LOCUS AF401211 137 bp mRNA linear HUM 26-JUL-2016 DEFINITION Homo sapiens BCL2 protein mRNA, partial cds. ACCESSION AF401211 VERSION AF401211.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 137) AUTHORS Kang,H.S., Park,Y.J., Jung,H.M., Jun,D.Y., Huh,T.L. and Kim,Y.H. TITLE Characterization of TPA-responsive genes in U937 cells using ordered differential display PCR JOURNAL Unpublished REFERENCE 2 (bases 1 to 137) AUTHORS Kang,H.S., Jun,D.Y. and Kim,Y.H. TITLE Direct Submission JOURNAL Submitted (23-JUL-2001) Department of Microbiology, College of Natural Sciences, Kyungpook National University, 1370 Sankyuk-dong, Puk-ku, Taegu 702-701, Korea FEATURES Location/Qualifiers source 1..137 /db_xref="H-InvDB:HIT000079096" /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /cell_line="U937" CDS <1..137 /codon_start=3 /product="BCL2 protein" /protein_id="AAL02169.1" /translation="DAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK " BASE COUNT 19 a 38 c 41 g 39 t ORIGIN 1 gggatgcctt tgtggaactg tacggcccca gcatgcggcc tctgtttgat ttctcctggc 61 tgtctctgaa gactctgctc agtttggccc tggtgggagc ttgcatcacc ctgggtgcct 121 atctgggcca caagtga //