LOCUS       X59131                  3650 bp    mRNA    linear   HUM 07-OCT-2008
DEFINITION  Homo sapiens D13S106 mRNA for a highly charged amino acid sequence.
ACCESSION   X59131
VERSION     X59131.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1
  AUTHORS   Wilton A.N.
  JOURNAL   Submitted (20-APR-1991) to the INSDC. A.N. Wilton, Macquarie
            University, School of Biological Sciences, NSW 2109, AUSTRALIA
  REMARK    Revised by [3]
REFERENCE   2  (bases 1 to 1181)
  AUTHORS   Wilton A.N., Zehavi-Feferman T., Fleming J., Baker E., Chen L.Z.,
            Cooper D.W.
  TITLE     A unique intronless gene or gene seqment on chromosome 13
            specifying a highly charged amino acid sequence
  JOURNAL   Cytogenet. Cell Genet. 58, 1985-1985(1991).
REFERENCE   3
  AUTHORS   Turner R.J.
  JOURNAL   Submitted (12-FEB-1998) to the INSDC. Turner R.J., University of
            New South Wales, School of Biochemistry and Molecular Genetics,
            Kensington, Sydney, AUSTRALIA 2052
  REMARK    Revised by [4]
REFERENCE   4  (bases 1 to 3650)
  AUTHORS   Wilton A.N.
  JOURNAL   Submitted (19-OCT-1998) to the INSDC. A.N. Wilton, Macquarie
            University, School of Biological Sciences, NSW 2109, AUSTRALIA
FEATURES             Location/Qualifiers
     source          1..3650
                     /db_xref="H-InvDB:HIT000322302"
                     /organism="Homo sapiens"
                     /chromosome="13"
                     /map="13q12-q14"
                     /isolate="IGR3"
                     /mol_type="mRNA"
                     /clone_lib="lambda-gt11 (RM Hope, Univ. Adelaide)"
                     /clone="39"
                     /cell_line="IGR3"
                     /tissue_type="melanoma"
                     /db_xref="taxon:9606"
     CDS             178..3456
                     /gene="D13S106"
                     /product="hypothetical protein"
                     /note="highly charged amino acid sequence"
                     /db_xref="GOA:Q5W0Q7"
                     /db_xref="H-InvDB:HIT000322302.13"
                     /db_xref="HGNC:HGNC:20294"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="InterPro:IPR028890"
                     /db_xref="InterPro:IPR029388"
                     /db_xref="InterPro:IPR033505"
                     /db_xref="UniProtKB/Swiss-Prot:Q5W0Q7"
                     /protein_id="CAA41848.1"
                     /translation="MMDSPKIGNGLPVIGPGTDIGISSLHMVGYLGKNFDSAKVPSDE
                     YCPACREKGKLKALKTYRISFQESIFLCEDLQCIYPLGSKSLNNLISPDLEECHTPHK
                     PQKRKSLESSYKDSLLLANSKKTRNYIAIDGGKVLNSKHNGEVYDETSSNLPDSSGQQ
                     NPIRTADSLERNEILEADTVDMATTKDPATVDVSGTGRPSPQNEGCTSKLEMPLESKC
                     TSFPQALCVQWKNAYALCWLDCILSALVHSEELKNTVTGLCSKEESIFWRLLTKYNQA
                     NTLLYTSQLSGVKDGDCKKLTSEIFAEIETCLNEVRDEIFISLQPQLRCTLGDMESPV
