LOCUS       AF401211                 137 bp    mRNA    linear   HUM 26-JUL-2016
DEFINITION  Homo sapiens BCL2 protein mRNA, partial cds.
ACCESSION   AF401211
VERSION     AF401211.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 137)
  AUTHORS   Kang,H.S., Park,Y.J., Jung,H.M., Jun,D.Y., Huh,T.L. and Kim,Y.H.
  TITLE     Characterization of TPA-responsive genes in U937 cells using
            ordered differential display PCR
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 137)
  AUTHORS   Kang,H.S., Jun,D.Y. and Kim,Y.H.
  TITLE     Direct Submission
  JOURNAL   Submitted (23-JUL-2001) Department of Microbiology, College of
            Natural Sciences, Kyungpook National University, 1370 Sankyuk-dong,
            Puk-ku, Taegu 702-701, Korea
FEATURES             Location/Qualifiers
     source          1..137
                     /db_xref="H-InvDB:HIT000079096"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /cell_line="U937"
     CDS             <1..137
                     /codon_start=3
                     /product="BCL2 protein"
                     /protein_id="AAL02169.1"
                     /translation="DAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
                     "
BASE COUNT           19 a           38 c           41 g           39 t
ORIGIN      
        1 gggatgcctt tgtggaactg tacggcccca gcatgcggcc tctgtttgat ttctcctggc
       61 tgtctctgaa gactctgctc agtttggccc tggtgggagc ttgcatcacc ctgggtgcct
      121 atctgggcca caagtga
//