LOCUS       X04412                  2602 bp    mRNA    linear   HUM 07-OCT-2008
DEFINITION  Human mRNA for plasma gelsolin.
ACCESSION   X04412
VERSION     X04412.1
KEYWORDS    gelsolin; plasma protein.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2602)
  AUTHORS   Kwiatkowski,D.J., Stossel,T.P., Orkin,S.H., Mole,J.E., Colten,H.R.
            and  Yin,H.L.
  TITLE     Plasma and cytoplasmic gelsolins are encoded by a single gene and
            contain a duplicated actin-binding domain
  JOURNAL   Nature 323(6087), 455-458(1986).
   PUBMED   3020431
COMMENT     The tetrapeptide Asp-Glu-Ser-Gly (residues 96-99) is thought to
            participate in the actin contact between adjacent actins in the
            filament.
FEATURES             Location/Qualifiers
     source          1..2602
                     /db_xref="H-InvDB:HIT000321037"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     CDS             15..2363
                     /product="plasma gelsolin"
                     /db_xref="GOA:P06396"
                     /db_xref="H-InvDB:HIT000321037.14"
                     /db_xref="HGNC:HGNC:4620"
                     /db_xref="InterPro:IPR007122"
                     /db_xref="InterPro:IPR007123"
                     /db_xref="PDB:1C0F"
                     /db_xref="PDB:1C0G"
                     /db_xref="PDB:1D4X"
                     /db_xref="PDB:1DEJ"
                     /db_xref="PDB:1EQY"
                     /db_xref="PDB:1ESV"
                     /db_xref="PDB:1H1V"
                     /db_xref="PDB:1KCQ"
                     /db_xref="PDB:1MDU"
                     /db_xref="PDB:1NLV"
                     /db_xref="PDB:1NM1"
                     /db_xref="PDB:1NMD"
                     /db_xref="PDB:1P8X"
                     /db_xref="PDB:1P8Z"
                     /db_xref="PDB:1SOL"
                     /db_xref="PDB:1T44"
                     /db_xref="PDB:1YAG"
                     /db_xref="PDB:1YVN"
                     /db_xref="PDB:2FF3"
                     /db_xref="PDB:2FF6"
                     /db_xref="PDB:2FH1"
                     /db_xref="PDB:2FH2"
                     /db_xref="PDB:2FH3"
                     /db_xref="PDB:2FH4"
                     /db_xref="PDB:3A5L"
                     /db_xref="PDB:3A5M"
                     /db_xref="PDB:3A5N"
                     /db_xref="PDB:3A5O"
                     /db_xref="PDB:3CI5"
                     /db_xref="PDB:3CIP"
                     /db_xref="PDB:3CJB"
                     /db_xref="PDB:3CJC"
                     /db_xref="PDB:3FFK"
                     /db_xref="PDB:3FFN"
                     /db_xref="PDB:3TU5"
                     /db_xref="UniProtKB/Swiss-Prot:P06396"
                     /protein_id="CAA28000.1"
                     /translation="MAPHRPAPALLCALSLALCALSLPVRAATASRGASQAGAPQGRV
                     PEARPNSMVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQ
                     LRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGY
                     FKSGLKYKKGGVASGFKHVVPNEVVVQRLFQVKGRRVVRATEVPVSWESFNNGDCFIL
                     DLGNNIHQWCGSNSNRYERLKATQVSKGIRDNERSGRARVHVSEEGTEPEAMLQVLGP
                     KPALPAGTEDTAKEDAANRKLAKLYKVSNGAGTMSVSLVADENPFAQGALKSEDCFIL
                     DHGKDGKIFVWKGKQANTEERKAALKTASDFITKMDYPKQTQVSVLPEGGETPLFKQF
                     FKNWRDPDQTDGLGLSYLSSHIANVERVPFDAATLHTSTAMAAQHGMDDDGTGQKQIW
                     RIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYNWQGAQSTQDEVAASAI
                     LTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSREGGQTAPASTRLF
                     QVRANSAGATRAVEVLPKAGALNSNDAFVLKTPSAAYLWVGTGASEAEKTGAQELLRV
                     LRAQPVQVAEGSEPDGFWEALGGKAAYRTSPRLKDKKMDAHPPRLFACSNKIGRFVIE
                     EVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDR
