LOCUS       Z19002                  2197 bp    mRNA    linear   HUM 09-SEP-2004
DEFINITION  H.sapiens of PLZF gene encoding kruppel-like zinc finger protein.
ACCESSION   Z19002
VERSION     Z19002.1
KEYWORDS    kruppel-like zinc finger protein.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2197)
  AUTHORS   Chen,Z., Brand,N.J., Chen,A., Chen,S.J., Tong,J.H., Wang,Z.Y.,
            Waxman,S. and  Zelent,A.Z.
  TITLE     Fusion between a novel Kruppel-like zinc finger gene and the
            retinoic acid receptor-alpha locus due to a variant t(11;17)
            translocation associated with acute promyelocytic leukaemia
  JOURNAL   EMBO J. 12(3), 1161-1167(1993).
   PUBMED   8384553
REFERENCE   2  (bases 1 to 2197)
  AUTHORS   Zelent,A.Z.
  JOURNAL   Submitted (09-DEC-1992) to the INSDC. Zelent A. Z., Institute of
            Cancer Research, Leukaemia Research Fund Centre, Fulham Road,
            London, United Kingdom, SW3 6JB
FEATURES             Location/Qualifiers
     source          1..2197
                     /db_xref="H-InvDB:HIT000326606"
                     /organism="Homo sapiens"
                     /chromosome="11q23.1"
                     /mol_type="mRNA"
                     /dev_stage="adult"
                     /clone_lib="human ventricular cDNA lambda ZapII library"
                     /clone="PLZF"
                     /tissue_type="heart"
                     /germline
                     /db_xref="taxon:9606"
     5'UTR           1..75
     CDS             76..2097
                     /gene="PLZF"
                     /product="kruppel-like zinc finger protein"
                     /function="transcription factor"
                     /db_xref="GOA:Q05516"
                     /db_xref="H-InvDB:HIT000326606.13"
                     /db_xref="HGNC:HGNC:12930"
                     /db_xref="InterPro:IPR000210"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR011333"
                     /db_xref="InterPro:IPR013069"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="PDB:1BUO"
                     /db_xref="PDB:1CS3"
                     /db_xref="UniProtKB/Swiss-Prot:Q05516"
                     /protein_id="CAA79489.1"
                     /translation="MDLTKMGMIQLQNPSHPTGLLCKANQMRLAGTLCDVVIMVDSQE
                     FHAHRTVLACTSKMFEILFHRNSQHYTLDFLSPKTFQQILEYAYTATLQAKAEDLDDL
                     LYAAEILEIEYLEEQCLKMLETIQASDDNDTEATMADGGAEEEEDRKARYLKNIFISK
                     HSSEESGYASVAGQSLPGPMVDQSPSVSTSFGLSAMSPTKAAVDSLMTIGQSLLQGTL
                     QPPAGPEEPTLAGGGRHPGVAEVKTEMMQVDEVPSQDSPGAAESSISGGMGDKVEERG
                     KEGPGTPTRSSVITSARELHYGREESAEQVPPPAEAGQAPTGRPEHPAPPPEKHLGIY
                     SVLPNHKADAVLSMPSSVTSGLHVQPALAVSMDFSTYGGLLPQGFIQRELFSKLGELA
                     VGMKSESRTIGEQCSVCGVELPDNEAVEQHRKLHSGMKTYGCELCGKRFLDSLRLRMH
                     LLAHSAGAKAFVCDQCGAQFSKEDALETHRQTHTGTDMAVFCLLCGKRFQAQSALQQH
                     MEVHAGVRSYICSECNRTFPSHTALKRHLRSHTGDHPYECEFCGSCFRDESTLKSHKR
