-5 cytosine-specific DNA methylases
                     C-terminal signature."
     misc_feature    complement(412492..412530)
                     /note="PS00094 C-5 cytosine-specific DNA methylases active
                     site."
     misc_feature    complement(412693..412818)
                     /note="HMMPfam hit to PF00145, DNA_methylase, score
                     4.1e-16"
     CDS             complement(413184..414632)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0338c"
                     /old_locus_tag="TVA3206"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0338c"
                     /protein_id="CDQ48235.1"
                     /translation="MYEINQYDHININDLDDVRGLLKKHECSIALIKSLPKNANDKNQ
                     VYFHSDASLLNSIFDLRFSDRGESSSETKRSSDPGKLIPQAEFHHFSWLDTDGNAVRA
                     KQCKAIVYAQYPEARLSGFQTVNREMPRCMSIEYTKRADYLPRYLVLGANRSGHAFAV
                     LVVDPNRLFIEQFNQLENYFGSKVCKAFNIDLGEDSGTEKLKELLKANVAGKTLLGCR
                     LKLGETVPFTGTQVHGYTLEHALGIAPNADKEGDIFGIELKCFTRKKLTLFTPEPDGG
                     LYKESFPDFMTTYGYKKNDVYRLTGLHRAYQENEKTQLTLKIQCFHPIVTKDENGKKT
                     THFEHGLYNPKKPITKQMTGMEVVLEDRQGKIAASWSIERLLNCWGAKHNEVVYIPAT
                     KLPNDEPNSLAAGYTFKIEFPDEVLWCLNTNAERLFQAIHSGTVYLDPAPKFHPTDAK
                     QSKRRSQWRINDIYKASSELYEEVHFISLNPK"
     CDS             complement(414906..415310)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0339c"
                     /old_locus_tag="TVA3205"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0339c"
                     /protein_id="CDQ48236.1"
                     /translation="MTAVECIYQKIKRSRRYVFERKDFDNVASYDQVGRALRQLVKQG
                     DLIKIGYGLYTKAKLNSLTGKPMPTHPGGTDALIREILKMKGVDFEMDNLSWQSLSGQ
                     STQIPSSVQYSWNPKQFNRKLVVGNRVLNSQN"
     CDS             complement(416140..417489)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0340c"
                     /old_locus_tag="TVA3204"
                     /product="putative uncharacterized integrase family
                     protein"
                     /note="user locus_tag: VANGcII0340c"
                     /note="Putative integrase; PROPHAGE_Escher_Sakai:
                     phage(gi15834496); Evalue=2e-14. IPR023109
                     Integrase/recombinase, N-terminal; IPR011010 DNA
                     breaking-rejoining enzyme, (IPR013762 integrase-like)
                     catalytic core. Putative phage(gi15834496)-ortholog."
                     /protein_id="CDQ48237.1"
                     /translation="MYLIKLSNNVFYTRISTPAILQTSLGYPREIRLSLFTKYRRLAT
                     KRNAQLASAIHTLHEQALAESIPYTDFKISLSTKVAEIRQQFCSNLPHVDNPQSKSTS
                     RIIETRAMSAPAPAPAPAPAPETIVNSSMISKQELLTELNNFIHSKRLEQVTPLTLTQ
                     LNQRCTNFLDYLTKQNVSLSAKAATTYRDHLIEKGLSCKTVKEYISANKQFFDYCEQI
                     ELIDKNVFKAIKAPKTRGTKASQQRDRWQLKEIKRLFSSSEFRKKDAQFQWTTKLQIY
                     QGCRPSEVCQLTTPNIQMIDGVPCITVSDSEADQRLKTSNASRIVPLHNQLIKEGFLE
                     YVQERREQKQKQLFNYKPHGENKDWSFRYRTNLGKLQTAIGMKPNARPTSYSFRHTFI
                     DELKIANTPEHIVAEIVGHAHPNITYGRYGKQAKIQQLHEAVNSFPVVEVKGEVCVN"
     misc_feature    complement(416197..416730)
                     /note="HMMPfam hit to PF00589, Phage_integrase, score
                     0.00011"
     tRNA            complement(417572..417659)
                     /product="tRNA-SerTGA"
                     /anticodon=(pos:complement(417623..417625),aa:Ser,seq:tga)
                     /note="tRNA Ser, anticodon TGA, Cove score 65.93"
     CDS             417974..418651
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0341"
                     /old_locus_tag="TVA3203"
                     /product="Putative MaoC domain protein"
                     /note="user locus_tag: VANGcII0341"
                     /protein_id="CDQ48238.1"
                     /translation="MKVENLFKHRGDSMNKYSSELMQWVSPSVREYWGELLHKTNSRQ
                     LFSWVRDFHQPAVNEDAPIAEPLILKPEAQRLYKQLQTQIGEVIHTGKWLVVDQERIN
                     QFGQVTEDMQWIHTDPQKAEVDSPFRTTIAHGFLTLALLPKLTDSVDPDKPIFPTAKM
                     VVNIGLNEVRFPYPVKSGNRVRAISTLLKVTPIKKGLEIEREIKVEIEGIRRPGCVVV
                     SVIQLHF"
     misc_feature    418208..418600
                     /note="HMMPfam hit to PF01575, MaoC_dehydratas, score
                     8.4e-19"
     CDS             complement(418705..419526)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0342c"
                     /old_locus_tag="TVA3202"
                     /product="ABC transporter, periplasmic substrate-binding
                     protein"
                     /note="user locus_tag: VANGcII0342c"
                     /note="IPR011862 Phosphate binding protein (IPR024370
                     -domain); HOMOLOG/ORTHOLOG SPECIES: PHAGE_Synech_S_SM1"
                     /protein_id="CDQ48239.1"
                     /translation="MFRVALATLLSTLLHTQFAFASEVNISGSTSVARIMEVFAEDYN
                     TAHPETYIAVQAVGSSAGITLLKKGVADIAMSSRYLTESEQDETMSTLPIAYDGLAVV
                     INRLNSIENLTREQLFDIYKGKITNWKQVGGADQKIAVVTREASSGSRYSFESLLGLT
                     RVINDRLVSDISSNNLVVNSNSMVKTLINHNPQAIGFISTGSVDKSIKAIKFDGVEAT
                     AKNIVTHEYKLSMPFLVVYYPEKITKETQAFIASLKSAEAKARIEEYGYIPLKNK"
     misc_feature    complement(418747..419523)
                     /note="HMMPfam hit to PF01547, SBP_bac_1, score 6.2e-05"
     misc_feature    complement(419464..419526)
                     /note="Signal peptide predicted for TVA3202 by SignalP 2.0
                     HMM (Signal peptide probability 1.000) with cleavage site
                     probability 0.999 between residues 21 and 22"
     CDS             419686..420051
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0343"
                     /old_locus_tag="TVA3201"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0343"
                     /protein_id="CDQ48240.1"
                     /translation="MSEGKMAVVNLLQRQLERRAELVCHNRNQSVSVELGKSCFEPIV
                     NGVHFIKHHYKLDSTHCDYSSIVAKVIWEEAKWALYIPNTDPDKEIEDWLPYPFLPKT
                     TDLTALIREIEKDPKSYFW"
     CDS             complement(420113..422122)
                     /transl_table=11
                     /gene="rnb"
                     /locus_tag="VANGNB10_cII0344c"
                     /old_locus_tag="TVA3200"
                     /product="Ribonuclease II/ribonuclease R"
                     /EC_number="3.1.13.1"
                     /note="user locus_tag: VANGcII0344c"
                     /note="Phage-like protein (gi115304286):
                     IPR004476,IPR011804, IPR012340 Nucleic acid-binding,
                     OB-fold; also cfr: P30850 RNB_ECOLI (K12)"
                     /protein_id="CDQ48241.1"
                     /translation="MFQDNPLLAQLKQQIQENLPKKEGTIKATEKGFGFLEVDSKNSF
                     FIPPPYMKKCLHGDKVVAIIRTENEKEVAEPQELLEPSLTRFIGRVKLYKGKLNVTPD
                     NPQLKRQSLKAKVQKGLNPEHFSEGDWVVAQLINHPLKDDSGFMVEITHKITDANDKI
                     APWWVTLAENDLPNSEPAGIEHWQLKDDADLQRIDMTHLPFVTIDGASTKDMDDALFA
                     QRTENGDFTLTIAIADPTAYITPDDEMDSVARERGFTIYLPGRNIPMLPRDLADDLCS
                     LMENEVRPALCCTVTVTKEGVIGDDITFFAANIKSHARLVYDHVSDWLETGTSADWQP
                     SDQIASVVRDLYDFSLARAQWRETYAVVFPDHPDYRFELSEDNDVVAIHADLRRSANR
                     LVEEAMITANICAGKTLKAHFGQGVFNTHAGFKPEKIADVVELVNPTGELEYTADNLA
                     TLEGFASLRRWLCKQETRYLDNRIRKYQAYSEIGNQPLPHYAMGLDIYATWTSPIRKY
                     GDMINHRMLKAHILNKEPVQTPDETVGEELALHRKHHKMAERNVGDWLYARTLVNEPS
                     KGTRFTAEIFDINRAGMRVRLLENGAAAFIPGSLILDNKERIECNAESGTLLVDKEVV
                     FKLGDTLEVMLAEVNMENRSLIAKPTQVFEPLPIPSEANTTTQGE"
     misc_feature    complement(420179..420433)
                     /note="HMMPfam hit to PF00575, S1, score 2.8e-12"
     misc_feature    complement(420554..421546)
                     /note="HMMPfam hit to PF00773, RNB, score 3.3e-119"
     misc_feature    complement(420581..420655)
                     /note="PS01175 Ribonuclease II family signature."
     misc_feature    complement(420899..420922)
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
     misc_feature    complement(421880..422053)
                     /note="HMMPfam hit to PF08206, OB_RNB, score 7.1e-19"
     CDS             422485..424503
                     /transl_table=11
                     /gene="deaD"
                     /locus_tag="VANGNB10_cII0345"
                     /old_locus_tag="TVA3199"
                     /product="DNA/RNA helicase, DEAD/DEAH box type (RNA
                     helicase). Putative phage(gi310831360)-ortholog."
