LOCUS       BC008336                3116 bp    mRNA    linear   HUM 12-JUL-2001
DEFINITION  Homo sapiens, clone IMAGE:3506235, mRNA, partial cds.
ACCESSION   BC008336
VERSION     BC008336.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3116)
  AUTHORS   Strausberg,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-MAY-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Cancer Genomics Office, National Cancer
            Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590,
            USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: DCTD/DTP
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Genome Sequence Centre,
            BC Cancer Agency, Vancouver, BC, Canada
            info@bcgsc.bc.ca
            Steven Jones, Jennifer Asano, Ian Bosdet, Yaron Butterfield,
            Susanna Chan, Readman Chiu, Chris Fjell, Erin Garland, Ran Guin,
            Letticia Hsiao, Martin Krzywinski, Reta Kutsche, Oliver Lee, Soo
            Sen Lee, Victor Ling, Carrie Mathewson, Candice McLeavy, Steven
            Ness, Pawan Pandoh, Anna-Liisa Prabhu, Parvaneh Saeedi, Jacqueline
            Schein, Duane Smailus, Michael Smith, Lorraine Spence, Jeff Stott,
            Michael Thorne, Miranada Tsai, Natasja van den Bosch, Jill Vardy,
            George Yang, Scott Zuyderduyn, Marco Marra.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 23 Row: d Column: 11.
FEATURES             Location/Qualifiers
     source          1..3116
                     /db_xref="H-InvDB:HIT000087041"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="IMAGE:3506235"
                     /tissue_type="Kidney, renal cell adenocarcinoma"
                     /clone_lib="NIH_MGC_14"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     CDS             <1..1785
                     /codon_start=1
                     /product="Unknown (protein for IMAGE:3506235)"
                     /protein_id="AAH08336.1"
                     /translation="NKDTGHSNRQSDVRIKFEHNGERRIIAFSRPVKYEDVEHKVTTV
                     FGQPLDLHYMNNELSILLKNQDDLDKAIDILDRSSSMKSLRILLLSQDRNHNSSSPHS
                     GVSRQVRIKASQSAGDINTIYQPPEPRSRHLSVSSQNPGRSSPPPGYVPERQQHIARQ
                     GSYTSINSEGEFIPETSEQCMLDPLSSAENSLSGSCQSLDRSADSPSFRKSRMSRAQS
                     FPDNRQEYSDRETQLYDKGVKGGTYPRRYHVSVHHKDYSDGRRTFPRIRRHQGNLFTL
                     VPSSRSLSTNGENMGLAVQYLDPRGRLRSADSENALSVQERNVPTKSPSAPINWRRGK
                     LLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKNLQHERI
                     VQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHS
                     NMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGMRSVTGTPYWMSPEVIS
                     GEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLPSHISEHGRD
                     FLRRIFVEARQRPSAEELLTHHFAQLMY"
BASE COUNT          713 a          879 c          887 g          637 t
ORIGIN      
        1 aacaaagaca caggtcactc aaataggcag agtgacgtca gaatcaagtt cgagcacaac
       61 ggggagaggc gaattatagc gttcagccgg cctgtgaaat atgaagatgt ggagcacaag
      121 gtgacaacag tatttggaca acctcttgat ctacattaca tgaacaatga gctctccatc
      181 ctgctgaaaa accaagatga tcttgataaa gcaattgaca ttttagatag aagctcaagc
      241 atgaaaagcc ttaggatatt gctgttgtcc caggacagaa accataacag ttcctctccc
      301 cactctgggg tgtccagaca ggtgcggatc aaggcttccc agtccgcagg ggatataaat
      361 actatctacc agccccccga gcccagaagc aggcacctct ctgtcagctc ccagaaccct
