LOCUS BC007054 1156 bp mRNA linear HUM 03-OCT-2003
DEFINITION Homo sapiens TBC1 domain family, member 7, mRNA (cDNA clone
MGC:12476 IMAGE:3828592), complete cds.
ACCESSION BC007054
VERSION BC007054.1
KEYWORDS MGC.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1156)
AUTHORS Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
TITLE Generation and initial analysis of more than 15,000 full-length
human and mouse cDNA sequences
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
PUBMED 12477932
REFERENCE 2 (bases 1 to 1156)
AUTHORS Strausberg,R.
TITLE Direct Submission
JOURNAL Submitted (30-APR-2001) National Institutes of Health, Mammalian
Gene Collection (MGC), Cancer Genomics Office, National Cancer
Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590,
USA
REMARK NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT Contact: MGC help desk
Email: cgapbs-r@mail.nih.gov
Tissue Procurement: ATCC
cDNA Library Preparation: CLONTECH Laboratories, Inc.
cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
DNA Sequencing by: Sequencing Group at the Stanford Human Genome
Center, Stanford University School of Medicine, Stanford, CA 94305
Web site: http://www-shgc.stanford.edu
Contact: (Dickson, Mark) mcd@paxil.stanford.edu
Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
R. M.
Clone distribution: MGC clone distribution information can be found
through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
Series: IRAL Plate: 16 Row: a Column: 21
This clone was selected for full length sequencing because it
passed the following selection criteria: matched mRNA gi: 24475975.
FEATURES Location/Qualifiers
source 1..1156
/db_xref="H-InvDB:HIT000033015"
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/clone="MGC:12476 IMAGE:3828592"
/tissue_type="Kidney, hypernephroma"
/clone_lib="NIH_MGC_58"
/lab_host="DH10B"
/note="Vector: pDNR-LIB"
gene 1..1156
/gene="TBC1D7"
/gene_synonym="dJ257A7.3"
/db_xref="GeneID:51256"
CDS 98..979
/gene="TBC1D7"
/gene_synonym="dJ257A7.3"
/codon_start=1
/product="TBC1D7 protein"
/protein_id="AAH07054.1"
/db_xref="GeneID:51256"
/translation="MTEDSQRNFRSVYYEKVGFRGVEEKKSLEILLKDDRLDTEKLCT
FSQRFPLPSMYRALVWKVLLGILPPHHESHAKVMMYRKEQYLDVLHALKVVRFVSDAT
PQAEVYLRMYQLESGKLPRSPSFPLEPDDEVFLAIAKAMEEMVEDSVDCYWITRRFVN
QLNTKYRDSLPQLPKAFEQYLNLEDGRLLTHLRMCSAAPKLPYDLWFKRCFAGCLPES
SLQRVWDKVVSGSCKILVFVAVEILLTFKIKVMALNSAEKITKFLENIPQDSSDAIVS
KAIDLWHKHCGTPVHSS"
misc_feature 602..952
/gene="TBC1D7"
/gene_synonym="dJ257A7.3"
/note="COG5210; Region: COG5210, GTPase-activating protein
[General function prediction only]"
/db_xref="CDD:COG5210"
BASE COUNT 309 a 247 c 290 g 310 t
ORIGIN
1 gatgtcacgt ccggcggcgg cggcagcggc agcggcagcg gcgctgagtt ttgtctcccc
61 ggccgtctgg gcgcgcgcgg gtgtcccaga atgaaatatg actgaggact ctcagagaaa
121 ctttcgttca gtatattatg agaaagtggg gtttcgtgga gttgaagaaa agaaatcatt
181 agaaattctc ctaaaagatg accgtctgga tactgagaaa ctttgtactt ttagtcagag
241 gttccctctc ccgtccatgt accgtgcatt ggtatggaag gtgcttctag gaatcttgcc
301 tccacaccac gagtcccatg ccaaggtgat gatgtatcgt aaggagcagt acttggatgt
361 ccttcatgcc ctgaaagtcg ttcgctttgt tagtgatgcc acacctcagg ctgaagtcta
421 tctccgcatg tatcagctgg agtctgggaa gttacctcga agtccctctt ttccactgga
481 gccagatgat gaagtgtttc ttgccatagc taaagccatg gaggaaatgg tggaagatag
541 tgtcgactgt tactggatca cccgacgctt tgtgaaccaa ttaaatacca agtaccggga
601 ttccttgccc cagttgccaa aagcgtttga acaatacttg aatctggaag atggcagact
661 gctgactcat ctgaggatgt gttccgcggc gcccaaactt ccttatgatc tctggttcaa
721 gaggtgcttt gcgggatgtt tgcctgaatc cagtttacag agggtttggg ataaagttgt
781 gagtggatcc tgtaagatcc tagtttttgt agctgtcgaa attttattaa cctttaaaat
841 aaaagttatg gcactgaaca gtgcagagaa gataacaaag tttctggaaa atattcccca
901 ggacagctca gacgcgatcg tgagcaaggc cattgacttg tggcacaaac actgtgggac
961 cccggtccat tcaagctgaa cgcacccgct ggttgtggac cgtctgccag gcaccacagt
1021 gagcattgtg ttcttggcat gtgatctggg aaactgattg aataatacac ttttcttgct
1081 ttggtgctca aagtggtttt tttcccccaa taaaattatt taatcgaaaa aaaaaaaaaa
1141 aaaaaaaaaa aaaaaa
//