                     /EC_number="3.6.1.-"
                     /note="user locus_tag: VANGcII0345"
                     /protein_id="CDQ48242.1"
                     /translation="MQDSVIQFSELALNDSILSALNEMGFVSPTPIQAAAIPFLLEGR
                     DALGKAQTGTGKTAAFSLPLLNKLNLSQHKPQAIVMAPTRELAIQVAAEIKNLGQKIQ
                     GLKVLEIYGGASIVDQMRALKNGAHIVVGTPGRVKDLITRDRLHLDECHTFVLDEADE
                     MLKMGFVDDVTWIMEQAPGTAQRVLFSATMPPMVKTIVDRYLRDPARVDVAGSNQTVA
                     KVEQQYWVVKGVEKDEAMARLLETEETDASIVFVRTRQDTERLADWLLSRGFKAAALH
                     GDIPQSLRERTVDHIKQGVIDILVATDVVARGLDVPRITHVFNYDIPFDVESYIHRIG
                     RTGRAGRKGKAILLVRTNQIRMLRTIERVTRSQMEEIQLPMRDKVAEARLIKLGAELE
                     ADKGHTALDKFVELIEKLQQSLEIDATTLAAILLKRQQGNRPLFYVGPDPMVDAIERE
                     KSRRRDRKEGSERGERREGGRDSRDGREGRREYGTASNDWDTYQLQVGREQGVQVKDI
                     VGALANELGLTKGSIGAIKLAQGHTFVQLPKSMSSDVEGKLRKLRIRQKEVGAVVCDF
                     DDFRESRGRREGGNGGGARREGGNGGFRNREGGAPAAGAGRGGREGGFRGNRDGAAAT
                     GRDGERRFDRNRGGDHRGNFRGERGHGNASANANANAGTLSRPRRAEA"
     misc_feature    422572..423075
                     /note="HMMPfam hit to PF00270, DEAD, score 2.9e-69"
     misc_feature    422632..422655
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
     misc_feature    422944..422970
                     /note="PS00039 DEAD-box subfamily ATP-dependent helicases
                     signature."
     misc_feature    423274..423504
                     /note="HMMPfam hit to PF00271, Helicase_C, score 3e-35"
     misc_feature    423913..424179
                     /note="HMMPfam hit to PF03880, DbpA, score 9.2e-34"
     CDS             424717..426645
                     /transl_table=11
                     /gene="thrS"
                     /locus_tag="VANGNB10_cII0346"
                     /old_locus_tag="TVA3198"
                     /product="threonyl-tRNA synthetase"
                     /EC_number="6.1.1.3"
                     /note="user locus_tag: VANGcII0346"
                     /protein_id="CDQ48243.1"
                     /translation="MPIITLPDGSQRHFEHPVSTMEVAASIGPGLAKATIAGRVDGVR
                     VDACDLIENDASLEIITTKDEVDGLEIVRHSCAHLLGHALKQLYPQAKMAIGPTIDSG
                     FYYDIDLEQSLTQDDLEQIEKRMKELAKTKYQVVKKKVSWQEARDAFEARGETYKMEI
                     LDQNVARDDRPGLYHHEEYIDMCRGPHVPNMSFCQHFTLLSIAGAYWRGNSDNKMLQR
                     IYGTAFHDKKALQAHLTRLEEAAKRDHRKIGKQLDLFHMQQEAPGMVFWHHNGWSIFR
                     DLEVFIRQKLSEYDYQEVKGPLMMDRVLWERSGHWDKYADAMFTTSSENREYAIKPMN
                     CPGHVQIFNQGLKSYRDLPLRMAEFGSCHRNEPSGSLHGIMRVRGFTQDDAHIFCTED
                     QIQQEVTSCIKMVYDTYTTFGFDNIVVKLSTRPEKRVGSDEIWDKSEEALKLSLQAMD
                     IPFEIQEGEGAFYGPKIEFTLHDCLDRAWQCGTVQLDFNLPARLGATYVGESNERLVP
                     VMIHRAILGSLERFIGILIEEYAGFFPTWLAPEQAVIMNITDKQSVYAQEVAQKLQKC
                     GIRAKADLRNEKIGFKIREHTLKRVPYMLVCGDQEMEAGEIAVRTRRGKDLGKFKLDD
                     FIAYIQAEVSSRKLNLEE"
     misc_feature    424720..424899
                     /note="HMMPfam hit to PF02824, TGS, score 1.5e-13"
     misc_feature    425227..425376
                     /note="HMMPfam hit to PF07973, tRNA_SAD, score 4.1e-23"
     misc_feature    425536..426033
                     /note="HMMPfam hit to PF00587, tRNA-synt_2b, score
                     8.4e-64"
     misc_feature    425803..425868
                     /note="PS00179 Aminoacyl-transfer RNA synthetases class-II
                     signature 1."
     misc_feature    426262..426291
                     /note="PS00339 Aminoacyl-transfer RNA synthetases class-II
                     signature 2."
     misc_feature    426340..426612
                     /note="HMMPfam hit to PF03129, HGTP_anticodon, score
                     2.9e-33"
     misc_feature    426685..426915
                     /note="HMMPfam hit to PF05198, IF3_N, score 5.9e-40"
     CDS             426811..427200
                     /transl_table=11
                     /gene="infC"
                     /locus_tag="VANGNB10_cII0347"
                     /old_locus_tag="TVA3197"
                     /product="translation initiation factor IF-3"
                     /note="user locus_tag: VANGcII0347"
                     /note="IPR001288: Translation initiation factor 3;
                     PHAGE_Cronob_vB_CsaM_GAP32 (Evalue: 3e-11)"
                     /protein_id="CDQ48244.1"
                     /translation="MDLVEISPNAEPPVCRVMDYGKFLFEKSKTAKEQKKKQKQIQIK
                     EIKFRPGTDIGDYQVKLRNLTRFLEEGNKVKVTIRFRGREMAHQDIGVDVLHRLKEDT
                     AEIAVVESFPSRIEARQMIMMLAPKKK"
     misc_feature    426856..426897
                     /note="PS00938 Initiation factor 3 signature."
     misc_feature    426928..427194
                     /note="HMMPfam hit to PF00707, IF3_C, score 2.3e-53"
     CDS             427304..427498
                     /transl_table=11
                     /gene="rpmI"
                     /locus_tag="VANGNB10_cII0348"
                     /old_locus_tag="TVA3196"
                     /product="50S ribosomal subunit protein L35"
                     /note="user locus_tag: VANGcII0348"
                     /protein_id="CDQ48245.1"
                     /translation="MPKMKTNKGAAKRFKKTAGGIKFKHATKRHILTKRTTKNKRQLR
                     PNSILPKCEVAGVMRMLPYA"
     misc_feature    427313..427348
                     /note="PS00936 Ribosomal protein L35 signature."
     misc_feature    427313..427486
                     /note="HMMPfam hit to PF01632, Ribosomal_L35p, score
                     9.3e-30"
     CDS             427540..427893
                     /transl_table=11
                     /gene="rplT"
                     /locus_tag="VANGNB10_cII0349"
                     /old_locus_tag="TVA3195"
                     /product="50S ribosomal protein L20"
                     /note="user locus_tag: VANGcII0349"
                     /protein_id="CDQ48246.1"
                     /translation="MPRVKRGVQARARHKKVLKQAKGYYGARSRVYRVAFQAVTKAGQ
                     YAYRDRRTKKRQFRQLWIARINAASRQNGLSYSRFINGLKKASIEIDRKILADIAVFD
                     KAAFAVLVEKAKTAL"
     misc_feature    427543..427866
                     /note="HMMPfam hit to PF00453, Ribosomal_L20, score 3e-64"
     misc_feature    427699..427749
                     /note="PS00937 Ribosomal protein L20 signature."
