LOCUS       Y14153                  2151 bp    mRNA    linear   HUM 07-OCT-2008
DEFINITION  Homo sapiens mRNA for beta-transducin repeat containing protein.
ACCESSION   Y14153
VERSION     Y14153.1
KEYWORDS    beta-transducin repeats; beta-TRCP gene; WD repeat.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1
  AUTHORS   Margottin F., Bour S.P., Durand H., Selig L., Benichou S.,
            Richard V., Thomas D., Strebel K., Benarous R.
  TITLE     A novel human WD protein, h-beta TrCp, that interacts with HIV-1
            Vpu connects CD4 to the ER degradation pathway through an F-box
            motif
  JOURNAL   Mol. Cell 1(4), 565-574(1998).
   PUBMED   9660940
REFERENCE   2  (bases 1 to 2151)
  AUTHORS   Benarous R.
  JOURNAL   Submitted (03-JUL-1997) to the INSDC. R. Benarous, INSERM -
            I.C.G.M., Laboratoire Interactions Proteiques, CHU Cochin, 24 rue
            de Fg.St-Jacques, 75014 Paris, FRANCE
FEATURES             Location/Qualifiers
     source          1..2151
                     /db_xref="H-InvDB:HIT000325814"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /cell_line="Jurkat T-cell"
                     /cell_type="T lymphocyte"
                     /tissue_type="lymphoid"
                     /db_xref="taxon:9606"
     CDS             70..1779
                     /gene="beta-TRCP"
                     /product="beta-transducin repeats containing protein"
                     /db_xref="GOA:Q9Y297"
                     /db_xref="H-InvDB:HIT000325814.12"
                     /db_xref="HGNC:HGNC:1144"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="InterPro:IPR021977"
                     /db_xref="PDB:1P22"
                     /db_xref="PDB:2P64"
                     /db_xref="UniProtKB/Swiss-Prot:Q9Y297"
                     /protein_id="CAA74572.1"
                     /translation="MDPAEAVLQEKALKFMNSSEREDCNNGEPPRKIIPEKNSLRQTY
                     NSCARLCLNQETVCLASTAMKTENCVAKTKLANGTSSMIVPKQRKLSASYEKEKELCV
                     KYFEQWSESDQVEFVEHLISQMCHYQHGHINSYLKPMLQRDFITALPARGLDHIAENI
                     LSYLDAKSLCAAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWRGLAERRGWGQYLFK
                     NKPPDGNAPPNSFYRALYPKIIQDIETIESNWRCGRHSLQRIHCRSETSKGVYCLQYD
                     DQKIVSGLRDNTIKIWDKNTLECKRILTGHTGSVLCLQYDERVIITGSSDSTVRVWDV
                     NTGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAA
                     VNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDN
                     TIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDPRAPAG
                     TLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLNDPAAQAEPPRSPSRTYTY
                     ISR"
     repeat_region   259..544
                     /rpt_family="WD"
                     /rpt_unit_range=516..544
BASE COUNT          628 a          467 c          513 g          543 t
ORIGIN      
        1 tgcgttggct gcggcctggc accaaagggg cggccccggc ggagagcgga cccagtggcc
       61 tcggcgatta tggacccggc cgaggcggtg ctgcaagaga aggcactcaa gtttatgaat
      121 tcctcagaga gagaagactg taataatggc gaacccccta ggaagataat accagagaag
      181 aattcactta gacagacata caacagctgt gccagactct gcttaaacca agaaacagta
      241 tgtttagcaa gcactgctat gaagactgag aattgtgtgg ccaaaacaaa acttgccaat
      301 ggcacttcca gtatgattgt gcccaagcaa cggaaactct cagcaagcta tgaaaaggaa
      361 aaggaactgt gtgtcaaata ctttgagcag tggtcagagt cagatcaagt ggaatttgtg
      421 gaacatctta tatcccaaat gtgtcattac caacatgggc acataaactc gtatcttaaa
      481 cctatgttgc agagagattt cataactgct ctgccagctc ggggattgga tcatatcgct
      541 gagaacattc tgtcatacct ggatgccaaa tcactatgtg ctgctgaact tgtgtgcaag
      601 gaatggtacc gagtgacctc tgatggcatg ctgtggaaga agcttatcga gagaatggtc
      661 aggacagatt ctctgtggag aggcctggca gaacgaagag gatggggaca gtatttattc
      721 aaaaacaaac ctcctgacgg gaatgctcct cccaactctt tttatagagc actttatcct
      781 aaaattatac aagacattga gacaatagaa tctaattgga gatgtggaag acatagttta
      841 cagagaattc actgccgaag tgaaacaagc aaaggagttt actgtttaca gtatgatgat
      901 cagaaaatag taagcggcct tcgagacaac acaatcaaga tctgggataa aaacacattg
      961 gaatgcaagc gaattctcac aggccataca ggttcagtcc tctgtctcca gtatgatgag
     1021 agagtgatca taacaggatc atcggattcc acggtcagag tgtgggatgt aaatacaggt
     1081 gaaatgctaa acacgttgat tcaccattgt gaagcagttc tgcacttgcg tttcaataat
     1141 ggcatgatgg tgacctgctc caaagatcgt tccattgctg tatgggatat ggcctcccca
     1201 actgacatta ccctccggag ggtgctggtc ggacaccgag ctgctgtcaa tgttgtagac
     1261 tttgatgaca agtacattgt ttctgcatct ggggatagaa ctataaaggt atggaacaca
     1321 agtacttgtg aatttgtaag gaccttaaat ggacacaaac gaggcattgc ctgtttgcag
     1381 tacagggaca ggctggtagt gagtggctca tctgacaaca ctatcagatt atgggacata
     1441 gaatgtggtg catgtttacg agtgttagaa ggccatgagg aattggtgcg ttgtattcga
     1501 tttgataaca agaggatagt cagtggggcc tatgatggaa aaattaaagt gtgggatctt
     1561 gtggctgctt tggacccccg tgctcctgca gggacactct gtctacggac ccttgtggag
     1621 cattccggaa gagtttttcg actacagttt gatgaattcc agattgtcag tagttcacat
     1681 gatgacacaa tcctcatctg ggacttccta aatgatccag ctgcccaagc tgaacccccc
     1741 cgttcccctt ctcgaacata cacctacatc tccagataaa taaccataca ctgacctcat
     1801 acttgcccag gacccattaa agttgcggta tttaacgtat ctgccaatac caggatgagc
     1861 aacaacagta acaatcaaac tactgcccag tttccctgga ctagccgagg agcagggctt
     1921 tgagactcct gttgggacac agttggtctg cagtcggccc aggacggtct actcagcaca
     1981 actgactgct tcagtgctgc tatcagaaga tgtcttctat caattgtgaa tgattggaac
     2041 ttttaaacct cccctcctct cctcctttca cctctgcacc tagttttttc ccattggttc
     2101 cagacaaagg tgacttataa atatatttag tgttttgcca gaaaaaaaaa a
//