LOCUS       CR541713                 975 bp    mRNA    linear   HUM 16-OCT-2008
DEFINITION  Homo sapiens full open reading frame cDNA clone RZPDo834B0329D for
            gene IRF1, interferon regulatory factor 1; complete cds, without
            stopcodon.
ACCESSION   CR541713
VERSION     CR541713.1
KEYWORDS    Full ORF shuttle clone, Gateway(TM), complete cds.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 975)
  AUTHORS   Halleck,A., Ebert,L., Mkoundinya,M., Schick,M., Eisenstein,S.,
            Neubert,P., Kstrang,K., Schatten,R., Shen,B., Henze,S., Mar,W.,
            Korn,B., Zuo,D., Hu,Y. and  LaBaer,J.
  TITLE     Cloning of human full open reading frames in Gateway(TM) system
            entry vector (pDONR201)
  JOURNAL   Unpublished.
REFERENCE   2  (bases 1 to 975)
  AUTHORS   Halleck,A., Ebert,L., Mkoundinya,M., Schick,M., Eisenstein,S.,
            Neubert,P., Kstrang,K., Schatten,R., Shen,B., Henze,S., Mar,W.,
            Korn,B., Zuo,D., Hu,Y. and  LaBaer,J.
  JOURNAL   Submitted (28-JUN-2004) to the INSDC. RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH, Im Neuenheimer Feld
            580, D-69120 Heidelberg, Germany
COMMENT     RZPD; RZPDo834B0329D, ORFNo 3418
            www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=RZPDo834B0329D
            RZPDLIB; Human Full ORF Clones Gateway(TM) - RZPD (kan-resist.)
            RZPD LIB No. 834
            www.rzpd.de/cgi-bin/products/showLib.pl.cgi/response?libNo=834
            www.rzpd.de/products/orfclones/
            Contact: Inge Arlart
            RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH,
            Heubnerweg 6, D-14059 Berlin, Germany
            Tel: +49 30 32639 100
            Fax: +49 30 32639 111
            www.rzpd.de
            This clone is available from RZPD;
            Contact RZPD (customer.service@rzpd.de) for further information.
            
            This CDS clone is part of a collection of human full ORF clones
            jointly established and verified by the Harvard Institute of
            Proteomics (HIP) and RZPD.
            This CDS has been cloned without stopcodon.
            The CDS has been inserted into pDONR201 via a BP Clonase(TM)
            reaction.
            Additional sequence has been added in front of the start codon:
            att..AAAAAA GCA GGC TCC ACC (ATG).
            The last codon is followed by the 3' att site: GACCCAGCTTTCTT..att
            The clone is validated by full sequence check.
            Compared to the reference sequence NM_002198 (GI:4504720)
            we did not find any amino acid exchanges.
            Clone distribution: http://www.rzpd.de/products/orfclones/
FEATURES             Location/Qualifiers
     source          1..975
                     /db_xref="H-InvDB:HIT000268586"
                     /organism="Homo sapiens"
                     /lab_host="DH5Alpha"
                     /mol_type="mRNA"
                     /clone_lib="Human Full ORF Clones Gateway(TM) - RZPD"
                     /clone="RZPDo834B0329D"
                     /note="Vector: pDONR201, Site_1: attP1; Site_2: attP2"
                     /db_xref="taxon:9606"
     CDS             1..>975
                     /codon_start=1
                     /gene="IRF1"
                     /db_xref="GOA:Q6FHN8"
                     /db_xref="H-InvDB:HIT000268586.13"
                     /db_xref="InterPro:IPR001346"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR017431"
                     /db_xref="InterPro:IPR019817"
                     /db_xref="UniProtKB/TrEMBL:Q6FHN8"
                     /protein_id="CAG46514.1"
                     /translation="MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKH
                     GWDINKDACLFRSWAIHTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKG
                     SSAVRVYRMLPPLTKNQRKERKSKSSRDAKSKAKRKSCGDSSPDTFSDGLSSSTLPDD
                     HSSYTVPGYMQDLEVEQALTPALSPCAVSSTLPDWHIPVEVVPDSTSDLYNFQVSPMP
                     STSEATTDEDEEGKLPEDIMKLLEQSEWQPTNVDGKGYLLNEPGVQPTSVYGDFSCKE
                     EPEIDSPGGDIGLSLQRVFTDLKNMDATWLDSLLTPVRLPSIQAIPCAP"
BASE COUNT          259 a          265 c          269 g          182 t
ORIGIN
        1 atgcccatca ctcggatgcg catgagaccc tggctagaga tgcagattaa ttccaaccaa
       61 atcccggggc tcatctggat taataaagag gagatgatct tccagatccc atggaagcat
      121 gctgccaagc atggctggga catcaacaag gatgcctgtt tgttccggag ctgggccatt
      181 cacacaggcc gatacaaagc aggggaaaag gagccagatc ccaagacgtg gaaggccaac
      241 tttcgctgtg ccatgaactc cctgccagat atcgaggagg tgaaagacca gagcaggaac
      301 aagggcagct cagctgtgcg agtgtaccgg atgcttccac ctctcaccaa gaaccagaga
      361 aaagaaagaa agtcgaagtc cagccgagat gctaagagca aggccaagag gaagtcatgt
      421 ggggattcca gccctgatac cttctctgat ggactcagca gctccactct gcctgatgac
      481 cacagcagct acacagttcc aggctacatg caggacttgg aggtggagca ggccctgact
      541 ccagcactgt cgccgtgtgc tgtcagcagc actctccccg actggcacat cccagtggaa
      601 gttgtgccgg acagcaccag tgatctgtac aacttccagg tgtcacccat gccctccacc
      661 tctgaagcta caacagatga ggatgaggaa gggaaattac ctgaggacat catgaagctc
      721 ttggagcagt cggagtggca gccaacaaac gtggatggga aggggtacct actcaatgaa
      781 cctggagtcc agcccacctc tgtctatgga gactttagct gtaaggagga gccagaaatt
      841 gacagcccag ggggggatat tgggctgagt ctacagcgtg tcttcacaga tctgaagaac
      901 atggatgcca cctggctgga cagcctgctg accccagtcc ggttgccctc catccaggcc
      961 attccctgtg caccg
//