     CDS             complement(427965..428489)
                     /pseudo
                     /transl_table=11
                     /gene="intIA"
                     /locus_tag="VANGNB10_cII0350c"
                     /old_locus_tag="TVA3194"
                     /product="Putative Phage integrase, catalytic
                     core,site-specific recombinase, IntIA (partial)"
                     /note="user locus_tag: VANGcII0350c"
                     /note="Integrase, integron-type (IPR011946); Similar to
                     Vibrio anguillarum (Listonella anguillarum) intia subname:
                     full=site-specific recombinase intia UniProt:Q84BL3
                     (EMBL:AY126447) (320 aa) fasta scores: E()=2.6e-68, 100.0%
                     id in 167 aa, and to Vibrio anguillarum (Listonella
                     anguillarum) intIa subname: full=site-specific recombinase
                     intia UniProt:Site-specific (320 aa) fasta scores:
                     E()=2.6e-70, 100.0% id in 166 aa. DNA breaking-rejoining
                     enzyme, catalytic core. Putative
                     PHAGE-Staphy-PT1028-ortholog."
                     /db_xref="PSEUDO:CDQ48247.1"
     misc_feature    complement(427992..428186)
                     /note="HMMPfam hit to PF00589, Phage_integrase, score
                     4.5e-23"
     repeat_region   complement(428469..430849)
                     /rpt_family="IS66"
                     /note="NB10_ISVa5 (2.381 bp; complete); three-orf
                     IS-element"
     CDS             complement(428501..430042)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0351c"
                     /product="transposase, ISVa5 (orfC; IS66-family)"
                     /note="user locus_tag: VANGcII0351c"
                     /note="Transposase, ISVa5 (IS66-family; 513aa)"
                     /protein_id="CDQ48248.1"
                     /translation="MEKTPNINPESQDIAELQAMVKALMLSQEQKESQWQQERQSLLE
                     QLKLAFDRQFAKRSEALKPYDESQGDLFNEAECEAVKEEEVEVTTTITTKKRGKRKPL
                     PKTLPREVIELDLDDHEKQCSCCNHGLHKIGEDRSEKLEFTPAVLKVLEYVRPKYACR
                     QCEKTGDSSHIVQKPSPQSLIPKSFATESLLANIILGKYQYAMPLYRQESLFTQSGIE
                     LSRTTMARWVIQVSEKFAPLYAALKKYLLQQVVVQADETPLNVLKEEKKCYMWLYCSG
                     ADSPEAALPNVKNIALYDYQNSRARACPIAFLGDYNGYLQTDGYAAYDGLHQVTNVGC
                     LAHARRKFMDAKKLQGKGKSGKADKALAKIQKLYGIESRLKGAPAEERKAERQALAKP
                     ILDELYQWMTTQKVIGSSPLGKAIKYTLGQWSKLTRYIDDGHLSIDNNRAERAIKPLV
                     IGRKNWLFSNTPNGADASAMLYSIIETAKANGLILYDYLVKCMKELAKAEPDIDALLP
                     WNFKH"
     CDS             complement(430102..430455)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0352c"
                     /product="transposase, ISVa5 (orfB; IS66-family)"
                     /note="user locus_tag: VANGcII0352c"
                     /note="Transposase, ISVa5 (IS66-family; 117aa)"
                     /protein_id="CDQ48249.1"
                     /translation="MKGMLSAPDIYLYRESVDFRKSINGLAAIIENDTDLPLGSGALF
                     LFTNKQRDKIKVLYWDKTGFALWYKRLEKAKYKWPSKEKNQVFTLTQFELDRLLSGFT
                     IIGHEPVKINDFTMS"
     CDS             complement(430452..430769)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0353c"
                     /product="transposase, ISVa5 (orfA; IS66-family)"
                     /note="user locus_tag: VANGcII0353c"
                     /note="Transposase, ISVa5 (IS66-family; 105aa)"
                     /protein_id="CDQ48250.1"
                     /translation="MAKRRTNLEWQSLFEQYESSSVTQRAFCEEHGLSLSTFFAKRRQ
                     LQTVNQSEFVGFVKAEIVEKTTKYQAQIATANMTLLINDVELSIPQGTPATYLAELIG
                     ALS"
     CDS             431075..431353
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0354"
                     /old_locus_tag="TVA3592"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0354"
                     /protein_id="CDQ48251.1"
                     /translation="MIKVEYVLDDSEKQYLEISVSDLESFDSEESAFDAVGKTDLVEN
                     ELLESVALRLGLEYDHQESVQSPAYEYAAKLGFTRLRGELGGKTIFIT"
     misc_feature    431168..431191
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
     repeat_region   431457..433837
                     /rpt_family="IS66"
                     /note="NB10_ISVa5 (2.381 bp; complete); three-orf
                     IS-element"
     CDS             431537..431854
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0355"
                     /product="transposase, ISVa5 (orfA; IS66-family)"
                     /note="user locus_tag: VANGcII0355"
                     /note="Transposase, ISVa5 (IS66-family; 105aa)"
                     /protein_id="CDQ48252.1"
                     /translation="MAKRRTNLEWQSLFEQYESSSVTQRAFCEEHGLSLSTFFAKRRQ
                     LQTVNQSEFVGFVKAEIVEKTTKYQAQIATANMTLLINDVELSIPQGTPATYLAELIG
                     ALS"
     CDS             431851..432204
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0356"
                     /product="transposase, ISVa5 (orfB; IS66-family)"
                     /note="user locus_tag: VANGcII0356"
                     /note="Transposase, ISVa5 (IS66-family; 117aa)"
                     /protein_id="CDQ48253.1"
                     /translation="MKGMLSAPDIYLYRESVDFRKSINGLAAIIENDTDLPLGSGALF
                     LFTNKQRDKIKVLYWDKTGFALWYKRLEKAKYKWPSKEKNQVFTLTQFELDRLLSGFT
                     IIGHEPVKINDFTMS"
     CDS             432264..433805
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0357"
                     /product="transposase, ISVa5 (orfC; IS66-family)"
                     /note="user locus_tag: VANGcII0357"
                     /note="Transposase, ISVa5 (IS66-family; 513aa)"
                     /protein_id="CDQ48254.1"
                     /translation="MEKTPNINPESQDIAELQAMVKALMLSQEQKESQWQQERQSLLE
                     QLKLAFDRQFAKRSEALKPYDESQGDLFNEAECEAVKEEEVEVTTTITTKKRGKRKPL
                     PKTLPREVIELDLDDHEKQCSCCNHGLHKIGEDRSEKLEFTPAVLKVLEYVRPKYACR
                     QCEKTGDSSHIVQKPSPQSLIPKSFATESLLANIILGKYQYAMPLYRQESLFTQSGIE
                     LSRTTMARWVIQVSEKFAPLYAALKKYLLQQVVVQADETPLNVLKEEKKCYMWLYCSG
                     ADSPEAALPNVKNIALYDYQNSRARACPIAFLGDYNGYLQTDGYAAYDGLHQVTNVGC
                     LAHARRKFMDAKKLQGKGKSGKADKALAKIQKLYGIESRLKGAPAEERKAERQALAKP
                     ILDELYQWMTTQKVIGSSPLGKAIKYTLGQWSKLTRYIDDGHLSIDNNRAERAIKPLV
                     IGRKNWLFSNTPNGADASAMLYSIIETAKANGLILYDYLVKCMKELAKAEPDIDALLP
                     WNFKH"
     CDS             433838..434056
                     /pseudo
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0358"
                     /product="transposase, ISVa5 (orfA; IS66-family)"
                     /note="user locus_tag: VANGcII0358"
                     /note="Transposase, ISVa5 (IS66-family; 72 of
                     105aa),truncated in N-terminus"
     repeat_region   433838..436038
                     /rpt_family="IS66"
                     /note="NB10_ISVa5, truncated in N-term/first ORF: 2002nt
                     (2.381 bp; complete); three-orf IS-element"
     CDS             434053..434406
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0359"
                     /product="transposase, ISVa5 (orfB; IS66-family)"
                     /note="user locus_tag: VANGcII0359"
                     /note="Transposase, ISVa5 (IS66-family; 117aa)"
                     /protein_id="CDQ48256.1"
                     /translation="MKGMLSAPDIYLYRESVDFRKSINGLAAIIENDTDLPLGSGALF
                     LFTNKQRDKIKVLYWDKTGFALWYKRLEKAKYKWPSKEKNQVFTLTQFELDRLLSGFT
                     IIGHEPVKINDFTMS"
     CDS             434466..436007
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0360"
                     /product="transposase, ISVa5 (orfC; IS66-family)"
                     /note="user locus_tag: VANGcII0360"
                     /note="Transposase, ISVa5 (IS66-family; 513aa)"
                     /protein_id="CDQ48257.1"
                     /translation="MEKTPNINPESQDIAELQAMVKALMLSQEQKESQWQQERQSLLE
                     QLKLAFDRQFAKRSEALKPYDESQGDLFNEAECEAVKEEEVEVTTTITTKKRGKRKPL
                     PKTLPREVIELDLDDHEKQCSCCNHGLHKIGEDRSEKLEFTPAVLKVLEYVRPKYACR
                     QCEKTGDSSHIVQKPSPQSLIPKSFATESLLANIILGKYQYAMPLYRQESLFTQSGIE
                     LSRTTMARWVIQVSEKFAPLYAALKKYLLQQVVVQADETPLNVLKEEKKCYMWLYCSG
                     ADSPEAALPNVKNIALYDYQNSRARACPIAFLGDYNGYLQTDGYAAYDGLHQVTNVGC
                     LAHARRKFMDAKKLQGKGKSGKADKALAKIQKLYGIESRLKGAPAEERKAERQALAKP
                     ILDELYQWMTTQKVIGSSPLGKAIKYTLGQWSKLTRYIDDGHLSIDNNRAERAIKPLV
                     IGRKNWLFSNTPNGADASAMLYSIIETAKANGLILYDYLVKCMKELAKAEPDIDALLP
                     WNFKH"
     CDS             complement(436076..436555)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0361c"
