LOCUS       AJ891044                 373 bp    mRNA    linear   HUM 07-OCT-2008
DEFINITION  Homo sapiens mRNA for RGS5 protein.
ACCESSION   AJ891044
VERSION     AJ891044.1
KEYWORDS    RGS5 gene.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 373)
  AUTHORS   Liang Y.
  JOURNAL   Submitted (21-MAR-2005) to the INSDC. Liang Y., Biological Science,
            Allergan, Inc, 2525 Dupont Dr, Irvine, CA 92612, USA.
REFERENCE   2
  AUTHORS   Liang Y., Li C., Gozamn V.W., Woodwrad D.F.
  TITLE     Identification of a novel alternative splicing variant of RGS5 mRNA
            in human ocular tissues
  JOURNAL   FEBS J 272(3), 791-799(2005).
   PUBMED   15670159
FEATURES             Location/Qualifiers
     source          1..373
                     /db_xref="H-InvDB:HIT000330193"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     CDS             152..373
                     /gene="RGS5"
                     /product="RGS5 protein"
                     /db_xref="GOA:O15539"
                     /db_xref="H-InvDB:HIT000330193.9"
                     /db_xref="HGNC:HGNC:10001"
                     /db_xref="InterPro:IPR016137"
                     /db_xref="InterPro:IPR024066"
                     /db_xref="InterPro:IPR034955"
                     /db_xref="InterPro:IPR034956"
                     /db_xref="InterPro:IPR036305"
                     /db_xref="PDB:2CRP"
                     /db_xref="UniProtKB/Swiss-Prot:O15539"
                     /protein_id="CAI76926.1"
                     /translation="MAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFD
                     MAQKRIHALMEKDSLPRFVRSEFYQELIK"
BASE COUNT          112 a           79 c           89 g           93 t
ORIGIN      
        1 atgtgcaaag gacttgcagc tttgccccac tcatgcctgg aaagatggac ttgccagttt
       61 caaaagtttc ctgaagtctg aattcagtga ggaaaacctt gagttctgga ttgcctgtga
      121 ggattacaag aagatcaagt cccctgccaa gatggctgag aaggcaaagc aaatttatga
      181 agaattcatt caaacggagg ctcctaaaga ggtgaatatt gaccacttca ctaaggacat
      241 cacaatgaag aacctggtgg aaccttccct gagcagcttt gacatggccc agaaaagaat
      301 ccatgccctg atggaaaagg attctctgcc tcgctttgtg cgctctgagt tttatcagga
      361 gttaatcaag tag
//