LOCUS HUMVWF 714 bp mRNA linear HUM 14-JAN-1995
DEFINITION Human von Willebrand factor (vWF) mRNA.
ACCESSION K03028
VERSION K03028.1
KEYWORDS glycoprotein; von Willebrand factor.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 333 to 714)
AUTHORS Lynch,D.C.
JOURNAL Unpublished
REFERENCE 2 (bases 333 to 714)
AUTHORS Lynch,D.C., Zimmerman,T.S., Collins,C.J., Brown,M., Morin,M.J.,
Ling,E.H. and Livingston,D.M.
TITLE Molecular cloning of cDNA for human von Willebrand factor:
authentication by a new method
JOURNAL Cell 41 (1), 49-56 (1985)
PUBMED 3873280
REFERENCE 3 (bases 333 to 598)
AUTHORS Verweij,C.L., de Vries,C.J., Distel,B., van Zonneveld,A.J., van
Kessel,A.G., van Mourik,J.A. and Pannekoek,H.
TITLE Construction of cDNA coding for human von Willebrand factor using
antibody probes for colony-screening and mapping of the chromosomal
gene
JOURNAL Nucleic Acids Res. 13 (13), 4699-4717 (1985)
PUBMED 3875078
REFERENCE 4 (bases 1 to 622)
AUTHORS Ginsburg,D., Handin,R.I., Bonthron,D.T., Donlon,T.A., Bruns,G.A.,
Latt,S.A. and Orkin,S.H.
TITLE Human von Willebrand factor (vWF): isolation of complementary DNA
(cDNA) clones and chromosomal localization
JOURNAL Science 228 (4706), 1401-1406 (1985)
PUBMED 3874428
COMMENT Original source text: Human umbilical cord endothelial cell, cDNA
to mRNA, clones pDL34 [2], pvWF1210 [3], pVWd and pVWE6 [4].
[1] revises [2].
Draft entry and clean copy sequence for [2],[1] kindly provided by
D.Lynch, 17-SEP-1985; for [4] by D.Ginsberg, 09/17/85. The von
Willebrand factor is a large adhesive plasma glycoprotein, (the
MRNA spans about 9 kb and the coding region 6 kb) that is
instrumental in mediating the attachment of platelets to damaged
areas of the circulatory system and serves as a carrier for factor
VIIIC. Pro-vWF is mainly produced in endothelial cells and
undergoes a series of amino-terminal post-translational
modifications, producing two subunits, which combine to form vFW
multimers. The vWF gene is large and appears to be interrupted by
many introns. The peptide starts with a possible signal peptide.
FEATURES Location/Qualifiers
source 1..714
/db_xref="H-InvDB:HIT000191405"
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/map="12pter-p12"
gene 1..714
/gene="F8VWF"
mRNA <1..714
/gene="F8VWF"
/product="vWF mRNA"
CDS <1..584
/gene="F8VWF"
/note="von Willebrand factor"
/codon_start=3
/protein_id="AAA61293.1"
/db_xref="GDB:G00-119-125"
/translation="KTTCNPCPLGYKEENNTGECCGRCLPTACTIQLRGGQIMTLKRD
ETLQDGCDTHFCKVNERGEYFWEKRVTGCPPFDEHKCLAEGGKIMKIPGTCCDTCEEP
ECNDITARLQYVKVGSCKSEVEVDIHYCQGKCASKAMYSIDINDVQDQCSCCSPTRTE
PMQVALHCTNGSVVYHEVLNAMECKCSPRKCSK"
BASE COUNT 173 a 179 c 206 g 156 t
ORIGIN 112 bp upstream of Sau3A site; chromosome 1pter-p12.
1 ggaagaccac ctgcaacccc tgccccctgg gttacaagga agaaaataac acaggtgaat
61 gttgtgggag atgtttgcct acggcttgca ccattcagct aagaggagga cagatcatga
121 cactgaagcg tgatgagacg ctccaggatg gctgtgatac tcacttctgc aaggtcaatg
181 agagaggaga gtacttctgg gagaagaggg tcacaggctg cccacccttt gatgaacaca
241 agtgtctggc tgagggaggt aaaattatga aaattccagg cacctgctgt gacacatgtg
301 aggagcctga gtgcaacgac atcactgcca ggctgcagta tgtcaaggtg ggaagctgta
361 agtctgaagt agaggtggat atccactact gccagggcaa atgtgccagc aaagccatgt
421 actccattga catcaacgat gtgcaggacc agtgctcctg ctgctctccg acacggacgg
481 agcccatgca ggtggccctg cactgcacca atggctctgt tgtgtaccat gaggttctca
541 atgccatgga gtgcaaatgc tcccccagga agtgcagcaa gtgaggctgc tgcagctgca
601 tgggtgcctg ctgctgcctg ccttggcctg atgtggccag agtgctgcca gtcctctgca
661 tgttgtgctc ttgtgccctt ctgagcccac aataaaggct gagctcttat ctgc
//