LOCUS       BT068927                1573 bp    mRNA    linear   PLN 15-JUN-2012
DEFINITION  Zea mays full-length cDNA clone ZM_BFc0036L12 mRNA, complete cds.
ACCESSION   BT068927
VERSION     BT068927.2
KEYWORDS    FLI_CDNA.
SOURCE      Zea mays
  ORGANISM  Zea mays
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; PACMAD
            clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae;
            Zea.
REFERENCE   1  (bases 1 to 1573)
  AUTHORS   Soderlund,C., Descour,A., Kudrna,D., Bomhoff,M., Boyd,L.,
            Currie,J., Angelova,A., Collura,K., Wissotski,M., Ashley,E.,
            Morrow,D., Fernandes,J., Walbot,V. and Yu,Y.
  TITLE     Sequencing, mapping, and analysis of 27,455 maize full-length cDNAs
  JOURNAL   PLoS Genet. 5 (11), E1000740 (2009)
   PUBMED   19936069
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1573)
  AUTHORS   Yu,Y., Currie,J., Lomeli,R., Angelova,A., Collura,K., Wissotski,M.,
            Campos,D., Kudrna,D., Golser,W., Ashely,E., Haller,K., Descour,A.,
            Fernandes,J., Soderlund,C. and Walbot,V.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-FEB-2009) Plant Sciences, Arizona Genomics Institute,
            1657 E. Helen Street, Thomas Keating Building, Tucson, AZ 85721,
            USA
REFERENCE   3  (bases 1 to 1573)
  AUTHORS   Yu,Y., Currie,J., Lomeli,R., Angelova,A., Collura,K., Wissotski,M.,
            Campos,D., Kudrna,D., Golser,W., Ashely,E., Descour,A.,
            Fernandes,J., Soderlund,C. and Walbot,V.
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2012) Plant Sciences, Arizona Genomics Institute,
            1657 E. Helen Street, Thomas Keating Building, Tucson, AZ 85721,
            USA
  REMARK    Sequence reverse complemented by GenBank staff
COMMENT     On Jun 15, 2012 this sequence version replaced BT068927.1.
FEATURES             Location/Qualifiers
     source          1..1573
                     /organism="Zea mays"
                     /mol_type="mRNA"
                     /strain="B73"
                     /db_xref="taxon:4577"
                     /clone="ZM_BFc0036L12"
     CDS             193..1527
                     /codon_start=1
                     /product="unknown"
                     /protein_id="ACN35824.1"
                     /translation="MLLLLLVLLRRRCRFLVPRVYEAAHPSECNIQRVQAHVGEAHPE
                     PARLRAMARRARRDVELRLPQHPVPQAELAGDGGGLAEQPPHVHPHEQPGVAAEARHA
                     RAGQPGDDVVVPRPEALAVGADVGVREPGVREHGGERLLRLRRHEREAGHAARRGDHG
                     VVVRVHDADAEPREAQVLGQAVHDVDALRDAGVAAGLDQLRHADQVRRREDRAGVYLV
                     GDEVDVVAGHEVEHVLEGRPRHGGAQRVGRVGEQDGADARPRCLGLLVRRLERGGRDL
                     EPVGAVAVHRHDVHPRPPPQVSVETRIVRSRDQQRVSRVGQDEREQLVSCRGAGGEHD
                     AVGVKPGLAAPNLLHEVGHRLSEGLEAVVVLEQRVVPEAGDAGAGAAPARGLRVVPEV
                     PLEEVEGHLVLGEAHLNDAAGVGDGVVGVLVVGFPPGEVGRVLAVEAGSGHL"
BASE COUNT          272 a          498 c          522 g          281 t
ORIGIN      
        1 gcttgggcca aagtaagaat ttttataaat acatacatat atgtgtccct cctccatctg
       61 agaggcgata gttattgtta caaaatcgat gttaccatca atcgaaaaac cataaaagaa
      121 tccccctgta taactactct gtgatttaat ctgtccaatg acgtaattta ccctccaaaa
      181 aatttacttc gtatgctgct gctgctgcta gtgctgctgc gtcgacgctg tcgtttcctt
      241 gttccacgtg tctacgaagc ggctcatcct agcgagtgca acatccagcg tgtccaggct
      301 catgttggcg aagcacaccc tgaaccagcc aggctccgag caatggcacg acgagcccgg
      361 cgagatgttg agcttcgcct cccgcagcat ccggtcccac aggcggagct cgccggcgac
      421 ggtggtggcc tcgccgagca gccgcctcat gtccatccac acgaacagcc cggcgttgcc
      481 gcggaggcac ggcacgcccg cgcgggccag cccggcgacg acgtggtcgt gccgcgcccg
      541 gaggcgctgg cggttggtgc ggacgtaggc gtccgcgaac ccggcgtccg agagcatggc
      601 ggcgagcgtc ttctgcgtct gcgacgacac gagcgtgagg ctggacatgc ggcgcgccgc
      661 ggtgaccacg gcgtcgttgt acgagtacac gacgccgacg cggaaccccg ggaggcccag
      721 gtccttggac aggctgtaca cgatgtggac gcgctccgcg acgccggggt cgccgcggga
      781 ctcgaccagc tccgccacgc tgaccaggtc cggcgccgcg aagaccgagc cggagtatat
      841 ctcgtcggag atgaggtgga tgttgttgcg ggccacgaag tcgagcacgt cctcgagggc
      901 cggccgcgtc acggtggtgc ccagcgggtt ggacgggttg gtgagcagga cggcgcggac
      961 gcgcgtcccc gctgcctcgg cctcctcgta cgccgcctgg agcgcggcgg ccgtgacctg
     1021 gaacccgttg gcgctgtcgc agtgcaccgg cacgatgttc acccccgtcc tccaccgcag
     1081 gtctctgtcg aaaccaggat agtaaggagt agggatcagc agcgcgtctc ccgggttggc
     1141 caggacgaac gtgagcagct cgttagctgc cgtggcgccg gcggtgagca cgatgcggtc
     1201 ggggtcaaac cgggccttgc cgcccctaac cttctccatg aagttggcca tcgcctttct
     1261 gaaggccttg aggccgtggt agtcctggaa cagcgcgttg tccctgaagc tggcgacgcc
     1321 ggagccggag ccgccccagc ccgcggcctc cgggtggtcc ctgaggtacc cctcgaggag
     1381 gtcgaaggac acctggttct cggcgaggcc catctgaatg acgccgccgg ggttggagac
     1441 ggcgtcgtag gggttctcgt cgtaggcttt ccacccggcg aagtagggcg agtcctcgcc
     1501 gtggaggccg gaagtggcca cctttgacag gggaggcgac gccaccgcgt gcgcgtggcg
     1561 gctctggctc gcg
//