LOCUS Z70520 836 bp mRNA linear HUM 14-NOV-2006 DEFINITION H.sapiens FAS/Apo 1 mRNA for FAS soluble protein (clone FAS Exo4,6Del). ACCESSION Z70520 VERSION Z70520.1 KEYWORDS FAS soluble protein; FAS/Apo 1 gene. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 836) AUTHORS Papoff G., Cascino I., Eramo A., Starace G., Lynch D.H., Ruberti G. TITLE An N-terminal domain shared by Fas/Apo-1 (CD95) soluble variants prevents cell death in vitro JOURNAL J. Immunol. 156(12), 4622-4630(1996). PUBMED 8648105 REFERENCE 2 (bases 1 to 836) AUTHORS Ruberti G. JOURNAL Submitted (01-APR-1996) to the INSDC. Ruberti G., Cell Biology Institute, C.N.R., Immunology, viale C.Marx 43, Rome, Italy, I-00137 FEATURES Location/Qualifiers source 1..836 /db_xref="H-InvDB:HIT000327887" /organism="Homo sapiens" /chromosome="10" /isolate="LN" /mol_type="mRNA" /clone="FAS Exo4,6Del" /cell_type="PHA-activated PBMC" /db_xref="taxon:9606" CDS 1..399 /product="FAS soluble protein" /note="Alternative splicing variant of FAS gene missing exons 4 and 6. Exon 5 translated in a different frame up to a new stop codon at the beginning of exon 7." /db_xref="GOA:P25445" /db_xref="H-InvDB:HIT000327887.13" /db_xref="HGNC:HGNC:11920" /db_xref="InterPro:IPR000488" /db_xref="InterPro:IPR001368" /db_xref="InterPro:IPR008063" /db_xref="InterPro:IPR011029" /db_xref="InterPro:IPR033998" /db_xref="InterPro:IPR033999" /db_xref="PDB:1BZI" /db_xref="PDB:1DDF" /db_xref="PDB:2NA7" /db_xref="PDB:3EWT" /db_xref="PDB:3EZQ" /db_xref="PDB:3THM" /db_xref="PDB:3TJE" /db_xref="UniProtKB/Swiss-Prot:P25445" /experiment="experimental evidence, no additional details recorded" /protein_id="CAA94431.1" /translation="MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTV ETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCR RCRLCDEGHDVNMESSRNAHSPATPSAKRK" exon <1..30 /number=1 /experiment="experimental evidence, no additional details recorded" exon 31..196 /number=2 /experiment="experimental evidence, no additional details recorded" exon 197..334 /number=3 /experiment="experimental evidence, no additional details recorded" exon 335..396 /number=5 /note="Translated in a different frame in this variant." /experiment="experimental evidence, no additional details recorded" exon 397..479 /number=7 /note="Not translated in this variant as there is a stop codon at 397." /experiment="experimental evidence, no additional details recorded" exon 480..504 /number=8 /note="Not translated in this variant." /experiment="experimental evidence, no additional details recorded" exon 505..>836 /number=9 /note="Not translated in this variant." /experiment="experimental evidence, no additional details recorded" BASE COUNT 297 a 166 c 183 g 190 t ORIGIN 1 atgctgggca tctggaccct cctacctctg gttcttacgt ctgttgctag attatcgtcc 61 aaaagtgtta atgcccaagt gactgacatc aactccaagg gattggaatt gaggaagact 121 gttactacag ttgagactca gaacttggaa ggcctgcatc atgatggcca attctgccat 181 aagccctgtc ctccaggtga aaggaaagct agggactgca cagtcaatgg ggatgaacca 241 gactgcgtgc cctgccaaga agggaaggag tacacagaca aagcccattt ttcttccaaa 301 tgcagaagat gtagattgtg tgatgaagga catgatgtga acatggaatc atcaaggaat 361 gcacactcac cagcaacacc aagtgcaaag aggaagtgaa gagaaaggaa gtacagaaaa 421 catgcagaaa gcacagaaag gaaaaccaag gttctcatga atctccaacc ttaaatcctg 481 aaacagtggc aataaattta tctgatgttg acttgagtaa atatatcacc actattgctg 541 gagtcatgac actaagtcaa gttaaaggct ttgttcgaaa gaatggtgtc aatgaagcca 601 aaatagatga gatcaagaat gacaatgtcc aagacacagc agaacagaaa gttcaactgc 661 ttcgtaattg gcatcaactt catggaaaga aagaagcgta tgacacattg attaaagatc 721 tcaaaaaagc caatctttgt actcttgcag agaaaattca gactatcatc ctcaaggaca 781 ttactagtga ctcagaaaat tcaaacttca gaaatgaaat ccaaagcttg gtctag //