LOCUS Z47994 761 bp mRNA linear HUM 14-NOV-2006 DEFINITION H.sapiens FAS Del 2 mRNA. ACCESSION Z47994 VERSION Z47994.1 KEYWORDS FAS gene. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 2 (bases 1 to 761) AUTHORS Ruberti G. JOURNAL Submitted (24-JAN-1995) to the INSDC. Ruberti G., Cell Biology Institute, C.N.R., Immunology, viale C.Marx 43, Rome, Italy, I-00137 REFERENCE 3 (bases 1 to 761) AUTHORS Cascino I., Fiucci G., Papoff G., Ruberti G. TITLE Three functional soluble forms of the human apoptosis-inducing Fas molecule are produced by alternative splicing JOURNAL J. Immunol. 154(6), 2706-2713(1995). PUBMED 7533181 FEATURES Location/Qualifiers source 1..761 /db_xref="H-InvDB:HIT000327395" /organism="Homo sapiens" /chromosome="10" /isolate="GF" /mol_type="mRNA" /clone="FAS DEL2" /cell_type="PHA-activated PBMC" /db_xref="taxon:9606" CDS 1..312 /standard_name="FAS/Apo 1" /product="FAS soluble protein" /note="Alternative splicing variant of FAS gene missing exons 3 and 4. Exons 5 and 6 translated in a different frame up to new stop codon at 310." /db_xref="GOA:P25445" /db_xref="H-InvDB:HIT000327395.13" /db_xref="HGNC:HGNC:11920" /db_xref="InterPro:IPR000488" /db_xref="InterPro:IPR001368" /db_xref="InterPro:IPR008063" /db_xref="InterPro:IPR011029" /db_xref="InterPro:IPR033998" /db_xref="InterPro:IPR033999" /db_xref="PDB:1BZI" /db_xref="PDB:1DDF" /db_xref="PDB:2NA7" /db_xref="PDB:3EWT" /db_xref="PDB:3EZQ" /db_xref="PDB:3THM" /db_xref="PDB:3TJE" /db_xref="UniProtKB/Swiss-Prot:P25445" /experiment="experimental evidence, no additional details recorded" /protein_id="CAA88032.1" /translation="MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTV ETQNLEGLHHDGQFCHKPCPPDVNMESSRNAHSPATPSAKRKDPDLTWGGFVFFFCQF H" exon <1..30 /standard_name="FAS/Apo 1" /number=1 /experiment="experimental evidence, no additional details recorded" exon 31..196 /standard_name="FAS/Apo 1" /number=2 /experiment="experimental evidence, no additional details recorded" exon 197..258 /standard_name="FAS/Apo 1" /number=5 /note="Translated in a different frame in this variant." /experiment="experimental evidence, no additional details recorded" exon 259..321 /standard_name="FAS/Apo 1" /number=6 /note="Translated in a different frame in this variant up to a new stop codon at 310." /experiment="experimental evidence, no additional details recorded" exon 322..404 /standard_name="FAS/Apo 1" /number=7 /note="Not translated in this variant." /experiment="experimental evidence, no additional details recorded" exon 405..429 /standard_name="FAS/Apo 1" /number=8 /note="Not translated in this variant." /experiment="experimental evidence, no additional details recorded" exon 430..>761 /standard_name="FAS/Apo 1" /number=9 /note="Not translated in this variant." /experiment="experimental evidence, no additional details recorded" BASE COUNT 261 a 154 c 156 g 190 t ORIGIN 1 atgctgggca tctggaccct cctacctctg gttcttacgt ctgttgctag attatcgtcc 61 aaaagtgtta atgcccaagt gactgacatc aactccaagg gattggaatt gaggaagact 121 gttactacag ttgagactca gaacttggaa ggcctgcatc atgatggcca attctgccat 181 aagccctgtc ctccagatgt gaacatggaa tcatcaagga atgcacactc accagcaaca 241 ccaagtgcaa agaggaagga tccagatcta acttggggtg gctttgtctt cttcttttgc 301 caattccact aattgtttgg gtgaagagaa aggaagtaca gaaaacatgc agaaagcaca 361 gaaaggaaaa ccaaggttct catgaatctc caaccttaaa tcctgaaaca gtggcaataa 421 atttatctga tgttgacttg agtaaatata tcaccactat tgctggagtc atgacactaa 481 gtcaagttaa aggctttgtt cgaaagaatg gtgtcaatga agccaaaata gatgagatca 541 agaatgacaa tgtccaagac acagcagaac agaaagttca actgcttcgt aattggcatc 601 aacttcatgg aaagaaagaa gcgtatgaca cattgattaa agatctcaaa aaagccaatc 661 tttgtactct tgcagagaaa attcagacta tcatcctcaa ggacattact agtgactcag 721 aaaattcaaa cttcagaaat gaaatccaaa gcttggtcta g //