                     FAFPLLLKLETHIEKLFLYSFSWDFECSQCGHQYQNRHMKSLVTFTNVIPEWHPLNAA
                     HFGPCNNCNSKSQIRKMVLEKVSPIFMLHFVEGLPQNDLQHYAFHFEGCLYQITSVIQ
                     YRANNHFITWILDADGSWLECDDXKGPCSERHKKFEVPASEIHIVIWERKISQVTDKE
                     AACLPLKKTNDQHALSNEKPVSLTSCSVGDAASAETASVTHPKDISVAPRTLSQDTAV
                     THGDHLLSGPKGLVDNILPLTLEETIQKTASVSQLNSEAFLLENKPVAENTGILKTNT
                     LLSQESLMASSVSAPCNEKLIQDQFVDISFPSQVVNTNMQSVQLNTEDTVNTKSVNNT
                     DATGLIQGVKSVEIEKDAQLKQFLTPKTEQLKPERVTSQVSNLKKKETTADSQTTTSK
                     SLQNQSLKENQKKPFVGSWVKGLISRGASFMPLCVSAHNRNTITDLQPSVKGVNNFGG
                     FKTKGINQKASHVSKKARKSASKPPPISKPPAGPPSSNGTAAHPHAHAASEVLEKSGS
                     TSCGAQLNHSSYGNGISSANHEDLVEGQIHKLRLKLRKKLKAEKKKLAALMSSPQSRT
                     VRSENLEQVPQDGSPNDCESIEDLLNELPYPIDIASESACTTVPGVSLYSSQTHEEIL
                     AELLSPTPVSTELSENGEGDFRYLGMGDSHIPPPVPSEFNDVSQNTHLXQDHNYCSPT
                     KKNPCEVQPDSLTNNACVRTLNLESPMKTDIFDEFFSSSALNALANDTLDLPHFDEYL
                     FENY"
BASE COUNT         1185 a          709 c          731 g         1023 t
ORIGIN      
        1 aggagcagtc cgaggggaac gtgggttgaa cgttgcaact agggtggaga tcaagctgga
       61 acaggagttc cgatcgaccc ggtaccaaga aggggagtgc ccgcggcagg gttcattgaa
      121 aaaatcctta gtgatattga catgtctcaa gtgacataaa ttagccaatg actcggaatg
      181 atggattctc cgaagattgg aaatggtttg ccagtgattg gaccagggac tgatataggg
      241 atatcttcac tccacatggt ggggtatttg ggaaaaaatt ttgattcagc taaagttcca
      301 tcagatgagt attgccctgc ttgtagagag aagggaaagt taaaagcctt aaagacttac
      361 cgaattagtt ttcaagaatc tatctttttg tgtgaggatc tgcagtgcat ctatcctttg
      421 ggctctaaat cacttaataa cctaatttct cctgatttgg aagaatgtca cactccacat
      481 aagcctcaga aaaggaagag cttagaaagc agctataagg attcacttct tttagcaaat
      541 tccaaaaaga ctagaaatta tattgctatt gacggtggaa aagttttgaa cagcaaacat
      601 aatggagaag tatatgacga aacctcgtca aacttacctg atagtagtgg tcaacagaat
      661 ccaattagga cagctgattc cttggagcgg aatgagattt tggaagctga tactgttgac
      721 atggctacta caaaagatcc tgctacagtt gatgtctctg gaactggcag accttcccct
      781 caaaatgaag gatgtacatc taaactggaa atgccactgg agagcaaatg tacatcattt
      841 ccccaggctt tatgtgtcca gtggaaaaat gcttatgctc tctgttggtt agactgtatc
      901 ctgtcagctt tggtgcactc ggaagagtta aagaacaccg tgactggact gtgctcgaag
      961 gaggaatcta tattctggcg gttgcttaca aaatataatc aagcaaatac acttctatat
     1021 accagtcaat tgagtggtgt taaagatgga gattgtaaaa aacttacctc agaaatattt
     1081 gcagagatag agacctgtct gaatgaagtt agagatgaaa tttttattag ccttcagccc
     1141 cagcttagat gcacattagg tgatatggaa agccctgtgt ttgcatttcc cctgctctta
     1201 aaactagaaa cccacattga aaagctcttc ctatattctt tttcttggga ctttgaatgt
     1261 tcgcagtgtg gacaccaata tcaaaacagg catatgaaga gtctggtcac ctttacaaat
     1321 gtcatccctg agtggcaccc acttaatgct gcccattttg gtccatgtaa caattgcaac