                     /old_locus_tag="TVA3193"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0361c"
                     /protein_id="CDQ48258.1"
                     /translation="MINLGKYMTESTRNKTKRKLINHIKSIQPKYQVAIFFNDFDEGL
                     YFSNIMQQIKKPVSASFKHIPMIWVLRLKHQFNYGTVGYIQILTTDELDLDKLDNILN
                     KYTYENQINTKQRPFNYEQYTDTVAKQKLANLAAYLGSETSPRRYAITNKPKPVKDA"
     CDS             437036..437251
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0362"
                     /old_locus_tag="TVA3192"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0362"
                     /protein_id="CDQ48259.1"
                     /translation="MLRSSLFFQTAQFEFFCFFADLAFWFINEWFNLLQIYKKARSLV
                     LKMSLSIGWPNKRLKRDCQRVAVLVQN"
     misc_feature    437078..437146
                     /note="1 probable transmembrane helix predicted for
                     TVA3192 by TMHMM2.0 at aa 15-37"
     CDS             437389..437544
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0363"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0363"
                     /note="occur in vibrio sps"
                     /protein_id="CDQ48260.1"
                     /translation="MSIFTLKFVVYSSRKTGKVLCLPQSVLALARCKLSGRKVWKGQV
                     IQSFRIC"
     CDS             437554..437721
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0364"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0364"
                     /note="occur in vibrio sps"
                     /protein_id="CDQ48261.1"
                     /translation="MLSLSHSKAWFFVERWALFWRLIYHGSCLGWFLNHSTIAMVAFE
                     RVKSVYLIEFA"
     regulatory      437729..437768
                     /note="Putative Rho-independant termiator (cfr Arnold:
                     Erpin and RNAmotif hits)"
                     /regulatory_class="terminator"
     CDS             438378..438821
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0365"
                     /old_locus_tag="TVA3636"
                     /product="putative uncharacterized membrane associated
                     protein"
                     /note="user locus_tag: VANGcII0365"
                     /protein_id="CDQ48262.1"
                     /translation="MEEYRQNNINFWMHSVIGLASLTILVTFSSYSFPESLEFSFSND
                     KVLKLMGIFLIAIALPFNIGLAFVFKVLPLENQKINQLEKNPVIKISMSFGLVFFVLG
                     LGFLMFGVHHLVGKAFMFSSVLAFAILPCYLYSGGYIEKPLFKRK"
     misc_feature    join(438405..438473,438516..438584,438645..438713,
                     438726..438794)
                     /note="4 probable transmembrane helices predicted for
                     TVA3636 by TMHMM2.0 at aa 33-55, 70-92, 113-135 and
                     140-162"
     CDS             439014..439700
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0366"
                     /old_locus_tag="TVA3635"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0366"
                     /protein_id="CDQ48263.1"
                     /translation="MIDWLNENVGADAATYIGTFAGIIGLFLGAKVINLKFKNQVNKI
                     DNSKNHEQTLNVGSGNGFQSGGDMNVTIGSINSSEHEEEQAKKSHDLRIIEKIVELLP
                     YEDTLHHVDLSYISGMPYEFARSLDRAEDFNGPKYKIYNPKVEAAKEEFLNAVYSFNE
                     ICISFLSVDHPQRKPLMVVPPFDWRNGPSEARYRELQSSLSDHATMLINKYKLFVEVY
                     KSEGFISDKI"
     misc_feature    439050..439118
                     /note="1 probable transmembrane helix predicted for
                     TVA3635 by TMHMM2.0 at aa 13-35"
     CDS             complement(439839..440000)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0367c"
                     /old_locus_tag="tvaNC031(B&F300211)"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0367c"
                     /protein_id="CDQ48264.1"
                     /translation="MLGGRLDAEGYFTDEFTAINNPTRSRNNKLVMIIYCLSPVMRTW
                     NSPFNSNPI"
     CDS             complement(440258..440398)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0368c"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0368c"
                     /note="partly similar to V. anguillarum locus
                     WP_019282970"
                     /protein_id="CDQ48265.1"
                     /translation="MKTINLRLFKNPFRPSQLAENTERILNEIVALTLKTHPTHNARL
                     RG"
     CDS             complement(440467..440712)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0369c"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0369c"
                     /note="No blast-/fasta-hits (with neg E-values); No
                     Interpro-hits; no RFAM-hits"
                     /protein_id="CDQ48266.1"
                     /translation="MLCEFHAAFKVNYRRNEEILISYVQKRCLPKPKFHSDLSQREPL
                     AESTTKKAPFQQPLNFLLHQIFRAECQQVNQSKRHFN"
     CDS             complement(440883..441092)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0370c"
                     /old_locus_tag="TVA3634"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0370c"
                     /protein_id="CDQ48267.1"
                     /translation="MDKCIATEGKQQYIEHQDNENTICSVIAFSQTYEENLMAKTQSG
                     KKKVHVPAHTRNGKKVREHYRSTPN"
     repeat_region   complement(441160..442250)
                     /rpt_family="IS30"
                     /note="NB10_ISVa6; Pfam-A: HTH38 (Helix-turn-helix domain)
                     and rve (Integrase core domain). IPR025246: Transposase
                     IS30-like HTH domain."
     CDS             complement(441190..442158)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0371c"
                     /product="transposase, ISVa6 (IS30 family)"
                     /note="user locus_tag: VANGcII0371c"
                     /note="Similar to Vibrio parahaemolyticus serotype O3:K6
                     (strain RIMD 2210633) subname: full=putative transposase
                     for is1655 UniProt:uniprot_trembl_bacteria (310 aa) fasta
                     scores: E()=4.1e-100, 97.0% id in 231 aa. The second aa
                     varying among refs/species (?), R:Arg og K:Lys, both with
                     basic side chains; other refs with uncharged polar side
                     chains (S:Ser or T:Thr), and there are a few more such
                     examples along the aa-chain (ex: R:Arg changed with H:
                     His)."
                     /protein_id="CDQ48268.1"
                     /translation="MRYTHLTENERYMISALRKQGISTAKIAKQLGRHKATIYREIER
                     NSRYNRHFKRYSYQAWRAQQMARNRLSRSRRNKRYSEIDFRLPEALLRLDWSPDQIVG
                     YLRVRGYPTMSHELIYQHIWNDKSLGGTLWKHLRQSTKKRRKRYNSKDSRGRLAAKRH
                     ITERPAKAEHRKEPGHWEIDTVVGRGTKHCIVTLVDRMTGYTFIGQMDDRTSESLNVR
                     MSKIMTRSDLPFKTITADNGTEFHGYAQLEKHHNCLFYFANPYHSWERGTNENTNGLI
                     RQYLPKRTSMSHVTQKLCNEIAHKLNTRPRKRLGYRTPTEYIHAHL"
     CDS             complement(442816..443037)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0372c"
                     /old_locus_tag="NC032b"
                     /product="Putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0372c"
                     /note="former part of contig 00165; some nt-overlap with
                     tva3192B in newcontig031 and tva3192 in contig00153w.r;
                     (F&B300311)"
                     /protein_id="CDQ48269.1"
                     /translation="MVSSKVFSLGIPNTLRYSLARSVFHCSEPITYFGSIAILHLLTF
                     YIYHESAILLLKLLLCNKSLAIHNARLRG"
     CDS             443060..443227
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0373"
                     /old_locus_tag="TVA3149"
                     /product="Putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0373"
                     /note="No InterPro domains (prediction)"
                     /protein_id="CDQ48270.1"
                     /translation="MRDDDDYSFVEKDQDGNVVALYEAWHHMSTPKSFSASSGYKKLS
                     PEGEVIEQVKS"
     repeat_region   complement(443229..444319)
                     /rpt_family="IS30"
                     /note="Complete IS-seq: transposase ISVa6; Pfam-A: HTH38
                     (Helix-turn-helix domain) and rve (Integrase core domain).
                     IPR025246: Transposase IS30-like HTH domain."
     CDS             complement(443259..444227)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0374c"
                     /product="transposase, ISVa6 (IS30 family)"
                     /note="user locus_tag: VANGcII0374c"
                     /note="Transposase: The second aa varying among
                     refs/species (?), R:Arg og K:Lys, both with basic side
                     chains; other refs with uncharged polar side chains (S:Ser
                     or T:Thr), and there are a few more such examples along
                     the aa-chain (ex: R:Arg changed with H: His)."
