LOCUS CR541713 975 bp mRNA linear HUM 16-OCT-2008 DEFINITION Homo sapiens full open reading frame cDNA clone RZPDo834B0329D for gene IRF1, interferon regulatory factor 1; complete cds, without stopcodon. ACCESSION CR541713 VERSION CR541713.1 KEYWORDS Full ORF shuttle clone, Gateway(TM), complete cds. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 975) AUTHORS Halleck,A., Ebert,L., Mkoundinya,M., Schick,M., Eisenstein,S., Neubert,P., Kstrang,K., Schatten,R., Shen,B., Henze,S., Mar,W., Korn,B., Zuo,D., Hu,Y. and LaBaer,J. TITLE Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201) JOURNAL Unpublished. REFERENCE 2 (bases 1 to 975) AUTHORS Halleck,A., Ebert,L., Mkoundinya,M., Schick,M., Eisenstein,S., Neubert,P., Kstrang,K., Schatten,R., Shen,B., Henze,S., Mar,W., Korn,B., Zuo,D., Hu,Y. and LaBaer,J. JOURNAL Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld 580, D-69120 Heidelberg, Germany COMMENT RZPD; RZPDo834B0329D, ORFNo 3418 www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834B0329D RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.) RZPD LIB No. 834 www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834 www.rzpd.de/products/orfclones/ Contact: Inge Arlart RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH, Heubnerweg 6, D-14059 Berlin, Germany Tel: +49 30 32639 100 Fax: +49 30 32639 111 www.rzpd.de This clone is available from RZPD; Contact RZPD (customer.service@rzpd.de) for further information. This CDS clone is part of a collection of human full ORF clones jointly established and verified by the Harvard Institute of Proteomics (HIP) and RZPD. This CDS has been cloned without stopcodon. The CDS has been inserted into pDONR201 via a BP Clonase(TM) reaction. Additional sequence has been added in front of the start codon: att..AAAAAA GCA GGC TCC ACC (ATG). The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att The clone is validated by full sequence check. Compared to the reference sequence NM_002198 (GI:4504720) we did not find any amino acid exchanges. Clone distribution: http://www.rzpd.de/products/orfclones/ FEATURES Location/Qualifiers source 1..975 /db_xref="H-InvDB:HIT000268586" /organism="Homo sapiens" /lab_host="DH5Alpha" /mol_type="mRNA" /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD" /clone="RZPDo834B0329D" /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2" /db_xref="taxon:9606" CDS 1..>975 /codon_start=1 /gene="IRF1" /db_xref="GOA:Q6FHN8" /db_xref="H-InvDB:HIT000268586.12" /db_xref="InterPro:IPR001346" /db_xref="InterPro:IPR011991" /db_xref="InterPro:IPR017431" /db_xref="InterPro:IPR019817" /db_xref="UniProtKB/TrEMBL:Q6FHN8" /protein_id="CAG46514.1" /translation="MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHG WDINKDACLFRSWAIHTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSS AVRVYRMLPPLTKNQRKERKSKSSRDAKSKAKRKSCGDSSPDTFSDGLSSSTLPDDHSS YTVPGYMQDLEVEQALTPALSPCAVSSTLPDWHIPVEVVPDSTSDLYNFQVSPMPSTSE ATTDEDEEGKLPEDIMKLLEQSEWQPTNVDGKGYLLNEPGVQPTSVYGDFSCKEEPEID SPGGDIGLSLQRVFTDLKNMDATWLDSLLTPVRLPSIQAIPCAP" BASE COUNT 259 a 265 c 269 g 182 t ORIGIN 1 atgcccatca ctcggatgcg catgagaccc tggctagaga tgcagattaa ttccaaccaa 61 atcccggggc tcatctggat taataaagag gagatgatct tccagatccc atggaagcat 121 gctgccaagc atggctggga catcaacaag gatgcctgtt tgttccggag ctgggccatt 181 cacacaggcc gatacaaagc aggggaaaag gagccagatc ccaagacgtg gaaggccaac 241 tttcgctgtg ccatgaactc cctgccagat atcgaggagg tgaaagacca gagcaggaac 301 aagggcagct cagctgtgcg agtgtaccgg atgcttccac ctctcaccaa gaaccagaga 361 aaagaaagaa agtcgaagtc cagccgagat gctaagagca aggccaagag gaagtcatgt 421 ggggattcca gccctgatac cttctctgat ggactcagca gctccactct gcctgatgac 481 cacagcagct acacagttcc aggctacatg caggacttgg aggtggagca ggccctgact 541 ccagcactgt cgccgtgtgc tgtcagcagc actctccccg actggcacat cccagtggaa 601 gttgtgccgg acagcaccag tgatctgtac aacttccagg tgtcacccat gccctccacc 661 tctgaagcta caacagatga ggatgaggaa gggaaattac ctgaggacat catgaagctc 721 ttggagcagt cggagtggca gccaacaaac gtggatggga aggggtacct actcaatgaa 781 cctggagtcc agcccacctc tgtctatgga gactttagct gtaaggagga gccagaaatt 841 gacagcccag ggggggatat tgggctgagt ctacagcgtg tcttcacaga tctgaagaac 901 atggatgcca cctggctgga cagcctgctg accccagtcc ggttgccctc catccaggcc 961 attccctgtg caccg //