LOCUS       Z30093                   912 bp    mRNA    linear   HUM 23-OCT-1995
DEFINITION  H.sapiens mRNA for basic transcription factor 2, 34 kD subunit.
ACCESSION   Z30093
VERSION     Z30093.1
KEYWORDS    basic transcription factor; BTF2 protein; transcription factor.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 909)
  AUTHORS   Humbert S., van Vuuren H.A., Lutz Y., Hoeiijmakers J.J., Egly J.,
            Moncollin V.
  TITLE     p44 and p34 subunits of the BTF2/TFIIH transcription factor have
            homologies with SSL1, a yeast protein involved in DNA repair
  JOURNAL   EMBO J. 13(10), 2393-2398(1994).
   PUBMED   8194529
REFERENCE   2
  AUTHORS   Moncollin V.
  JOURNAL   Submitted (15-FEB-1994) to the INSDC. Vincent Moncollin, INSERM
            U-184/CNRS UPR 6520, Laboratoire de, Genetique Moleculaire des
            Eucaryotes, 11 rue Humann, Strasbourg, 67085, France
  REMARK    revised by [3]
REFERENCE   3  (bases 1 to 912)
  AUTHORS   Moncollin V.
  JOURNAL   Submitted (23-OCT-1995) to the INSDC. Vincent Moncollin, INSERM
            U-184/CNRS UPR 6520, Laboratoire de, Genetique Moleculaire des
            Eucaryotes, 11 rue Humann, Strasbourg, 67085, France
FEATURES             Location/Qualifiers
     source          1..912
                     /db_xref="H-InvDB:HIT000326868"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /cell_line="HeLa"
                     /db_xref="taxon:9606"
     CDS             1..912
                     /product="basic transcription factor 2, 35 kD subunit"
                     /db_xref="GOA:Q13889"
                     /db_xref="H-InvDB:HIT000326868.12"
                     /db_xref="HGNC:HGNC:4657"
                     /db_xref="InterPro:IPR004600"
                     /db_xref="PDB:5IVW"
                     /db_xref="PDB:5IY6"
                     /db_xref="PDB:5IY7"
                     /db_xref="PDB:5IY8"
                     /db_xref="PDB:5IY9"
                     /db_xref="UniProtKB/Swiss-Prot:Q13889"
                     /protein_id="CAA82909.1"
                     /translation="MVSDEDELNLLVIVVDANPIWWGKQALKESQFTLSKCIDAVMVL
                     GNSHLFMNRSNKLAVIASHIQESRFLYPGKNGRLGDFFGDPGNPPEFNPSGSKDGKYE
                     LLTSANEVIVEEIKDLMTKSDIKGQHTETLLAGSLAKALCYIHRMNKEVKDNQEMKSR
                     ILVIKAAEDSALQYMNFMNVIFAAQKQNILIDACVLDSDSGLLQQACDITGGLYLKVP
                     QMPSLLQYLLWVFLPDQDQRSQLILPPPVHVDYRAACFCHRNLIEIGYVCSVCLSIFC
                     NFSPICTTCETAFKISLPPVLKAKKRN"
BASE COUNT          267 a          186 c          199 g          260 t
ORIGIN      
        1 atggtttcag acgaagatga attgaatctt ctggttattg tagttgatgc caacccaatt
       61 tggtggggaa agcaagcatt aaaggaatct cagttcactt tatccaaatg catagatgcc
      121 gtgatggtgc tgggaaattc gcatttattc atgaatcgtt ccaacaaact tgctgtgata
      181 gcaagtcaca ttcaagaaag ccgattctta tatcctggaa agaatggcag acttggagac
      241 ttcttcggag accctggcaa ccctcctgaa tttaatccct ctgggagtaa agatggaaaa
      301 tacgaacttt taacctcagc aaatgaagtt attgttgaag agattaaaga tctaatgacc
      361 aaaagtgaca taaagggtca acatacagaa actttgctgg caggatccct ggccaaagcc
      421 ctttgctaca ttcatagaat gaacaaggaa gttaaagaca atcaggaaat gaaatcaagg
      481 atattggtga ttaaggctgc agaagacagt gcgttgcagt atatgaactt catgaatgtc
      541 atctttgcag cacagaaaca gaatattttg attgatgcct gtgttttaga ctccgactca
      601 gggctcctcc aacaggcttg tgacatcacg ggaggactgt acctgaaggt gcctcagatg
      661 ccttctcttc tgcagtattt gctgtgggtg tttcttcccg atcaagatca gagatctcag
      721 ttaatcctcc cacccccggt tcatgttgac tacagggctg cttgcttctg tcatcgaaat
      781 ctcattgaaa ttggttatgt ctgttctgtg tgtttgtcaa tattctgcaa tttcagcccc
      841 atttgtacta cgtgcgagac agcctttaaa atttctctgc ctccagtgct gaaagccaag
      901 aaaagaaact ga
//