LOCUS       HSU82328                2365 bp    mRNA    linear   HUM 20-MAR-1998
DEFINITION  Homo sapiens pyruvate dehydrogenase complex protein X subunit
            precursor (proX) mRNA, complete cds.
ACCESSION   U82328
VERSION     U82328.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2365)
  AUTHORS   Ling,M., McEachern,G., Seyda,A., MacKay,N., Scherer,S.W.,
            Bratinova,S., Beatty,B., Giovannucci-Uzielli,M.L. and Robinson,B.H.
  TITLE     Detection of a homozygous four base pair deletion in the protein X
            gene in a case of pyruvate dehydrogenase complex deficiency
  JOURNAL   Hum. Mol. Genet. 7 (3), 501-505 (1998)
   PUBMED   9467010
REFERENCE   2  (bases 1 to 2365)
  AUTHORS   Ling,M. and Robinson,B.H.
  TITLE     Direct Submission
  JOURNAL   Submitted (16-DEC-1996) Genetics, Research Institute, Hospital for
            Sick Children, 555 University Avenue, Toronto, Ont. M5G 1X8, Canada
FEATURES             Location/Qualifiers
     source          1..2365
                     /db_xref="H-InvDB:HIT000221760"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     gene            1..2365
                     /gene="proX"
     CDS             39..1544
                     /gene="proX"
                     /note="similar to the Rattus norvegicus dihydrolipoamide
                     acetyltransferase component (E2) of pyruvate dehydrogenase
                     complex: Swiss Prot Accession Number P08461"
                     /codon_start=1
                     /product="pyruvate dehydrogenase complex protein X subunit
                     precursor"
                     /protein_id="AAC39661.1"
                     /db_xref="GI:2979625"
                     /translation="MAASWRLGCDPRLLRYLVGFPGRRSVGLVKGALGWSVSRGRNWR
                     WFHSTQWLRGDPIKILMPSLSPTMEEGNIVKWLKKEGEAVSAGDALCEIETDKAVVTL
                     DASDDGILAKIVVEEGSKNIRLGSLIGLIVEEGEDWKHVEIPKDVGPPPPVSKPSEPR
                     PSPEPQISIPVKKEHIPGTLRFRLSPAARNILEKHSLDASQGTATGPRGIFTKEDALK
                     LVQLKQTGKITESRPTPAPTATPTAPSPLQATAGPSYPRPVIPPVSTPGQPNAVGTFT
                     EIPASNIRRVIAKRLTESKSTVPHAYATADCDLGAVLKVRQDLVKDDIKVSVNDFIIK
                     AAAVTLKQMPDVNVSWDGEGPKQLPFIDISVAVATDKGLLTPIIKDAAAKGIQEIADS
                     VKALSKKARDGKLLPEEYQGGSFSISNLGMFGIDEFTAVINPPQACILAVGRFRPVLK
                     LTEDEEGNAKLQQRQLITVTMSSDSRVVDDELATRFLKSFKANLENPIRLA"
     sig_peptide     39..197
                     /gene="proX"
                     /function="mitochondrial targeting sequence"
     mat_peptide     198..1541
                     /gene="proX"
                     /product="pyruvate dehydrogenase complex protein X
                     subunit"
BASE COUNT          751 a          453 c          535 g          626 t
ORIGIN      
        1 aggctgtgct gcgggcagcc agtgagaagg ccgtcaagat ggcggcctcc tggaggctgg