                     /protein_id="CDQ48271.1"
                     /translation="MRYTHLTENERYMISALRKQGISTAKIAKQLGRHKATIYREIER
                     NSRYNRHFKRYSYQAWRAQQMARNRLSRSRRNKRYSEIDFRLPEALLRLDWSPDQIVG
                     YLRVRGYPTMSHELIYQHIWNDKSLGGTLWKHLRQSTKKRRKRYNSKDSRGRLAAKRH
                     ITERPAKAEHRKEPGHWEIDTVVGRGTKHCIVTLVDRMTGYTFIGQMDDRTSESLNVR
                     MSKIMTRSDLPFKTITADNGTEFHGYAQLEKHHNCLFYFANPYHSWERGTNENTNGLI
                     RQYLPKRTSMSHVTQKLCNEIAHKLNTRPRKRLGYRTPTEYIHAHL"
     misc_RNA        445897..446048
                     /note="Partial; gb|AY126447.1| Listonella anguillarum
                     large subunit ribosomal protein L20 (rplT) and
                     super-integron InLan site-specific recombinase IntIA
                     (intIA) genes,complete cds; and unknown genes"
     CDS             446565..446780
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0375"
                     /old_locus_tag="TVA3192B"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0375"
                     /note="The CDS is situated between two putative
                     att-sites/cassette?!"
                     /protein_id="CDQ48272.1"
                     /translation="MLRSSLFFQTAQFEFFCFFADLAFWFINEWFNLLKIYKKARSLV
                     LKMSLPIGWPNKRLKRDCQRVAALVQN"
     CDS             446862..447398
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0376"
                     /old_locus_tag="TVA3134"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0376"
                     /protein_id="CDQ48273.1"
                     /translation="MDKIVELIKEDPLRVEALYHVSQLGLPQCYIAAGFVRNLVWDSL
                     HDFNEPTPLNDVDVIYFEPTESNSNAYLECEVLLKACMPKLNWQVRNQATMHERNGDE
                     PYQSSLDAMSYWPEKETAVAIRQIGLNQYECVAAFGFESLFSYWVTHNPKRQRETFEN
                     RVNSKGWLARWPSLRIAP"
     misc_feature    446913..447395
                     /note="HMMPfam hit to PF06042, DUF925, score 4.2e-87"
     CDS             447522..448124
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0377"
                     /old_locus_tag="TVA3135"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0377"
                     /protein_id="CDQ48274.1"
                     /translation="MEKILNNDVGIEILESLKDMKPDLNERDNLSLMLHFVVFDTQRA
                     IFDLVRLKHLGAASALLRVLFESHIKAEWLKVCASEKQIEQFKRDSVKSAKNSKYSIS
                     FQEMIADLEKKKPHLKGSLQAFKDYHWKGLNSFTHSGSMQLVQFQRGLDGIEETGSNT
                     IDFANRFAISSLGSVGELLKDINVLQRHISLADRFLGISI"
     CDS             448332..448622
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0378"
                     /old_locus_tag="tva3135B"
                     /product="putative uncharacterized (conserved) protein"
                     /note="user locus_tag: VANGcII0378"
                     /note="Similar to Vibrio splendidus (strain LGP32) (Vibrio
                     splendidus (strain Mel32)) subname: full=conserved protein
                     UniProt:Conserved (97 aa) fasta scores: E()=5.4e-39, 81.1%
                     id in 95 aa"
                     /protein_id="CDQ48275.1"
                     /translation="MTIPIKNVSNPEISCSNCHACCCRLEVMIITDTGVPEQHIAFDE
                     WGGETMLRLSDGWCSALDRETFMCTIYENRPWICREFEMGSYECRDERIDLS"
     misc_feature    448482..448580
                     /note="HMMPfam hit to PF03692, UPF0153, score 6.9e-07"
     CDS             449275..449715
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0379"
                     /old_locus_tag="TVA3127"
                     /product="putative excision endonuclease ATPase subunit"
                     /note="user locus_tag: VANGcII0379"
                     /protein_id="CDQ48276.1"
                     /translation="MKKLTILALSSLAFFSSNTFARDDVGNYSITKAMSSEVAKSKLG
                     SEVSFYFGEQSYGKVLKELGEFKTSKKTNAFNKTDEEACNWVFLSAMIALKDRAIKEG
                     GNAVVNIKSNYKNNLTSSNDTFQCGAGAVMAGVALSGEVVKLKK"
     misc_feature    449275..449337
                     /note="Signal peptide predicted for TVA3127 by SignalP 2.0
                     HMM (Signal peptide probability 1.000) with cleavage site
                     probability 1.000 between residues 21 and 22"
     CDS             450022..450237
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0380"
                     /old_locus_tag="TVA3126"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0380"
                     /protein_id="CDQ48277.1"
                     /translation="MLRSSLFFQIAQFEFFRFFVDSAFWFINESVSLFQVYKKARSLV
                     LKVSLLIYWPNKRLKRDCQRVSALVQN"
     CDS             450492..451556
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0381"
                     /old_locus_tag="TVA3125"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0381"
                     /protein_id="CDQ48278.1"
                     /translation="MINDHIQKQQGGDHSTNVQAESVTINGISYSDARTIALDVYKAN
                     FLELSQSAAQLARARAEELTDSFLSKLKEEHESAITELQQPAMQAALYEAQKQYAKTG
                     DADLEGMLVDILVQRASTPERNTKQIVLDEALEVVSKLTPDQLDMLSMNFALTRLSRG
                     GVNSQNALVDFFTNELLKFGNAQNPHQSWVEHLAYSGCVTLMDASWYKEIPDLILGQY
                     PAMFQKGFDEEQFVASIGDSSEKYKPLLKHSYHTVSLLEFNPLTEGALGEKAAKLGYE
                     EQEVSRLKSLFTSNLMNKNEVKDWLVEKVPGLTDLINNWGVKDSSLSKMQLTTVGIAL
                     AQANYTRKVNIKFDLGIWVK"
     CDS             complement(452433..452675)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0382c"
                     /old_locus_tag="TVA3124"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0382c"
                     /protein_id="CDQ48279.1"
                     /translation="MKIHRSLLVAVEQSAGENVLRDICLSLLNTGVPADSILDEFEEL
                     RATHTLDGEYEDTLLDVMDALCGWCSPNHALVPTVA"
     CDS             complement(452662..453075)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0383c"
                     /old_locus_tag="TVA3123"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0383c"
                     /protein_id="CDQ48280.1"
                     /translation="MITDESDGKPVLGSSDTPESIARKLGVRVPTDIEVDAQGNVKAG
                     FHGMSVSPIPVENLPRHRRPPEFGGTGKDPIWGLHTIHLGTFSLKYMPDPEKPSHGFI
                     APAMDMEYTHYEQCIYNTRDIWCPIVKEDLDDENS"
     CDS             453528..454037
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0384"
                     /old_locus_tag="TVA3122"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0384"
                     /protein_id="CDQ48281.1"
                     /translation="MKKILIIGNSGSGKSWLSGQLSKRLRLKEVHLDSVVWEPGGYNQ
                     KRSPETIKSELVKLSMDPSWIVEGVFGALIEELIPHADTLLFLDLNWAVCKVSLLARG
                     SESSKQLDVVEADKNFKELLTWASEYSIRTSKSSRQFHDYLFSNFSGTKVRFTSRLQV
                     GSFAAGTAC"
     misc_feature    453549..453572
                     /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
     misc_feature    454002..454034
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
     CDS             455188..455961
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0385"
                     /old_locus_tag="TVA3121"
                     /product="putative antibiotic resistance protein"
                     /note="user locus_tag: VANGcII0385"
                     /protein_id="CDQ48282.1"
                     /translation="MEELSGGRESAIYRDGEIIYRPLQLWSPTIHKLLTHLQSSGLTE
                     SPRFLGIEGKQEKLSFVVGDTYNYPLVGAIATSEALRSAAKLLRKIHDSTASFVSNND
                     IVNLPWMLDSREPFEVICHGDFTPYNVALSGNSVVGVFDFDTAHPASRVWDLAYSIYC
                     WAPFKTDSIDGLGTMEEQLLRARLFCDSYDATYSQREQLADAMVRRLNALVNFMRKEA
                     DSGDEQFATNIEEGHLQSYLNDIDYIETNKHKIQRALCN"
     misc_feature    455509..455742
                     /note="HMMPfam hit to PF01636, APH, score 8.3e-13"
     CDS             456729..457127
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0386"
                     /old_locus_tag="TVA3120"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0386"
                     /protein_id="CDQ48283.1"
                     /translation="MLSPALVHAIATGLLTNAVYDALKTQLLALSRDVKGKTYKRISG
                     SESIKTIDADFGVKFRSGYDSFDLKISPNASDEVKLRCIDRAFDIIRENGVQKEFSED
                     FSLKHKERIGFFDESTETYKLVGVDKLPKR"
     CDS             458212..458817
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0387"
                     /old_locus_tag="TVA3119"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0387"
                     /protein_id="CDQ48284.1"
                     /translation="MEYERPRKRNPLGITIEQHFHTAHSIGKFYNHTDNVEVFEKSTS
                     LTFPRNKRAKIFCTKRNWDERAERGYMVDIEHDYHEQIDNLGISKERNHHAISKYFVL
                     WRLRHQAHLNRLSNAKLNGVPGLSLTKEQQEIIEVKRAGFVNSEGEIPARQLTGHLIQ
                     SGIDQHMLDFKGVKWGLLQASKGQFLCADSYHDLFLIAYLS"
     misc_feature    458955..458970
                     /note="This sequence (CAATTTAAGAGGGATT) occurs three times
                     in chr2; two seq-variants: (A)TAACAAA()CCCAACGCTTGCCATTT..
                     and TAACAAT()CACAACGCTTGGCGGCCTCACTTC... Also near
                     tox-antitox CDSs??! Blast-seqrch indicates integrase
                     catalytic region/putative acetyltransferase at 3'side.
