LOCUS       X13450                   985 bp    mRNA    linear   ROD 12-SEP-1993
DEFINITION  Murine B lymphocyte lineage restricted mb-1 mRNA.
ACCESSION   X13450
VERSION     X13450.1
KEYWORDS    cell surface glycoprotein; cell-surface marker; glycoprotein; mb-1
            gene; membrane protein.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 985)
  AUTHORS   Sakaguchi N., Kashiwamura S., Kimoto M., Thalmann P., Melchers F.
  TITLE     B lymphocyte lineage-restricted expression of mb-1, a gene with
            CD3-like structural properties
  JOURNAL   EMBO J. 7(11), 3457-3464(1988).
   PUBMED   2463161
COMMENT     Data kindly reviewed (23-Jun-1989) by Sakaguchi N.
FEATURES             Location/Qualifiers
     source          1..985
                     /organism="Mus musculus"
                     /strain="(C57BL/6JxDBA/2J)F1"
                     /mol_type="mRNA"
                     /clone_lib="lambda gt10"
                     /clone="m-mb-1-W-8"
                     /cell_line="WEHI231"
                     /cell_type="B-cell lymphoma"
                     /db_xref="taxon:10090"
     mRNA            <1..985
                     /note="m-mb-1 mRNA"
     CDS             10..672
                     /note="m-mb-1 protein (AA 1 - 220)"
                     /db_xref="GOA:P11911"
                     /db_xref="InterPro:IPR003110"
                     /db_xref="InterPro:IPR003599"
                     /db_xref="InterPro:IPR007110"
                     /db_xref="InterPro:IPR013151"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="MGI:MGI:101774"
                     /db_xref="UniProtKB/Swiss-Prot:P11911"
                     /protein_id="CAA31801.1"
                     /translation="MPGGLEALRALPLLLFLSYACLGPGCQALRVEGGPPSLTVNLGE
                     EARLTCENNGRNPNITWWFSLQSNITWPPVPLGPGQGTTGQLFFPEVNKNTGACTGCQ
                     VIENNILKRSCGTYLRVRNPVPRPFLDMGEGTKNRIITAEGIILLFCAVVPGTLLLFR
                     KRWQNEKFGVDMPDDYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGNLHIGDAQLE
                     KP"
     misc_feature    181..183
                     /note="pot. N-linked glycosylation site"
     misc_feature    211..213
                     /note="pot. N-linked glycosylation site"
     misc_feature    967..972
                     /note="pot. polyA signal"
     polyA_site      985..985
                     /note="polyA site"
BASE COUNT          216 a          308 c          240 g          221 t
ORIGIN      
        1 tgggagacga tgccaggggg tctagaagcc ctcagagccc tgcctctcct cctcttcttg
       61 tcatacgcct gtttgggtcc cggatgccag gccctgcggg tagaaggggg tccaccatcc
      121 ctgacggtga acttgggcga ggaggcccgc ctcacctgtg aaaacaatgg caggaaccct
      181 aatatcacat ggtggttcag ccttcagtct aacatcacat ggcccccagt gccactgggt
      241 cctggccagg gtaccacagg ccagctgttc ttccccgaag taaacaagaa cacaggggct
      301 tgtactgggt gccaagtgat agaaaacaac atattaaaac gctcctgtgg tacttacctc
      361 cgcgtgcgca atccagtccc taggcccttc ctggacatgg gggaaggtac caagaaccgc
      421 atcatcacag cagaagggat catcttgctg ttctgtgcag tggtgccagg gacgctgctg
      481 ctattcagga aacggtggca aaatgagaag tttggggtgg acatgccaga tgactatgaa
      541 gatgaaaatc tctatgaggg cctgaacctt gatgactgtt ctatgtatga ggacatctcc
      601 aggggactcc agggcaccta ccaggatgtg ggcaacctcc acattggaga tgcccagctg
      661 gaaaagccat gactgacatg tcccaccctt ccctgcctgc catatgtctg actccagcat
      721 ccctgcctcc ccactcttcc cctggagtcc ccccttccca gtgcttgctc cagccactcg
      781 agtgcgctac ccttgcctcc aggctgcccc accctattct cccacctaat cttgtccttc
      841 cccaagtcca gctccctctc tagtgggtaa tgagccctta atcgctgcct ctaggggagc
      901 tgattacagc atcctcgtta gtgtcacccc ccctcctccc agatctgtca tggccactta
      961 agtgataata aatccttccc aaagc
//