                     IHTGEKPYECNGCDKKFSLKHQLETHYRVHTGEKPFECKLCHQRSRDYSAMIKHLRTH
                     NGASPYQCTICTEYCPSLSSMQKHMKGHKPEEIPPDWRIEKTYLYLCYV"
     3'UTR           2098..2197
BASE COUNT          518 a          628 c          683 g          368 t
ORIGIN
        1 caggaagccc acccagcccc gccacgcaga gcccagaagg aaagaaagcc tcatgcctga
       61 gccgagggga gcaccatgga tctgacaaaa atgggcatga tccagctgca gaaccctagc
      121 caccccacgg ggctactgtg caaggccaac cagatgcggc tggccgggac tttgtgcgat
      181 gtggtcatca tggtggacag ccaggagttc cacgcccacc ggacggtgct ggcctgcacc
      241 agcaagatgt ttgagatcct cttccaccgc aatagtcaac actatacttt ggacttcctc
      301 tcgccaaaga ccttccagca gattctggag tatgcatata cagccacgct gcaagccaag
      361 gcggaggacc tggatgacct gctgtatgcg gccgagatcc tggagatcga gtacctggag
      421 gaacagtgcc tgaagatgct ggagaccatc caggcctcag acgacaatga cacggaggcc
      481 accatggccg atggcggggc cgaggaagaa gaggaccgca aggctcggta cctcaagaac
      541 atcttcatct cgaagcattc cagcgaggag agtgggtatg ccagtgtggc tggacagagc
      601 ctccctgggc ccatggtgga ccagagccct tcagtctcca cttcatttgg tctttcagcc
      661 atgagtccca ccaaggctgc agtggacagt ttgatgacca taggacagtc tctcctgcag
      721 ggaactcttc agccacctgc agggcccgag gagccaactc tggctggggg tgggcggcac
      781 cctggggtgg ctgaggtgaa gacggagatg atgcaggtgg atgaggtgcc cagccaggac
      841 agccctgggg cagccgagtc cagcatctca ggagggatgg gggacaaggt tgaggaaaga
      901 ggcaaagagg ggcctgggac cccgactcga agcagcgtca tcaccagtgc tagggagcta
      961 cactatgggc gagaggagag tgccgagcag gtgccacccc cagctgaggc tggccaggcc
     1021 cccactggcc gacctgagca cccagcaccc ccgcctgaga agcatctggg catctactcc
     1081 gtgttgccca accacaaggc tgacgctgta ttgagcatgc cgtcttccgt gacctctggc
     1141 ctccacgtgc agcctgccct ggctgtctcc atggacttca gcacctatgg ggggctgctg
     1201 ccccagggct tcatccagag ggagctgttc agcaagctgg gggagctggc tgtgggcatg
     1261 aagtcagaga gccggaccat cggagagcag tgcagcgtgt gtggggtcga gcttcctgat
     1321 aacgaggctg tggagcagca caggaagctg cacagtggga tgaagacgta cgggtgcgag
     1381 ctctgcggga agcggttcct ggatagtttg cggctgagaa tgcacttact ggctcattca
     1441 gcgggtgcca aagcctttgt ctgtgatcag tgcggtgcac agttttcgaa ggaggatgcc
     1501 ctggagacac acaggcagac ccatactggc actgacatgg ccgtcttctg tctgctgtgt
     1561 gggaagcgct tccaggcgca gagcgcactg cagcagcaca tggaggtcca cgcgggcgtg
     1621 cgcagctaca tctgcagtga gtgcaaccgc accttcccca gccacacggc tctcaaacgc
     1681 cacctgcgct cacatacagg cgaccacccc tacgagtgtg agttctgtgg cagctgcttc
     1741 cgggatgaga gcacactcaa gagccacaaa cgcatccaca cgggtgagaa accctacgag
     1801 tgcaatggct gtgacaagaa gttcagcctc aagcatcagc tggagacgca ctatagggtg
     1861 cacacaggtg agaagccctt tgagtgtaag ctctgccacc agcgctcccg ggactactcg
     1921 gccatgatca agcacctgag aacgcacaac ggcgcctcgc cctaccagtg caccatctgc
     1981 acagagtact gccccagcct ctcctccatg cagaagcaca tgaagggcca caagcccgag
     2041 gagatcccgc ccgactggag gatagagaag acgtacctct acctgtgcta tgtgtgaagg
     2101 gaggcccgcg gcggtggagc cgagcgggga gccaggaaag aagagttgga gtgagatgaa
     2161 ggaaggacta tgacaaataa aaaaaaaaaa ggaattc
//