LOCUS Z25436 150 bp mRNA linear HUM 22-JUL-1994 DEFINITION H.sapiens protein-tyrosine kinase gene, complete CDS. ACCESSION Z25436 VERSION Z25436.1 KEYWORDS protein-tyrosine kinase. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 2 (bases 1 to 150) AUTHORS Schultz S.J. JOURNAL Submitted (03-AUG-1993) to the INSDC. SCHULTZ S. J., University of Washington, Microbiology, SEATTLE, Washington, USA, 98195 REFERENCE 3 (bases 1 to 150) AUTHORS Schultz S.J., Nigg E.A. TITLE Identification of 21 novel human protein kinases, including 3 members of a family related to the cell cycle regulator nimA of Aspergillus nidulans JOURNAL Cell Growth Differ. 4(10), 821-830(1993). PUBMED 8274451 FEATURES Location/Qualifiers source 1..150 /db_xref="H-InvDB:HIT000326717" /organism="Homo sapiens" /mol_type="mRNA" /cell_line="HL-60" /db_xref="taxon:9606" CDS <1..>150 /codon_start=1 /product="protein-tyrosine kinase" /note="cloned using degenerate PCR primers representing conserved protein kinase subdomains VII and IX; encodes an open reading frame between subdomains VII and IX of protein kinase catalytic domain" /db_xref="GOA:Q15457" /db_xref="H-InvDB:HIT000326717.12" /db_xref="InterPro:IPR000719" /db_xref="InterPro:IPR001245" /db_xref="InterPro:IPR011009" /db_xref="UniProtKB/TrEMBL:Q15457" /citation=[3] /protein_id="CAA80923.1" /translation="KIADFGLSRNIYSADYYKANENGAIPIRWMPPESIFYNRYTTES DVWARG" BASE COUNT 43 a 39 c 32 g 36 t ORIGIN 1 aagatagcgg atttcggcct ctccaggaac atctactcag cagactacta caaagctaat 61 gaaaacggcg ctatccctat ccgttggatg ccaccagagt ccatttttta taaccgctac 121 actacagagt ctgatgtatg ggcacgaggt //