LOCUS       X83863                  1967 bp    mRNA    linear   HUM 31-MAY-1995
DEFINITION  H.sapiens mRNA for prostaglandin E receptor (EP3f).
ACCESSION   X83863
VERSION     X83863.1
KEYWORDS    prostaglandin E2 receptor EP3 subtype.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   2
  AUTHORS   Schmid,A., Thierauch,K.H., Schleuning,W.D. and  Dinter,H.
  TITLE     Splice variants of the human EP3 receptor for prostaglandin E2
  JOURNAL   Eur. J. Biochem. 228(1), 23-30(1995).
   PUBMED   7883006
REFERENCE   3  (bases 1 to 1967)
  AUTHORS   Dinter,H.
  JOURNAL   Submitted (12-JAN-1995) to the INSDC. H. Dinter, Schering AG, IZMB
            S109/618, 13342 Berlin, FRG
FEATURES             Location/Qualifiers
     source          1..1967
                     /db_xref="H-InvDB:HIT000324009"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /tissue_type="uterus"
                     /db_xref="taxon:9606"
     CDS             208..1485
                     /product="prostaglandin E receptor, subtype EP3f"
                     /db_xref="GOA:P43115"
                     /db_xref="H-InvDB:HIT000324009.13"
                     /db_xref="HGNC:HGNC:9595"
                     /db_xref="InterPro:IPR000265"
                     /db_xref="InterPro:IPR000276"
                     /db_xref="InterPro:IPR001244"
                     /db_xref="InterPro:IPR001481"
                     /db_xref="InterPro:IPR008365"
                     /db_xref="InterPro:IPR017452"
                     /db_xref="UniProtKB/Swiss-Prot:P43115"
                     /protein_id="CAA58743.1"
                     /translation="MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSG
                     EDCGSVSVAFPITMLLTGFVGNALAMLLVSRSYRRRESKRKKSFLLCIGWLALTDLVG
                     QLLTTPVVIVVYLSKQRWEHIDPSGRLCTFFGLTMTVFGLSSLFIASAMAVERALAIR
                     APHWYASHMKTRATRAVLLGVWLAVLAFALLPVLGVGQYTVQWPGTWCFISTGRGGNG
                     TSSSHNWGNLFFASAFAFLGLLALTVTFSCNLATIKALVSRCRAKATASQSSAQWGRI
                     TTETAIQLMGIMCVLSVCWSPLLIMMLKMIFNQTSVEHCKTHTEKQKECNFFLIAVRL
                     ASLNQILDPWVYLLLRKILLRKFCQMRKRRLREQAPLLPTPTVIDPSRFCAQPFRWFL
                     DLSFPAMSSSHPQLPLTLASFKLLREPCSVQLS"
BASE COUNT          396 a          595 c          488 g          488 t
ORIGIN
        1 gaaggcgtgg ctccctcccg ggccagtgag cctggcgccg ccgcggccgc gtcccagcag
       61 cggagtaggg cggcggctgc gccccgcacc atgggggcag cccagcccca gccgcggtaa
      121 acgccgacct ccgccgccgc ccgcgcccgt ctgccccctc ccgctgcggc tctctggacg
      181 ccatcccctc ctcacctcga agccaacatg aaggagaccc ggggctacgg aggggatgcc
      241 cccttctgca cccgcctcaa ccactcctac acaggcatgt gggcgcccga gcgttccgcc
      301 gaggcgcggg gcaacctcac gcgccctcca gggtctggcg aggattgcgg atcggtgtcc
      361 gtggccttcc cgatcaccat gctgctcact ggtttcgtgg gcaacgcact ggccatgctg
      421 ctcgtgtcgc gcagctaccg gcgccgggag agcaagcgca agaagtcctt cctgctgtgc
      481 atcggctggc tggcgctcac cgacctggtc gggcagcttc tcaccacccc ggtcgtcatc
      541 gtcgtgtacc tgtccaagca gcgttgggag cacatcgacc cgtcggggcg gctctgcacc
      601 tttttcgggc tgaccatgac tgttttcggg ctctcctcgt tgttcatcgc cagcgccatg
      661 gccgtcgagc gggcgctggc catcagggcg ccgcactggt atgcgagcca catgaagacg
      721 cgtgccaccc gcgctgtgct gctcggcgtg tggctggccg tgctcgcctt cgccctgctg
      781 ccggtgctgg gcgtgggcca gtacaccgtc cagtggcccg ggacgtggtg cttcatcagc
      841 accgggcgag ggggcaacgg gactagctct tcgcataact ggggcaacct tttcttcgcc
      901 tctgcctttg ccttcctggg gctcttggcg ctgacagtca ccttttcctg caacctggcc
      961 accattaagg ccctggtgtc ccgctgccgg gccaaggcca cggcatctca gtccagtgcc
     1021 cagtggggcc gcatcacgac cgagacggcc attcagctta tggggatcat gtgcgtgctg
     1081 tcggtctgct ggtctccgct cctgataatg atgttgaaaa tgatcttcaa tcagacatca
     1141 gttgagcact gcaagacaca cacggagaag cagaaagaat gcaacttctt cttaatagct
     1201 gttcgcctgg cttcactgaa ccagatcttg gatccttggg tttacctgct gttaagaaag
     1261 atccttcttc gaaagttttg ccagatgaga aaaagaagac tcagagagca agctcctctt
     1321 cttcccaccc ctactgtgat tgatccttca aggttctgtg ctcagccctt ccgttggttc
     1381 ttggatttgt cctttcccgc catgtcttca tcacatccac aacttccact aacacttgcg
     1441 agcttcaaac ttcttagaga accctgcagt gtccagctaa gctgatgact tgaagataaa
     1501 tctgcctaac cctgggatga agtatctgtg aactattttg acagcagatg aggaattttg
     1561 gggaaattaa aacctgcctt tctgccagga tcacatcact ggaagctcca tgactctctt
     1621 tttgtaaaag aaaaaaaaat cacagaaaca cccacctccc aaactattct cttttacttc
     1681 ttcccccaag cccaccccca aatataactg ttatccagaa gctgttatgt cctgtttcca
     1741 tacatgtttt tgtactttta ctatatctac atacatcaat taaacttatg tcctattgtt
     1801 ttgtgaattt atatttgcgt atacattatc atatgtaaaa tttgcatttt tttattgaaa
     1861 attatgtttc ttgagattta tccacattga aacatggagc tctaaatcgt taattttaac
     1921 cgctatagag tattccataa tttgaataaa gcataatttg tttgtac
//