                     36-40+ bases occuring several times in Vibrios (only a few
                     in Shewanella baltica)."
     CDS             460110..460358
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0388"
                     /old_locus_tag="TVA2306"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0388"
                     /protein_id="CDQ48285.1"
                     /translation="MNDTTAKPALPDHLAGNPRSPHYVAECFEHHIGIRLNGKERTDV
                     EEYCISEGWVKIPSPKAKDRFGQPMLIKLKGEVEAFYK"
     misc_feature    complement(460647..460910)
                     /note="xxx_Occuring ca 10x in Vang 775 chr2"
     CDS             461145..461690
                     /transl_table=11
                     /gene="rimL"
                     /locus_tag="VANGNB10_cII0389"
                     /old_locus_tag="TVA2979"
                     /product="ribosomal-protein-serine acetyltransferase"
                     /note="user locus_tag: VANGcII0389"
                     /protein_id="CDQ48286.1"
                     /translation="MFTLDVDTDLKLALVTPKYASAYLEIVSREREYLSQWLAWPPHA
                     SNEEFFLSFIKSSLHDYADGKSLVCGMIYQDKLVGNISFNSINRQLKKVEIGYWLSSE
                     YQGKGIVSKSVLKLTDLAFTEFDMEKVQISAASENIPSRNVCERLGFSLEGIISCAEN
                     LNGRVVDHAVYGLNRTNWPKT"
     misc_feature    461349..461594
                     /note="HMMPfam hit to PF00583, Acetyltransf_1, score
                     2.7e-09"
     misc_feature    461457..461504
                     /note="PS00589 PTS HPR component serine phosphorylation
                     site signature."
     CDS             461823..462338
                     /transl_table=11
                     /gene="blc"
                     /gene_synonym="vlp"
                     /gene_synonym="vlpA"
                     /locus_tag="VANGNB10_cII0390"
                     /old_locus_tag="TVA2978"
                     /product="outer membrane lipocalin-like protein"
                     /note="user locus_tag: VANGcII0390"
                     /protein_id="CDQ48287.1"
                     /translation="MRSILLIICTVLLNGCLGMPESVKPVSDFELNNYLGKWYEVARL
                     DHSFERGLSQVTAEYRVRNDGGVSVLNRGYSEEKGEWKEAEGKAYFVNSPTDGYLKVS
                     FFGPFYGSYVVFELERENYSYAFVSGPNTEYLWLLSRTPRIEPDILEKFVQMSKERGF
                     DTNRLIYVRQQ"
     misc_feature    461904..461945
                     /note="PS00213 Lipocalin signature."
     misc_feature    461907..462332
                     /note="HMMPfam hit to PF08212, Lipocalin_2, score 6e-62"
     CDS             463890..464171
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0391"
                     /old_locus_tag="TVAchr2_001"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0391"
                     /note="Occurs twice in Vang775chr2 (gb|CP002285.1),
                     ID=100% and 98%. Similar to Vibrio metschnikovii CIP 69.14
                     subname: full=putative uncharacterized protein
                     UniProt:uniprot_trembl_bacteria (93 aa) blastp scores:
                     E()=2e-42."
                     /protein_id="CDQ48288.1"
                     /translation="MNVDKAKKRILKRVQKGFKGYPQISLEYFGKTTDLATEVVITFL
                     PEENAEPQIQRFTSDKDAREDEAIQSVLLKIIERAEAATVLEKQEISVC"
     CDS             complement(464750..464980)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0392c"
                     /old_locus_tag="TVA3647"
                     /product="Pas_Saposin-family protein"
                     /note="user locus_tag: VANGcII0392c"
                     /protein_id="CDQ48289.1"
                     /translation="MKALIYETLISLANQDPEQHAKIRENLYEQLGLPLDKQLALYSR
                     ALGPASSGKLENDQAINNAVESAIKLLETPEH"
     misc_feature    complement(464753..464980)
                     /note="HMMPfam hit to PF09016, Pas_Saposin, score 1.3e-50"
     misc_feature    465101..465184
                     /note="The sequence
                     CTTTAGTGCAAAATTGAAGTTCAGTGTTTACAGTGTGTTTTTTGAGTTCGGCTATGCG
                     TTGTCAACCCCTTAGCCGGGCGTTAG occuring also in newcontig018,
                     between tva3119 and 2306 (rev strand); putative
                     Att-site?!"
     CDS             join(465617..465661,465663..466199)
                     /pseudo
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0393"
                     /old_locus_tag="TVA3646"
                     /product="putative uncharacterized protein (pseudogene)"
                     /note="user locus_tag: VANGcII0393"
                     /note="CDS contains a framshift after codon 45; verified
                     by pcr (seq2364). May be truncated in N-term (6-8aa)
                     and/or the protein should start after this framshift?! CDS
                     contains HMMPfam (DUF025): This family consists of several
                     hypothetical bacterial proteins of unknown function. This
                     family was recently identified as belonging to the
                     nucleotidyltransferase superfamily. Same sequence in both
                     454- and PacBio-sequencing (putative pseudogene)"
                     /db_xref="PSEUDO:CDQ48290.1"
     misc_feature    465714..466196
                     /note="HMMPfam hit to PF06042, DUF925, score 4.6e-98. This
                     family (DUF925) consists of several hypothetical bacterial
                     proteins of unknown function. This family was recently
                     identified as belonging to the nucleotidyltransferase
                     superfamily"
     CDS             466881..467222
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0394"
                     /old_locus_tag="TVA3645"
                     /product="putative uncharacterized SH3 domain-protein"
                     /note="user locus_tag: VANGcII0394"
                     /note="The CDS contains two variant SH3-domains"
                     /protein_id="CDQ48291.1"
                     /translation="MEVVTTEKHVSEYPNPFYLKQGDKVALGTIDDEFPNWIFITSSE
                     GEQGWAPVQYIEKIEGGSEGILLKDYDNAELNTVIGEKLSVLFELNEWYRVSRSTGEI
                     GWVPVRSVQRT"
     misc_feature    466884..467054
                     /note="HMMPfam hit to PF07653, SH3_2, score 8.2e-08;
                     PF07653: SH3 (Src homology 3) domains are often indicative
                     of a protein involved in signal transduction related to
                     cytoskeletal organisation. First described in the Src
                     cytoplasmic tyrosine kinase P12931. The structure is a
                     partly opened beta barrel."
     misc_feature    467067..467219
                     /note="HMMPfam hit to PF07653, SH3_2, score 0.0087"
     misc_feature    467227..467242
                     /note="This sequence (CAATTTAAGAGGGATT) occurs three times
                     in chr2/two seq-variants: 2x TAACAAA()CCCAACGCTTGGCATTT..
                     and 1x TAACAAT()CACAACGCTTGGCGGCCTCACTTC... Also near
                     tox-antitox CDSs??! Blast-seqrch indicates integrase
                     catalytic region/putative acetyltransferase at 3'side.
                     36-40+ bases occuring several times in Vibrios (only a few
                     in Shewanella baltica)."
     CDS             467377..467736
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0395"
                     /old_locus_tag="TVA3644"
                     /product="glyoxalase/dioxygenase superfamily protein"
                     /note="user locus_tag: VANGcII0395"
                     /protein_id="CDQ48292.1"
                     /translation="MNQNEKLNYVEFAAKNLEATKSFFSSVFGWEFTDYGPEYTAFSN
                     QGLDGGFFKADCCSQTASGGALLIFYSSNIETTLAKVQNSGGQIIRPIFDFPGGCRFH
                     FIEPSGNEFAVWSEARV"
     misc_feature    467392..467715
                     /note="HMMPfam hit to PF00903, Glyoxalase, score 6.6e-10"
     CDS             468913..469836
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0396"
                     /old_locus_tag="TVA3643"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0396"
                     /note="Toxin-antitoxin construct?"
