LOCUS       X85373                   455 bp    mRNA    linear   HUM 12-JUN-2006
DEFINITION  H.sapiens mRNA for Sm protein G.
ACCESSION   X85373
VERSION     X85373.1
KEYWORDS    pBSCF gene; Sm protein G.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1
  AUTHORS   Hermann H., Fabrizio P., Raker V.A., Foulaki K., Hornig H.,
            Brahms H., Luhrmann R.
  TITLE     snRNP Sm proteins share two evolutionarily conserved sequence
            motifs which are involved in Sm protein-protein interactions
  JOURNAL   EMBO J. 14(9), 2076-2088(1995).
   PUBMED   7744013
REFERENCE   2  (bases 1 to 455)
  AUTHORS   Raker V.A.
  JOURNAL   Submitted (15-MAR-1995) to the INSDC. V.A. Raker, Institut fuer
            Molekularbiologie & Tumorforschung, Emil-Mannkopff-Str. 2, 35037
            Marburg, FRG
FEATURES             Location/Qualifiers
     source          1..455
                     /db_xref="H-InvDB:HIT000324171"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /clone_lib="lambda gt10"
                     /cell_line="Hela"
                     /db_xref="taxon:9606"
     CDS             84..314
                     /gene="pBSCF"
                     /product="Sm protein G"
                     /db_xref="GOA:P62308"
                     /db_xref="H-InvDB:HIT000324171.12"
                     /db_xref="HGNC:HGNC:11163"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR034098"
                     /db_xref="PDB:3CW1"
                     /db_xref="PDB:3JCR"
                     /db_xref="PDB:3PGW"
                     /db_xref="PDB:4F7U"
                     /db_xref="PDB:4PJO"
                     /db_xref="PDB:4V98"
                     /db_xref="PDB:4WZJ"
                     /db_xref="PDB:5MQF"
                     /db_xref="PDB:5O9Z"
                     /db_xref="PDB:5XJC"
                     /db_xref="PDB:5XJL"
                     /db_xref="PDB:5XJQ"
                     /db_xref="PDB:5XJR"
                     /db_xref="PDB:5XJT"
                     /db_xref="PDB:5XJU"
                     /db_xref="PDB:5YZG"
                     /db_xref="PDB:5Z56"
                     /db_xref="PDB:5Z57"
                     /db_xref="PDB:5Z58"
                     /db_xref="PDB:6AH0"
                     /db_xref="PDB:6AHD"
                     /db_xref="UniProtKB/Swiss-Prot:P62308"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /protein_id="CAA59689.1"
                     /translation="MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDE
                     CVEMATSGQQNNIGMVVIRGNSIIMLEALERV"
BASE COUNT          152 a           76 c          108 g          119 t
ORIGIN      
        1 tagacgccgg gcctacagcg ggaggctgag gaaagccgtg cgttgcgttc caaggacatc
       61 tgtgagcccg cggagtatac accatgagca aagctcaccc tcccgagttg aaaaaattta
      121 tggacaagaa gttatcattg aaattaaatg gtggcagaca tgtccaagga atattgcggg
      181 gatttgatcc ctttatgaac cttgtgatag atgaatgtgt ggagatggcg actagtggac
      241 aacagaacaa tattggaatg gtggtaatac gaggaaatag tatcatcatg ttagaagcct
      301 tggaacgagt ataaataatg gctgttcagc agagaaaccc atgtcctctc tccatagggc
      361 ctgtttacta tgatgtaaaa attaggtcat gtacattttc atattagact ttttgttaaa
      421 taaacttttg taatagtcaa aaaaaaaaaa aaaaa
//