      421 ggccgaagct cacctccccc tggctatgtt cctgagcggc agcagcacat tgcccggcag
      481 gggtcctaca ccagcatcaa cagtgagggg gagttcatcc cagagaccag cgagcagtgc
      541 atgctggatc ccctgagcag tgcagaaaat tccttgtctg gaagctgcca atccttggac
      601 aggtcagcag acagcccatc cttccggaaa tcacgaatgt cccgtgccca gagcttccct
      661 gacaacagac aggaatactc agatcgggaa actcagcttt atgacaaagg ggtcaaaggt
      721 ggaacctacc cccggcgcta ccacgtgtct gtgcaccaca aggactacag tgatggcaga
      781 agaacatttc cccgaatacg gcgtcatcaa ggcaacttgt tcaccctggt gccctccagc
      841 cgctccctga gcacaaatgg cgagaacatg ggtctggctg tgcaatacct ggacccccgt
      901 gggcgcctgc ggagtgcgga cagcgagaat gccctctctg tgcaggagag gaatgtgcca
      961 accaagtctc ccagtgcccc catcaactgg cgccggggaa agctcctggg ccagggtgcc
     1021 ttcggcaggg tctatttgtg ctatgacgtg gacacgggac gtgaacttgc ttccaagcag
     1081 gtccaatttg atccagacag tcctgagaca agcaaggagg tgagtgctct ggagtgcgag
     1141 atccagttgc taaagaactt gcagcatgag cgcatcgtgc agtactatgg ctgtctgcgg
     1201 gaccgcgctg agaagaccct gaccatcttc atggagtaca tgccaggggg ctcggtgaaa
     1261 gaccagttga aggcttacgg tgctctgaca gagagcgtga cccgaaagta cacgcggcag
     1321 atcctggagg gcatgtccta cctgcacagc aacatgattg ttcaccggga cattaaggga
     1381 gccaacatcc tccgagactc tgctgggaat gtaaagctgg gggactttgg ggccagcaaa
     1441 cgcctgcaga cgatctgtat gtcggggacg ggcatgcgct ccgtcactgg cacaccctac
     1501 tggatgagcc ctgaggtgat cagcggcgag ggctatggaa ggaaagcaga cgtgtggagc
     1561 ctgggctgca ctgtggtgga gatgctgaca gagaaaccac cgtgggcaga gtatgaagct
     1621 atggccgcca tcttcaagat tgccacccag cccaccaatc ctcagctgcc ctcccacatc
     1681 tctgaacatg gccgggactt cctgaggcgc atttttgtgg aggctcgcca gagaccttca
     1741 gctgaggagc tgctcacaca ccactttgca cagctcatgt actgagctct cacggccaca
     1801 cagctgccgg tcgccctttg ctgcatggca gggggctgct gctgggctca gtgaagttgc
     1861 tgcttctccc aggcaaggct gtggaccatg gagtggcagc ccagccagcg tcggtctgtg
     1921 ccccttccgc cactggggct cagagccggg gtggggtggc tgcagcctca ggactgggag
     1981 cccccagcct gtcagatcca ggagctccag tgtcctgagc tcagcgtgga ggggtagggg
     2041 ctgggaacag tgtgcaaggc agccgtgggc cccaccctcg gggatgtgtc ctgacactgc
     2101 aattggcacc gaagcccaga gggtctgggg gcacaagact gacgccaggg tatgaagagt
     2161 gttattttca ttcaaagtgt tattttgttt ttccttccaa tgtctggaga ccaccagggc
     2221 atctctgggc tggatgagct cccacaagcc tgagggaaag gccagcactc gctagcagtg
     2281 gcaggcagag gcccaggctg ccgtccccta gagtcccagg ttggctctgc cagtcctgtc
     2341 ctttaccaaa gatgaatgaa gcaaatgtca tgctgcctta ttcagggaag gaggagcctg
     2401 tcctgcctgt ggccatgacc ctgcctctcc caggcagggg cccgcgatgt ggaactgctg
     2461 ccactgaggg gggatccagt tttgtcaatg cagttgtctc tgttttacaa gttggagtca
     2521 ctcttatgct gtacccagtt tctaaactgg agactgtgtg tgccctctgg gctctgagta
     2581 cccctgcttt gggcttgggc ctaggctgca ttgaaaagag ctgaaggttg tggcctttgc
     2641 gctcctggcc cagcctttgt tccccactgg agcagaaggg gagatggacg acacggtggg
     2701 ggcatctggc ctggccagtg ccctgatccc agagagcccg aggaggtgtc tcaggctgcc
     2761 tgagtcgtga cctgctaggc cagagcccac tccatctggt agaagggaaa gcccatatgc
     2821 taccaccagc tgtgtccaaa accgccagct ctgttcttcc tcagccagcc tcgcccatcc
     2881 ccttgaggtc tcagcccctt tcccttgtag ctcctcccct ggagggggaa tggcagcagg
     2941 ggttggggaa acagcatctc caagcagctt agagttggcc atatttacct cagcctgggc
     3001 gctggtcctt tcttccggcc cctcccctcc aaaatgtgcc tattgctaga gctcctccct
     3061 ctcaacaccc agtttccttg ggagttgtca aaaaaaaaaa aaaaaaaaaa aaaaaa
//