LOCUS       BC017996                 438 bp    mRNA    linear   HUM 26-JUL-2016
DEFINITION  Homo sapiens similar to CG32736-PA, mRNA (cDNA clone
            IMAGE:4251653), partial cds.
ACCESSION   BC017996
VERSION     BC017996.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 438)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 438)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (03-DEC-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC/DCTD/DTP
            cDNA Library Preparation: CLONTECH Laboratories, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Sequencing Group at the Stanford Human Genome
            Center, Stanford University School of Medicine, Stanford, CA  94305
            Web site:       http://www-shgc.stanford.edu
            Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
            Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
            R. M.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 35 Row: f Column: 15
            This clone was selected for full length sequencing because it
            passed the following selection criteria: Hexamer frequency ORF
            analysis.
FEATURES             Location/Qualifiers
     source          1..438
                     /db_xref="H-InvDB:HIT000089519"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="IMAGE:4251653"
                     /tissue_type="Skin, melanotic melanoma, high MDR."
                     /clone_lib="NIH_MGC_62"
                     /lab_host="DH10B"
                     /note="Vector: pDNR-LIB"
     gene            <1..438
                     /gene="LOC440957"
                     /db_xref="GeneID:440957"
     CDS             <1..364
                     /gene="LOC440957"
                     /codon_start=2
                     /product="LOC440957 protein"
                     /protein_id="AAH17996.1"
                     /db_xref="GeneID:440957"
                     /translation="LVRLPDSGGGRRSLVSQVAVHGENGRGGLGCVRAIQCLVPSYPS
                     PRPRSSMFTRAQVRRILQRVPGKQRFGIYRFLPFFFVLGGTMEWIMIKVRVGQETFYD
                     VYRRKASERQYQRRLEDE"
BASE COUNT          121 a          104 c          124 g           89 t
ORIGIN      
        1 actcgtgcgc ctaccagaca gtggcggagg acggcgctcg ctagtctccc aggtcgcggt
       61 acacggcgag aacgggcggg gcggtctcgg ctgcgtccgg gcgatccagt gcttagttcc
      121 gtcatatccc tctccacgac ctcggtcgag catgttcacc agggcccagg tgagacggat
      181 tctgcagcgg gtgcccggga agcagcgatt tggcatctac cggttcctgc ccttcttttt
      241 tgtcctggga ggaacgatgg agtggatcat gattaaagtg cgcgtgggcc aggagacctt
      301 ctatgatgtc taccgtagaa aagcctcaga aagacagtat cagagaaggc tggaagatga
      361 atgagactga acttcagcag tcaataaagt caatatgaat ttttactcaa aaaaaaaaaa
      421 aaaaaaaaaa aaaaaaaa
//