LOCUS       Z25436                   150 bp    mRNA    linear   HUM 22-JUL-1994
DEFINITION  H.sapiens protein-tyrosine kinase gene, complete CDS.
ACCESSION   Z25436
VERSION     Z25436.1
KEYWORDS    protein-tyrosine kinase.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   2  (bases 1 to 150)
  AUTHORS   Schultz S.J.
  JOURNAL   Submitted (03-AUG-1993) to the INSDC. SCHULTZ S. J., University of
            Washington, Microbiology, SEATTLE, Washington, USA, 98195
REFERENCE   3  (bases 1 to 150)
  AUTHORS   Schultz S.J., Nigg E.A.
  TITLE     Identification of 21 novel human protein kinases, including 3
            members of a family related to the cell cycle regulator nimA of
            Aspergillus nidulans
  JOURNAL   Cell Growth Differ. 4(10), 821-830(1993).
   PUBMED   8274451
FEATURES             Location/Qualifiers
     source          1..150
                     /db_xref="H-InvDB:HIT000326717"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /cell_line="HL-60"
                     /db_xref="taxon:9606"
     CDS             <1..>150
                     /codon_start=1
                     /product="protein-tyrosine kinase"
                     /note="cloned using degenerate PCR primers representing
                     conserved protein kinase subdomains VII and IX; encodes an
                     open reading frame between subdomains VII and IX of
                     protein kinase catalytic domain"
                     /db_xref="GOA:Q15457"
                     /db_xref="H-InvDB:HIT000326717.12"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR001245"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q15457"
                     /citation=[3]
                     /protein_id="CAA80923.1"
                     /translation="KIADFGLSRNIYSADYYKANENGAIPIRWMPPESIFYNRYTTES
                     DVWARG"
BASE COUNT           43 a           39 c           32 g           36 t
ORIGIN      
        1 aagatagcgg atttcggcct ctccaggaac atctactcag cagactacta caaagctaat
       61 gaaaacggcg ctatccctat ccgttggatg ccaccagagt ccatttttta taaccgctac
      121 actacagagt ctgatgtatg ggcacgaggt
//