LOCUS Z47995 698 bp mRNA linear HUM 14-NOV-2006 DEFINITION H.sapiens FAS Del3 mRNA. ACCESSION Z47995 VERSION Z47995.1 KEYWORDS FAS gene. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 2 (bases 1 to 698) AUTHORS Ruberti G. JOURNAL Submitted (24-JAN-1995) to the INSDC. Ruberti G., Cell Biology Institute, C.N.R., Immunology, viale C.Marx 43, Rome, Italy, I-00137 REFERENCE 3 (bases 1 to 698) AUTHORS Cascino I., Fiucci G., Papoff G., Ruberti G. TITLE Three functional soluble forms of the human apoptosis-inducing Fas molecule are produced by alternative splicing JOURNAL J. Immunol. 154(6), 2706-2713(1995). PUBMED 7533181 FEATURES Location/Qualifiers source 1..698 /db_xref="H-InvDB:HIT000327396" /organism="Homo sapiens" /chromosome="10" /isolate="GF" /mol_type="mRNA" /clone="FAS DEL3" /cell_type="PHA-activated PBMC" /db_xref="taxon:9606" CDS 1..261 /standard_name="FAS/Apo 1" /product="FAS soluble protein" /note="Alternative splicing variant of FAS gene missing exons 3,4 and 6. Exon 5 translated in a different frame up to a new stop codon at the beginning of exon 7." /db_xref="GOA:P25445" /db_xref="H-InvDB:HIT000327396.13" /db_xref="HGNC:HGNC:11920" /db_xref="InterPro:IPR000488" /db_xref="InterPro:IPR001368" /db_xref="InterPro:IPR008063" /db_xref="InterPro:IPR011029" /db_xref="InterPro:IPR033998" /db_xref="InterPro:IPR033999" /db_xref="PDB:1BZI" /db_xref="PDB:1DDF" /db_xref="PDB:2NA7" /db_xref="PDB:3EWT" /db_xref="PDB:3EZQ" /db_xref="PDB:3THM" /db_xref="PDB:3TJE" /db_xref="UniProtKB/Swiss-Prot:P25445" /experiment="experimental evidence, no additional details recorded" /protein_id="CAA88033.1" /translation="MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTV ETQNLEGLHHDGQFCHKPCPPDVNMESSRNAHSPATPSAKRK" exon <1..30 /standard_name="FAS/Apo 1" /number=1 /experiment="experimental evidence, no additional details recorded" exon 31..196 /standard_name="FAS/Apo 1" /number=2 /experiment="experimental evidence, no additional details recorded" exon 197..258 /standard_name="FAS/Apo 1" /number=5 /note="Translated in a different frame in this variant." /experiment="experimental evidence, no additional details recorded" exon 259..341 /standard_name="FAS/Apo 1" /number=7 /note="Not translated in this variant as there is a stop codon at 259." /experiment="experimental evidence, no additional details recorded" exon 342..366 /standard_name="FAS/Apo 1" /number=8 /note="Not translated in this variant." /experiment="experimental evidence, no additional details recorded" exon 367..>698 /standard_name="FAS/Apo 1" /number=9 /note="Not translated in this variant." /experiment="experimental evidence, no additional details recorded" BASE COUNT 251 a 141 c 142 g 164 t ORIGIN 1 atgctgggca tctggaccct cctacctctg gttcttacgt ctgttgctag attatcgtcc 61 aaaagtgtta atgcccaagt gactgacatc aactccaagg gattggaatt gaggaagact 121 gttactacag ttgagactca gaacttggaa ggcctgcatc atgatggcca attctgccat 181 aagccctgtc ctccagatgt gaacatggaa tcatcaagga atgcacactc accagcaaca 241 ccaagtgcaa agaggaagtg aagagaaagg aagtacagaa aacatgcaga aagcacagaa 301 aggaaaacca aggttctcat gaatctccaa ccttaaatcc tgaaacagtg gcaataaatt 361 tatctgatgt tgacttgagt aaatatatca ccactattgc tggagtcatg acactaagtc 421 aagttaaagg ctttgttcga aagaatggtg tcaatgaagc caaaatagat gagatcaaga 481 atgacaatgt ccaagacaca gcagaacaga aagttcaact gcttcgtaat tggcatcaac 541 ttcatggaaa gaaagaagcg tatgacacat tgattaaaga tctcaaaaaa gccaatcttt 601 gtactcttgc agagaaaatt cagactatca tcctcaagga cattactagt gactcagaaa 661 attcaaactt cagaaatgaa atccaaagct tggtctag //