     1381 agtaaatcac aaataagaaa aatggtatta gaaaaagtat ctcccatatt catgttgcac
     1441 tttgtagaag gcttaccaca gaatgacttg cagcactatg catttcattt tgaaggctgt
     1501 ctttatcaga taacttctgt aattcagtat cgagcaaata atcattttat aacatggatt
     1561 ttagatgctg atggaagttg gctggaatgt gatgacwtaa aaggcccatg ttctgaaagg
     1621 cacaagaaat ttgaagttcc tgcttcagag atacatattg ttatttggga aagaaaaata
     1681 tcccaagtga cagataaaga agctgcctgc cttccactta aaaagactaa tgaccaacac
     1741 gctctcagta atgagaaacc agtatcttta acatcgtgtt ctgtgggtga tgctgcctca
     1801 gctgaaacag cctcagtaac tcaccctaaa gatatatcag ttgcccctcg tactctttca
     1861 caggacacag ctgtaactca tggagatcat ttactttcag gtccaaaagg tttggttgac
     1921 aatattttac ctctgacact tgaagaaact atccagaaaa cagcctcagt ttcacagtta
     1981 aattctgaag ctttcctgtt agaaaataaa cctgtagcag aaaatacagg aattctcaaa
     2041 accaatactt tgctatcaca agaatcacta atggcttctt cagtatcagc tccatgtaat
     2101 gaaaagctta ttcaagacca atttgtggac ataagttttc catcccaagt tgtaaataca
     2161 aacatgcagt cagtacagct gaatacagaa gatactgtaa atactaaatc tgtgaataat
     2221 actgatgcta ctggtcttat acagggagtg aagtcagtag aaattgagaa ggacgctcag
     2281 ttaaaacaat tccttacacc aaaaactgaa caattaaaac cagaacgtgt cacatctcag
     2341 gtatctaatt tgaagaaaaa agaaactaca gcagattctc aaaccacaac atccaagtca
     2401 ttacagaatc agtctctgaa agaaaatcag aagaagccat ttgtgggaag ttgggttaaa
     2461 ggcttaataa gcaggggtgc ttcttttatg ccactctgtg tttcagctca taatagaaac
     2521 actataactg atttacaacc ttcagttaaa ggggtaaata attttggtgg ctttaaaact
     2581 aaaggtataa accagaaggc cagccacgta tccaagaaag ctcgtaagag tgcaagtaag
     2641 cctcctccca tcagtaagcc accagcaggc cctccatcgt ctaatggcac agctgcccac
     2701 ccacatgctc atgctgcttc agaagttttg gaaaagtctg gaagcacctc atgtggagct
     2761 caactcaacc acagttctta tgggaatggt atttcttcag caaaccatga agacttggtg
     2821 gaaggtcaga ttcataaact tcgtctaaaa cttcgtaaaa agctaaaggc agaaaagaag
     2881 aaattagctg ctcttatgtc ttccccgcaa agcagaacag ttcgaagtga aaatctagaa
     2941 caggtgcccc aggatgggtc tccaaatgat tgtgaatcaa tagaggactt gttaaatgag
     3001 ctaccatatc caattgatat tgccagtgag tctgcatgca ccactgttcc tggtgtttcc
     3061 ctgtacagta gtcaaactca tgaagaaatt ttagcggaat tattgtctcc tacacctgtt
     3121 tcaacagagc tgtcagaaaa tggggaaggt gactttaggt atttgggaat gggagatagt
     3181 catatcccac caccagtacc aagtgaattc aatgatgttt cccagaacac acatctgaka
     3241 caggaccata attattgtag ccccaccaag aaaaatccat gtgaagttca gccagactct
     3301 ctgacaaata atgcctgcgt tagaacatta aacttggaga gtccgatgaa gactgatatt
     3361 ttcgatgagt ttttttcctc ctcagcatta aatgctttag caaatgacac attagaccta
     3421 cctcatttcg atgaatatct gtttgagaat tattgaatta atgcttgtta acttttttca
     3481 tataatattt attattatta gaagaactta caatgtgttc aggtagtgtt tatacactgg
     3541 acttgtgtaa ttacttgtgt aataaccatg aacaaaatgc aaggtttaac ctttggttct
     3601 gcccatgaag catgtaatct ttcttacaca ttaaaatcac tgaatgtgta
//