       61 gctgtgatcc gcggctgctg cgttatcttg tgggcttccc tggccgccga agcgtagggc
      121 tggtgaaggg ggctcttggg tggtctgtaa gccgcggacg taattggaga tggtttcaca
      181 gcacgcagtg gcttcggggt gatcccatta agatactaat gccatcactg tctcctacaa
      241 tggaagaagg aaacattgtg aaatggctga aaaaggaagg tgaagcggtg agtgctggag
      301 atgcattatg tgaaattgag actgacaaag ctgtggttac cttagatgca agtgatgatg
      361 gaatcttggc caaaatcgtg gttgaagaag gaagtaaaaa tatacggcta ggttcactaa
      421 ttggtttgat agtagaagaa ggagaagatt ggaaacatgt tgaaattccc aaagacgtag
      481 gtcctccacc accagtttca aaaccttcag agcctcgccc ctcaccagaa ccacagattt
      541 ccatccctgt caagaaggaa cacatacccg ggacactacg gttccgttta agtccagctg
      601 cccgcaatat tctggaaaaa cactcactgg atgctagcca gggcacagcc actggccctc
      661 gggggatatt cactaaagag gatgctctca aacttgtcca gttgaaacaa acgggcaaga
      721 ttaccgagtc cagaccaact ccagccccca cagccactcc cacagcacct tcgcccctac
      781 aggccacagc tggaccatct tatccccggc ctgtgatccc accagtatca actcctggac
      841 aacccaatgc agtgggcaca ttcactgaaa tccccgccag caatattcga agagtcattg
      901 ccaagagatt aactgaatct aaaagtactg tacctcatgc atatgctact gctgactgtg
      961 accttggagc tgttttaaaa gttaggcaag atctggtcaa agatgacatt aaagtatcag
     1021 taaatgattt tatcatcaag gcagcagctg ttacccttaa acaaatgcca gatgttaatg
     1081 taagctggga tggagagggc ccaaagcaac tgccatttat tgacatttca gtggctgtgg
     1141 caacagataa aggcttactt actccaatca taaaagatgc tgctgctaaa ggtatccagg
     1201 aaattgctga ctctgtaaag gctctatcaa agaaagcaag agatggaaaa ttgttgcctg
     1261 aagaatacca aggaggatct tttagtattt ccaacttggg gatgtttggc atcgacgaat
     1321 ttactgcagt gattaaccct cctcaggcct gcattttggc ggttgggagg ttccgacctg
     1381 tgctgaagct cactgaggat gaagagggaa atgccaaact gcagcagcgc cagctcataa
     1441 cagtcacaat gtcaagtgac agtcgagtgg ttgatgacga actggcaacc aggtttctta
     1501 aaagttttaa agcaaaccta gagaatccta tccgacttgc ctagtcctca aagataagaa
     1561 gttggtgttc agcttagttg attcagtagt tgttaccaag aaacatatgt tataggaaaa
     1621 caacttggta tttaagtatg aagtggatga aatgtttatt tatttaaggt gaaagcattt
     1681 gacccagggt gtcttcatct tcaatttggg tttaatgtta tagaaataaa tgatgataaa
     1741 ctctaactaa taaaggaaag agaatatttg gttactcaga tccattttta acctctggtg
     1801 ctgtataaag ggaatattaa actagatgta aatcaaagta tatgtttggc tcatttgagc
     1861 attttggaat atttgagaat gtatgataca tgtaaaatta aaaaaactat tagaactgta
     1921 ccataattat gttgaaggta gaagtgatct tcaaagagat ggccattaac ttagcagtgg
     1981 gacctcactt ttacaagcac tgctctagat atacttgaag aatttaatag gtacagaagt
     2041 ttattctgga taataaataa ataaggatca cactgtatta ggggttatgg caacattatt
     2101 gaatttttta tgtacataaa gccatatgtt tagggtggtt tctatctgtc ttgtttttca
     2161 cttatataac actgtgaact tctaaagcaa gaggataaaa gaagcatgaa tgaaaagaat
     2221 gacatttcaa aaaaatggtt caatgaaaaa ctatagctaa aatatgtaaa cctttctagg
     2281 taaaccgctt gccttcatct tgagtcggaa tatatttaaa taaattgtgt tatctcttgc
     2341 caaaaaaaaa aaaaaaaaaa aaaaa
//