LOCUS       X86105                   168 bp    mRNA    linear   HUM 15-FEB-1996
DEFINITION  H.sapiens mRNA for T cell receptor, V beta 13.3, J beta 2.2 , C
            beta 2.
ACCESSION   X86105
VERSION     X86105.1
KEYWORDS    HLA-B27; reactive arthritis; T-cell receptor; T-cell receptor beta
            chain.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1
  AUTHORS   Duchmann R., May E., Ackermann B., Goergen B.,
            Meyer zum Bueschenfelde K.H., Hermann E.
  TITLE     HLA-B27-restricted cytotoxic T lymphocyte responses to
            arthritogenic enterobacteria or self-antigens are dominated by
            closely related TCRBV gene segments. A study in patients with
            reactive arthritis
  JOURNAL   Scand. J. Immunol. 43(1), 101-108(1996).
   PUBMED   8560188
REFERENCE   2  (bases 1 to 168)
  AUTHORS   May E.
  JOURNAL   Submitted (28-FEB-1995) to the INSDC. E. May, Univ. of Mainz,
            1.Med. Klinik, J.Gutenberg Univ. Mainz, Klinische Immunologie II,
            Langenbeckstr. 1, D- 55101 Mainz, FRG
FEATURES             Location/Qualifiers
     source          1..168
                     /db_xref="H-InvDB:HIT000324193"
                     /organism="Homo sapiens"
                     /isolate="patient with Yersinia enterocolitica 03-induced
                     acute Reiter's syndrome"
                     /mol_type="mRNA"
                     /haplotype="HLA-B27"
                     /clone="P1.5.103"
                     /cell_type="synovial T-lymphocyte"
                     /db_xref="taxon:9606"
     CDS             <1..>168
                     /codon_start=1
                     /gene="TCRB"
                     /product="T-cell receptor beta chain"
                     /db_xref="H-InvDB:HIT000324193.7"
                     /protein_id="CAA60058.1"
                     /translation="SRLNKREFSLRLESAAPSQTSVYFCASSRQGDTGELFFGEGSRL
                     TVLEDLKNVFPP"
     mRNA            1..168
                     /experiment="experimental evidence, no additional details
                     recorded"
BASE COUNT           36 a           47 c           48 g           37 t
ORIGIN      
        1 tccagattaa acaaacggga gttctcgctc aggctggagt cggctgctcc ctcccagaca
       61 tctgtgtact tctgtgccag cagtcgacag ggcgacaccg gggagctgtt ttttggagaa
      121 ggctctaggc tgaccgtact ggaggacctg aaaaacgtgt tcccaccc
//