                     RTPITVVKQGFEPPSFVGWFLGWDDDYWSVDPLDRAMAELAA"
     sig_peptide     15..95
                     /note="put. signal peptide (-27 to -1)"
     mat_peptide     96..2360
                     /note="mature plasma gelsolin (aa 1-755)"
     misc_feature    381..392
                     /note="tetrapeptide (aa 96-99)"
     misc_feature    2581..2586
                     /note="polyadenylation signal"
     polyA_site      2602..2602
                     /note="polyadenylation site"
BASE COUNT          551 a          750 c          804 g          497 t
ORIGIN
        1 gccgtgtcgc caccatggct ccgcaccgcc ccgcgcccgc gctgctttgc gcgctgtccc
       61 tggcgctgtg cgcgctgtcg ctgcccgtcc gcgcggccac tgcgtcgcgg ggggcgtccc
      121 aggcgggggc gccccagggg cgggtgcccg aggcgcggcc caacagcatg gtggtggaac
      181 accccgagtt cctcaaggca gggaaggagc ctggcctgca gatctggcgt gtggagaagt
      241 tcgatctggt gcccgtgccc accaaccttt atggagactt cttcacgggc gacgcctacg
      301 tcatcctgaa gacagtgcag ctgaggaacg gaaatctgca gtatgacctc cactactggc
      361 tgggcaatga gtgcagccag gatgagagcg gggcggccgc catctttacc gtgcagctgg
      421 atgactacct gaacggccgg gccgtgcagc accgtgaggt ccagggcttc gagtcggcca
      481 ccttcctagg ctacttcaag tctggcctga agtacaagaa aggaggtgtg gcatcaggat
      541 tcaagcacgt ggtacccaac gaggtggtgg tgcagagact cttccaggtc aaagggcggc
      601 gtgtggtccg tgccaccgag gtacctgtgt cctgggagag cttcaacaat ggcgactgct
      661 tcatcctgga cctgggcaac aacatccacc agtggtgtgg ttccaacagc aatcggtatg
      721 aaagactgaa ggccacacag gtgtccaagg gcatccggga caacgagcgg agtggccggg
      781 cccgagtgca cgtgtctgag gagggcactg agcccgaggc gatgctccag gtgctgggcc
      841 ccaagccggc tctgcctgca ggtaccgagg acaccgccaa ggaggatgcg gccaaccgca
      901 agctggccaa gctctacaag gtctccaatg gtgcagggac catgtccgtc tccctcgtgg
      961 ctgatgagaa ccccttcgcc cagggggccc tgaagtcaga ggactgcttc atcctggacc
     1021 acggcaaaga tgggaaaatc tttgtctgga aaggcaagca ggcaaacacg gaggagagga
     1081 aggctgccct caaaacagcc tctgacttca tcaccaagat ggactacccc aagcagactc
     1141 aggtctcggt ccttcctgag ggcggtgaga ccccactgtt caagcagttc ttcaagaact
     1201 ggcgggaccc agaccagaca gatggcctgg gcttgtccta cctttccagc catatcgcca
     1261 acgtggagcg ggtgcccttc gacgccgcca ccctgcacac ctccactgcc atggccgccc
     1321 agcacggcat ggatgacgat ggcacaggcc agaaacagat ctggagaatc gaaggttcca
     1381 acaaggtgcc cgtggaccct gccacatatg gacagttcta tggaggcgac agctacatca
     1441 ttctgtacaa ctaccgccat ggtggccgcc aggggcagat aatctataac tggcagggtg
     1501 cccagtctac ccaggatgag gtcgctgcat ctgccatcct gactgctcag ctggatgagg
     1561 agctgggagg tacccctgtc cagagccgtg tggtccaagg caaggagccc gcccacctca
     1621 tgagcctgtt tggtgggaag cccatgatca tctacaaggg cggcacctcc cgcgagggcg
     1681 ggcagacagc ccctgccagc acccgcctct tccaggtccg cgccaacagc gctggagcca
     1741 cccgggctgt tgaggtattg cctaaggctg gtgcactgaa ctccaacgat gcctttgttc
     1801 tgaaaacccc ctcagccgcc tacctgtggg tgggtacagg agccagcgag gcagagaaga
     1861 cgggggccca ggagctgctc agggtgctgc gggcccaacc tgtgcaggtg gcagaaggca
     1921 gcgagccaga tggcttctgg gaggccctgg gcgggaaggc tgcctaccgc acatccccac
     1981 ggctgaagga caagaagatg gatgcccatc ctcctcgcct ctttgcctgc tccaacaaga
     2041 ttggacgttt tgtgatcgaa gaggttcctg gtgagctcat gcaggaagac ctggcaacgg
     2101 atgacgtcat gcttctggac acctgggacc aggtctttgt ctgggttgga aaggattctc
     2161 aagaagaaga aaagacagaa gccttgactt ctgctaagcg gtacatcgag acggacccag
     2221 ccaatcggga tcggcggacg cccatcaccg tggtgaagca aggctttgag cctccctcct
     2281 ttgtgggctg gttccttggc tgggatgatg attactggtc tgtggacccc ttggacaggg
     2341 ccatggctga gctggctgcc tgaggagggg cagggcccac ccatgtcacc ggtcagtgcc
     2401 ttttggaact gtccttccct caaagaggcc ttagagcgag cagagcagct ctgctatgag
     2461 tgtgtgtgtg tgtgtgtgtt gtttcttttt ttttttttta cagtatccaa aaatagccct
     2521 gcaaaaattc agagtccttg caaaattgtc taaaatgtca gtgtttggga aattaaatcc
     2581 aataaaaaca ttttgaagtg tg
//