LOCUS AJ891044 373 bp mRNA linear HUM 07-OCT-2008 DEFINITION Homo sapiens mRNA for RGS5 protein. ACCESSION AJ891044 VERSION AJ891044.1 KEYWORDS RGS5 gene. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 373) AUTHORS Liang Y. JOURNAL Submitted (21-MAR-2005) to the INSDC. Liang Y., Biological Science, Allergan, Inc, 2525 Dupont Dr, Irvine, CA 92612, USA. REFERENCE 2 AUTHORS Liang Y., Li C., Gozamn V.W., Woodwrad D.F. TITLE Identification of a novel alternative splicing variant of RGS5 mRNA in human ocular tissues JOURNAL FEBS J 272(3), 791-799(2005). PUBMED 15670159 FEATURES Location/Qualifiers source 1..373 /db_xref="H-InvDB:HIT000330193" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" CDS 152..373 /gene="RGS5" /product="RGS5 protein" /db_xref="GOA:O15539" /db_xref="H-InvDB:HIT000330193.9" /db_xref="HGNC:HGNC:10001" /db_xref="InterPro:IPR016137" /db_xref="InterPro:IPR024066" /db_xref="InterPro:IPR034955" /db_xref="InterPro:IPR034956" /db_xref="InterPro:IPR036305" /db_xref="PDB:2CRP" /db_xref="UniProtKB/Swiss-Prot:O15539" /protein_id="CAI76926.1" /translation="MAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFD MAQKRIHALMEKDSLPRFVRSEFYQELIK" BASE COUNT 112 a 79 c 89 g 93 t ORIGIN 1 atgtgcaaag gacttgcagc tttgccccac tcatgcctgg aaagatggac ttgccagttt 61 caaaagtttc ctgaagtctg aattcagtga ggaaaacctt gagttctgga ttgcctgtga 121 ggattacaag aagatcaagt cccctgccaa gatggctgag aaggcaaagc aaatttatga 181 agaattcatt caaacggagg ctcctaaaga ggtgaatatt gaccacttca ctaaggacat 241 cacaatgaag aacctggtgg aaccttccct gagcagcttt gacatggccc agaaaagaat 301 ccatgccctg atggaaaagg attctctgcc tcgctttgtg cgctctgagt tttatcagga 361 gttaatcaag tag //