LOCUS X65666 162 bp mRNA linear HUM 18-APR-2005 DEFINITION H.sapiens Sox-10 mRNA. ACCESSION X65666 VERSION X65666.1 KEYWORDS DNA binding; sox-10 gene; Sry-related sequence. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 162) AUTHORS Denny P. JOURNAL Submitted (23-APR-1992) to the INSDC. P. Denny, Institute of Cancer Research, Chester Beatty Laboratories, Fulham Road, London SW3 6JB, UK REFERENCE 2 (bases 1 to 162) AUTHORS Denny P., Swift S., Brand N., Dabhade N., Barton P., Ashworth A. TITLE A conserved family of genes related to the testis determining gene, SRY JOURNAL Nucleic Acids Res. 20(11), 2887-2887(1992). PUBMED 1614875 FEATURES Location/Qualifiers source 1..162 /db_xref="H-InvDB:HIT000322756" /organism="Homo sapiens" /mol_type="mRNA" /dev_stage="adult and fetal" /tissue_type="heart muscle" /db_xref="taxon:9606" CDS <1..>162 /codon_start=1 /gene="sox-10" /product="SOX-10" /db_xref="GOA:Q9Y651" /db_xref="H-InvDB:HIT000322756.12" /db_xref="HGNC:HGNC:11197" /db_xref="InterPro:IPR009071" /db_xref="InterPro:IPR022097" /db_xref="InterPro:IPR036910" /db_xref="UniProtKB/Swiss-Prot:Q9Y651" /protein_id="CAA46617.1" /translation="SRAQRRKMAQENPKMHNSEISKRLGAEWKLLTESEKRPFIDEAK RLRAMHMKEH" misc_binding <1..>162 /bound_moiety="DNA" regulatory <1..>162 /note="HMG box" /regulatory_class="other" BASE COUNT 41 a 48 c 54 g 19 t ORIGIN 1 tcgcgggctc agcggcgcaa gatggcccag gagaacccca agatgcacaa ctcggagatc 61 agcaagcgct tgggcgccga gtggaaactg ctcacggagt cggagaagcg gccgttcatc 121 gacgaggcca agcgtctacg cgccatgcac atgaaggagc ac //