                     /protein_id="CDQ48293.1"
                     /translation="MPGAFAHITAVNFAISNSNLKSLNMPKKAKLALSRNQKFVELGC
                     VSPDFPYLKLGSPDQNEWADKMHYEKVGVLIRKAILLVKNLSGEDQEKAFAWLCGFVA
                     HVISDITIHPVVEMRVGPYHENSQEHRICEMNQDAYIWPKLNLGEIGYAERVNNNIGS
                     CNDPTNPSNLDRIITNLWETCLKDVFPEKADSAHPDINGWYKGFQFIVDNIEEGYRLF
                     PLARHVAAKQGLVYPSLEEIDESYIKALKTPCGIEDYDSIFERAVENVKQYLCYLSNA
                     VFDDGSVDMFLNWNLDTGRCEKEMLTAWSNS"
     CDS             469833..470231
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0397"
                     /old_locus_tag="TVA3642"
                     /product="putative uncharacterized (lipo/TA)protein"
                     /note="user locus_tag: VANGcII0397"
                     /protein_id="CDQ48294.1"
                     /translation="MKYLNLLILSMLTAGCAVSKPYNDEKMYDLASQFKDLAQTVDGS
                     IKFGDVMIDSGAQALEIVSTEQPDKVAPFVKYTIKAEMQGDNAVLLLCEEDVALIEDA
                     GCNAVLDKVYWHELKSNSCVITLQSNQVCN"
     misc_feature    469833..469889
                     /note="Signal peptide predicted for TVA3642 by SignalP 2.0
                     HMM (Signal peptide probability 0.981) with cleavage site
                     probability 0.918 between residues 19 and 20"
     misc_feature    469848..469880
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
     misc_feature    469980..470015
                     /note="PS00141 Eukaryotic and viral aspartyl proteases
                     active site."
     repeat_region   complement(470530..472910)
                     /rpt_family="IS66"
                     /note="NB10_ISVa5 (2.381 bp; complete); three-orf
                     IS-element"
     CDS             complement(470562..472103)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0398c"
                     /product="transposase, ISVa5 (orfC; IS66-family)"
                     /note="user locus_tag: VANGcII0398c"
                     /note="Transposase, ISVa5 (IS66-family; 513aa)"
                     /protein_id="CDQ48295.1"
                     /translation="MEKTPNINPESQDIAELQAMVKALMLSQEQKESQWQQERQSLLE
                     QLKLAFDRQFAKRSEALKPYDESQGDLFNEAECEAVKEEEVEVTTTITTKKRGKRKPL
                     PKTLPREVIELDLDDHEKQCSCCNHGLHKIGEDRSEKLEFTPAVLKVLEYVRPKYACR
                     QCEKTGDSSHIVQKPSPQSLIPKSFATESLLANIILGKYQYAMPLYRQESLFTQSGIE
                     LSRTTMARWVIQVSEKFAPLYAALKKYLLQQVVVQADETPLNVLKEEKKCYMWLYCSG
                     ADSPEAALPNVKNIALYDYQNSRARACPIAFLGDYNGYLQTDGYAAYDGLHQVTNVGC
                     LAHARRKFMDAKKLQGKGKSGKADKALAKIQKLYGIESRLKGAPAEERKAERQALAKP
                     ILDELYQWMTTQKVIGSSPLGKAIKYTLGQWSKLTRYIDDGHLSIDNNRAERAIKPLV
                     IGRKNWLFSNTPNGADASAMLYSIIETAKANGLILYDYLVKCMKELAKAEPDIDALLP
                     WNFKH"
     CDS             complement(472163..472516)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0399c"
                     /product="transposase, ISVa5 (orfB; IS66-family)"
                     /note="user locus_tag: VANGcII0399c"
                     /note="Transposase, ISVa5 (IS66-family; 117aa)"
                     /protein_id="CDQ48296.1"
                     /translation="MKGMLSAPDIYLYRESVDFRKSINGLAAIIENDTDLPLGSGALF
                     LFTNKQRDKIKVLYWDKTGFALWYKRLEKAKYKWPSKEKNQVFTLTQFELDRLLSGFT
                     IIGHEPVKINDFTMS"
     CDS             complement(472513..472830)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0400c"
                     /product="transposase, ISVa5 (orfA; IS66-family)"
                     /note="user locus_tag: VANGcII0400c"
                     /note="Transposase, ISVa5 (IS66-family; 105aa)"
                     /protein_id="CDQ48297.1"
                     /translation="MAKRRTNLEWQSLFEQYESSSVTQRAFCEEHGLSLSTFFAKRRQ
                     LQTVNQSEFVGFVKAEIVEKTTKYQAQIATANMTLLINDVELSIPQGTPATYLAELIG
                     ALS"
     CDS             473125..473331
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0401"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0401"
                     /note="CDS2r_NC30(040511)"
                     /protein_id="CDQ48298.1"
                     /translation="MKDRKMSEVEEPKSPCIRQCCLDEMDICLGCFRSLNEIIDWHSS
                     TIIEKNKILIACRQRRELSQKSRF"
     CDS             complement(473451..473681)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0402c"
                     /old_locus_tag="TVA3647b"
                     /product="Putative Pas_Saposin-family protein"
                     /note="user locus_tag: VANGcII0402c"
                     /protein_id="CDQ48299.1"
                     /translation="MKALIYETLISLANQDPEQHAKIRENLYGQLGLPLDKQLALYSR
                     ALGPASSGKLENDQAINNAVESAIKLLETPEH"
     CDS             complement(473975..474211)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0403c"
                     /old_locus_tag="TVA3118"
                     /product="putative RNA binding protein, rbpE"
                     /note="user locus_tag: VANGcII0403c"
                     /protein_id="CDQ48300.1"
                     /translation="MKLLVRNLSRSTTEQELRVLFSAHGSVAECTLVLDQVTGQSKGF
                     AFVEMPNENEANAAISSLNLSDVAKSKIRVKAAE"
     CDS             474496..474984
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0404"
                     /old_locus_tag="TVA3503"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0404"
                     /protein_id="CDQ48301.1"
                     /translation="MRGEYVCDISNKVWVSAIKYAVENIDQFSFDADSMHMLWIVNGG
                     HIRRHISDDKLILKWLKLILPKYEGGELQLYRGECQFLYDQGLIGFCWTPKKQVAEKF
                     ARGLNATESGGVLLSAYVSSEAILSAPNSHSADWLEESEYTCDPTQIRSIEVLHKYPK
                     LD"
     CDS             complement(475191..475493)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0405c"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0405c"
                     /note="No IPR-hit"
                     /protein_id="CDQ48302.1"
                     /translation="MLSIDKVKRTTEKLKPNPRNALGTEEITGKLDELLELKFTKNYV
                     EEANNKVRKTHLSAKGLQNQRSHAKEINKHTTSRKQTSVSSSTSRTVPLARYEEKC"
     CDS             complement(475694..476188)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0406c"
                     /old_locus_tag="TVA3502"
                     /product="putative toxin protein, TadB (TA system)"
                     /note="user locus_tag: VANGcII0406c"
                     /note="TADB|6298153 NC_009456/VC0395_0765 Vibrio cholerae
                     O395"
                     /protein_id="CDQ48303.1"
                     /translation="MNTVLLDKVKHDRNRFNCGIEALNNYLKVMASQQAKKDNTRTFV
                     LEDDNNSSHIIGFYTLTMTPIDLKALPDKLQKKHQSSTSGGLIARLAVDDRYKGKGFG
                     EWLLIDALRKLLAASDSVAFPVVIVDAKDGAKYFYERYGFQAFQDAENKLFITIADVR
                     ASLG"
     misc_feature    complement(475760..476062)
                     /note="HMMPfam hit to PF00583, Acetyltransf_1, score
                     0.00032"
     CDS             complement(476188..476460)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0407c"
                     /old_locus_tag="TVA3501"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0407c"
                     /protein_id="CDQ48304.1"
                     /translation="MATTLPRITARVDVDTQDLLTKAAAIAGMSSINSFVLSAAIEKA
                     KQVIEREQALKLSQADAILLMDALDRPTAQNSKLRAASERYESKAQ"
     misc_feature    complement(476200..476442)
                     /note="HMMPfam hit to PF08681, DUF1778, score 1.5e-28"
     CDS             477211..477990
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0408"
                     /old_locus_tag="TVA3500"
                     /product="Putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0408"
                     /note="The CDS seem to be truncated in C-terminus (by an
                     IS-element)"
                     /protein_id="CDQ48305.1"
                     /translation="MTFQHLLEQALYSSAIIHQPHALKAYLSTKFLCEYLDCSEKLLV
                     QVSRLIEQDALKISCNYTDTVQQVNFSSVRRHRILERGIYPASYQAMSQWHDEKGFTD
                     IFQHYVSRASRHSEYLSHNVTILLALNEVYKLLSPDSIPIFLNRLTEFVTSTFIGEEH
                     QSEPMLSTPNREGDILNACLEQPGFFGHNLITLAWIIRCKDRLSNIQYESMLCNLNIQ
                     AVSPLEDPDDELDSNIWNLCWMRALLLNSVVRHGSPKLFSY"
     repeat_region   complement(477933..478986)
                     /rpt_family="IS5"
                     /note="NB10_ISVa2 (complete: 1.054 bp); Accession
                     Number:L40498"
     CDS             complement(477987..478907)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0409c"
                     /old_locus_tag="tva3500p1"
                     /product="transposase, ISVa2"
                     /note="user locus_tag: VANGcII0409c"
                     /note="Similar to Vibrio anguillarum (Listonella
                     anguillarum) jm29 synonyms=jm01, jm07 UniProt:Putative
                     (306 aa) fasta scores: E()=2.2e-133, 100.0% id in 306 aa"
                     /protein_id="CDQ48306.1"
                     /translation="MPKPRYKTTNWKQYNKALINRGSLTFWIDEETIAEWKQNKQGKR
                     GRPRRFSDLAITTALMVKRVFSMPLRALQGFLDSVFKLANIPLVCPHYTCISRRAKEV
                     EVSFKTKTRGAIQHLAIDATGLKVYGEGEWKVKKHGTDGKRRVWRKLHIAVDTSTHEI
                     VAAELSLSNVTDAEVLPNLLKQTRRKIIEISGDGAYDTRNCHDAIRIKQAVALIPPRE
                     GAAFWEQGHPRNLAVGCQKLYGSNKKWKKRYGYHKRSLSETAMYRVKQLLGGKLSLRN
                     YNAQVGETYAMIKALNKLTGLGMPETQYIA"
     CDS             479006..479299
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0410"
                     /product="Putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0410"
                     /note="No predicted transmembrane helixes
                     (TMHMM2.0.model). Ion transport 2 domain protein
                     [Shewanella baltica BA175] Length=152; Score = 87.0 bits
                     (214), Expect = 7e-16 Identities = 40/87 (46%), Positives
                     = 65/87 (75%), Gaps = 4/87 (4%)."
