LOCUS       X01715                   709 bp    DNA     linear   HUM 14-NOV-2006
DEFINITION  Homo sapiens gene for acetylcholine receptor gamma chain precursor
            (exons 1 and 2).
ACCESSION   X01715
VERSION     X01715.1
KEYWORDS    acetylcholine receptor protein, gamma chain precursor; CHRNG gene.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 709)
  AUTHORS   Shibahara,S., Kubo,T., Perski,H.J., Takahashi,H., Noda,M. and 
            Numa,S.
  TITLE     Cloning and sequence analysis of human genomic DNA encoding gamma
            subunit precursor of muscle acetylcholine receptor
  JOURNAL   Eur. J. Biochem. 146(1), 15-22(1985).
   PUBMED   3967651
COMMENT     Data kindly reviewed (01-DEC-1986) by M. Noda
FEATURES             Location/Qualifiers
     source          1..709
                     /organism="Homo sapiens"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:9606"
     TATA_signal     196..200
                     /gene="CHRNG"
     mRNA            join(239..355,536..664,X01716.1:101..145,
                     X01716.1:322..431,
                     X01717.1:42..197,X01718.1:174..271,X01719.1:155..355,
                     X01719.1:548..662,X01720.1:60..174,X01721.1:84..297,
                     X01721.1:489..619,X04759.1:101..274)
                     /gene="CHRNG"
     5'UTR           239..280
                     /gene="CHRNG"
     exon            239..355
                     /gene="CHRNG"
                     /note="label:ex1"
     CDS             join(281..355,536..664,X01716.1:101..145,
                     X01716.1:322..431,
                     X01717.1:42..197,X01718.1:174..271,X01719.1:155..355,
                     X01719.1:548..662,X01720.1:60..174,X01721.1:84..297,
                     X01721.1:489..619,X04759.1:101..274)
                     /gene="CHRNG"
                     /product="acetylcholine receptor gamma chain precursor"
                     /db_xref="GOA:P07510"
                     /db_xref="HGNC:HGNC:1967"
                     /db_xref="InterPro:IPR002394"
                     /db_xref="InterPro:IPR006029"
                     /db_xref="InterPro:IPR006201"
                     /db_xref="InterPro:IPR006202"
                     /db_xref="InterPro:IPR018000"
                     /db_xref="InterPro:IPR027361"
                     /db_xref="UniProtKB/Swiss-Prot:P07510"
                     /protein_id="CAA25861.1"
                     /translation="MHGGQGPLLLLLLLAVCLGGTQRNLRNQEERLLADLMQNYDPNL
                     RPAERDSDVVNVSLKLTLTNLISLNEREEALTTNVWIEMQWCDYRLRWDPRDYEGLWV
                     LRVPSTMVWRPDIVLENNVDGVFEVALYCNVLVSPDGCIYWLPPAIFRSACSISVTYF
                     PFDWQNCSLIFQSQTYSTNEIDLQLSQEDGQTIEWIFIDPEAFTENGEWAIQHRPAKM
                     LLDPAAPAQEAGHQKVVFYLLIQRKPLFYVINIIAPCVLISSVAILIHFLPAKAGGQK
                     CTVAINVLLAQTVFLFLVAKKVPETSQAVPLISKYLTFLLVVTILIVVNAVVVLNVSL
                     RSPHTHSMARGVRKVFLRLLPQLLRMHVRPLAPAAVQDTQSRLQNGSSGWSITTGEEV
                     ALCLPRSELLFQQWQRQGLVAAALEKLEKGPELGLSQFCGSLKQAAPAIQACVEACNL
                     IACARHQQSHFDNGNEEWFLVGRVLDRVCFLAMLSLFICGTAGIFLMAHYNRVPALPF
                     PGDPRPYLPSPD"
     sig_peptide     281..335
                     /gene="CHRNG"
     mat_peptide     join(536..664,X01716.1:101..145,X01716.1:322..431,
                     X01717.1:42..197,X01718.1:174..271,X01719.1:155..355,
                     X01719.1:548..662,X01720.1:60..174,X01721.1:84..297,
                     X01721.1:489..628,X04759.1:101..271)
                     /gene="CHRNG"
                     /product="acetylcholine receptor gamma chain"
     exon            536..664
                     /gene="CHRNG"
                     /note="label:ex2"
BASE COUNT          121 a          230 c          227 g          131 t
ORIGIN
        1 cccgagttgg ggctggaagg tggatgtctc ttttggggca gacggggccc ctgtctcccc
       61 tctccagccc aggtaacctg agcccagcat tgtgtccatc ctggaacagc tgacaacgct
      121 gtggtcagac agctggtggg gctgggccag gctggccggg ctggctgggc tggctggggt
      181 gggagtgtag gctgttatat gacacccaga gcccatctct ctctgcccca gaccttggag
      241 ctgttgtccc acccctgtca ctgcagagag ctgaggcacc atgcatgggg gccaggggcc
      301 gctgctcctc ctgctgctgc tggctgtctg cctgggtggg acacaaagga atctcagcct
      361 ggggagtccc agagctgggg tccacagcct caggggatgg agggtctgag gggtattggg
      421 gcctgccctg gacccagttc cctgagtccc cacttcacac ccccagggcc tccccgctct
      481 ttccacctcc aagctcctgc taggctcacg cctgtctatt gcaggggccc agggccggaa
      541 ccaggaggag cgcctgctcg cagacctgat gcaaaactac gaccccaacc tgcggcccgc
      601 ggaacgagac tcggatgtgg tcaatgtcag cctgaagcta accctcacca acctcatctc
      661 cctggtaagc cgcaggacgg aggaggggtc agcgcaccac gccctggga
//