                     /protein_id="CDQ48307.1"
                     /translation="MIMVPTIYITMLVIVGVLFSTILLGMNSFLNTGKYIPAFKYFYY
                     CIISLTSVGYGDLSPGNDADRIVAIAMSLVGTLHMIIFISVIVSKLNLAPQKT"
     regulatory      complement(479008..479021)
                     /note="14-mer locus; defined as a regulatory sequence (in
                     repl origi) conserved among sequenced Vibrio genomes; cfr.
                     Venkova-Canova, T. and D. K. Chattoraj (2011): Transition
                     from a plasmid to a chromosomal mode of replication
                     entails additional regulators. Proceedings of the National
                     Academy of Sciences of the United States of America
                     108(15),6199-6204"
                     /regulatory_class="other"
     repeat_region   complement(479295..480385)
                     /rpt_family="IS30"
                     /note="Complete ISVa6 IS-element (1.091 bp)"
     CDS             complement(479325..480293)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0411c"
                     /product="transposase, ISVa6 (IS30 family)"
                     /note="user locus_tag: VANGcII0411c"
                     /note="Transposase, IS30 family; The second aa varying
                     among refs/species (?), R:Arg og K:Lys, both with basic
                     side chains; other refs with uncharged polar side chains
                     (S:Ser or T:Thr), and there are a few more such examples
                     along the aa-chain (ex: R:Arg changed with H: His)."
                     /protein_id="CDQ48308.1"
                     /translation="MRYTHLTENERYMISALRKQGISTAKIAKQLGRHKATIYREIER
                     NSRYNRHFKRYSYQAWRAQQMARNRLSRSRRNKRYSEIDFRLPEALLRLDWSPDQIVG
                     YLRVRGYPTMSHELIYQHIWNDKSLGGTLWKHLRQSTKKRRKRYNSKDSRGRLAAKRH
                     ITERPAKAEHRKEPGHWEIDTVVGRGTKHCIVTLVDRMTGYTFIGQMDDRTSESLNVR
                     MSKIMTRSDLPFKTITADNGTEFHGYAQLEKHHNCLFYFANPYHSWERGTNENTNGLI
                     RQYLPKRTSMSHVTQKLCNEIAHKLNTRPRKRLGYRTPTEYIHAHL"
     CDS             480666..481055
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0412"
                     /old_locus_tag="TVA3038"
                     /product="putative exported protein"
                     /note="user locus_tag: VANGcII0412"
                     /protein_id="CDQ48309.1"
                     /translation="MLKASGVVLSILSFYSFASLNCSGFSGCERKYCEIEQQIESAQL
                     ANNQKKIEGLKVALAEAKSNCSDTKLKQDLADEIKETKDKIAEYNLDLQEAKGSGKDN
                     KVRKYQNKIQEEERKLESLLQELSELG"
     misc_feature    480666..480719
                     /note="Signal peptide predicted for TVA3038 by SignalP 2.0
                     HMM (Signal peptide probability 0.986) with cleavage site
                     probability 0.848 between residues 18 and 19"
     misc_feature    480684..481028
                     /note="HMMPfam hit to PF06476, DUF1090, score 1.2e-20"
     misc_feature    480717..480749
                     /note="PS00013 Prokaryotic membrane lipoprotein lipid
                     attachment site."
     misc_feature    481146..481473
                     /note="BLAST vs contig00023 (=4.504 nt): %id=96,34;
                     alignmLength=328 (last part: 4176-4503); 12 mismatches;
                     Evalue=3e-158; bitscore=555."
     repeat_region   complement(481146..482388)
                     /rpt_family="IS3"
                     /note="Transposase ISVal2 (1.243 bp)"
     CDS             complement(481176..482096)
                     /pseudo
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0413c"
                     /old_locus_tag="TVA3037"
                     /product="Transposase, ISVal2-orfB (IS3 family;
                     ISVal2/ISVpe1)"
                     /note="user locus_tag: VANGcII0413c"
                     /note="Similar to Vibrio parahaemolyticus serotype O3:K6
                     (strain RIMD 2210633) subname: full=putative transposase
                     UniProt:Q87NT1 (283 aa) fasta scores: E()=5.1e-111, 89.8%
                     id in 283 aa. ISVal2_aa2 (length 309): id 264/283 (93%)
                     positives 273/283 (96%); ISVpa2_aa2 (306): Id 254/283
                     (89%), Positives=272/283 (96%). IS3 group (InsF for
                     insertion sequence IS3A/B/C/D/E/fA)."
     misc_feature    complement(481191..481673)
                     /note="HMMPfam hit to PF00665, rve, score 2.7e-49"
     misc_feature    complement(481941..482006)
                     /note="Predicted helix-turn-helix motif with score
                     1515.000, SD 4.35 at aa 8-29, sequence
                     FSIVRMAKVFGISRSGFYYWIK"
     CDS             complement(482042..482326)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0414c"
                     /old_locus_tag="TVA3036"
                     /product="Transposase, ISVal2-orfA (IS3 family)"
                     /note="user locus_tag: VANGcII0414c"
                     /protein_id="CDQ48311.1"
                     /translation="MTTKKTRIKHSPEFKAEALKLADKVGVAATARQLSLHESQIYGW
                     RKNSKKDTSTSQREQELTAEVAKLKRQLAEQAEELEIVKKAATYFAKNLK"
     misc_feature    complement(482081..482308)
                     /note="HMMPfam hit to PF01527, Transposase_8, score
                     4.5e-13"
     misc_feature    complement(482189..482254)
                     /note="Predicted helix-turn-helix motif with score
                     1225.000, SD 3.36 at aa 25-46, sequence
                     VGVAATARQLSLHESQIYGWRK"
     CDS             complement(482360..482623)
                     /pseudo
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0415c"
                     /old_locus_tag="TVA3035"
                     /product="putative uncharacterized (replication) protein"
                     /note="user locus_tag: VANGcII0415c"
                     /note="Putative bacteriophage replication gene A protein
                     (fragment)"
                     /db_xref="PSEUDO:CDQ48312.1"
     CDS             complement(482634..483167)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0416c"
                     /old_locus_tag="TVA3034"
                     /product="putative uncharacterized (replication) protein"
                     /note="user locus_tag: VANGcII0416c"
                     /protein_id="CDQ48313.1"
                     /translation="MSMEHLYTPALEPVRHFSEPRLPIEPKRFVSAPKFISKPRLSSF
                     AQFMEDFKLPKRYDLSKINTLTNWREDLYRSTFRHGDFSRHMTRSFLDTCDNKSFNEA
                     MIQVQAANDRLLINGHSAAMSDDEIKDLASAKSRAFKKQILSLPEPEQFAKACQLLAS
                     LGLSFRDELIKEKGKKR"
     CDS             complement(483170..483403)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0417c"
                     /old_locus_tag="TVA3033"
                     /product="putative uncharacterized protein"
                     /note="user locus_tag: VANGcII0417c"
                     /protein_id="CDQ48314.1"
                     /translation="MAILVKKAKLSNSMNPFVIIQLTSNHFLSSNGSYGSNRFAITPC
                     RLNAVKLPLVTANSVLHQVKREFPLAQISYEVC"
     CDS             complement(483406..483972)
                     /transl_table=11
                     /locus_tag="VANGNB10_cII0418c"
                     /old_locus_tag="TVA3032"
                     /product="putative exonuclease"
                     /note="user locus_tag: VANGcII0418c"
                     /protein_id="CDQ48315.1"
                     /translation="MYALNLENSVIIDTETTGLDSDA