LOCUS       HSU38784                1017 bp    mRNA    linear   HUM 16-OCT-1996
DEFINITION  Human ubiquitin-like protein mRNA, complete cds.
ACCESSION   U38784
VERSION     U38784.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1017)
  AUTHORS   Shen,Z., Pardington-Purtymun,P.E., Comeaux,J.C., Moyzis,R.K. and
            Chen,D.J.
  TITLE     UBL1, a human ubiquitin-like protein associating with human
            RAD51/RAD52 proteins
  JOURNAL   Genomics 36 (2), 271-279 (1996)
   PUBMED   8812453
REFERENCE   2  (bases 1 to 1017)
  AUTHORS   Shen,Z.
  TITLE     Direct Submission
  JOURNAL   Submitted (16-OCT-1995) Zhiyuan Shen, Life Sciences Division, Los
            Alamos National Lab, MS M888, Los Alamos, NM 87545, USA
FEATURES             Location/Qualifiers
     source          1..1017
                     /db_xref="H-InvDB:HIT000219602"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /note="This cDNA was cloned with the yeast two hybrid
                     system. The protein interacts with human RAD51 and RAD52
                     proteins in yeast"
     CDS             67..372
                     /note="similar to ubiquitin and to yeast Smt3p (suppressor
                     of MIF2); Method: conceptual translation supplied by
                     author"
                     /codon_start=1
                     /protein_id="AAC50733.1"
                     /db_xref="GI:1574948"
                     /translation="MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHL
                     KKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV"
BASE COUNT          310 a          180 c          213 g          314 t
ORIGIN      
        1 ggagcgaggt tctgcttacc cgaggcctct gctgtgcgga gacccccggg tgaagccacc
       61 gtcatcatgt ctgaccagga ggccaaacct tcaactgagg acttggggga taagaaggaa
      121 ggtgaatata ttaaactcaa agtcattgga caggatagca gtgagattca cttcaaagtg
      181 aaaatgacaa cacatctcaa gaaactcaaa gaatcatact gtcaaagaca gggtgttcca
      241 atgaattcac tcaggtttct ctttgagggt cagagaattg ctgataatca tactccaaaa
      301 gaactgggaa tggaggaaga agatgtgatt gaagtttatc aggaacaaac ggggggtcat
      361 tcaacagttt agatattctt tttatttttt ttcttttccc tcaatccttt tttattttta
      421 aaaatagttc ttttgtaatg tggtgttcaa aacggaattg aaaactggca ccccatctct
      481 ttgaaacatc tggtaatttg aattctagtg ctcattattc attattgttt gttttcattg
      541 tgctgatttt tggtgatcaa gcctcagtcc ccttcatatt accctctcct ttttaaaaat
      601 tacgtgtgca cagagaggtc acctttttca ggacattgca ttttcaggct tgtggtgata
      661 aataagatcg accaatgcaa gtgttcataa tgactttcca attggccctg atgttctagc
      721 atgtgattac ttcactcctg gactgtgact ttcagtggga gatggaagtt tttcagagaa
      781 ctgaactgtg gaaaaatgac ctttccttaa cttgaagcta cttttaaaat ttgagggtct
      841 ggaccaaaag aagaggaata tcaggttgaa gtcaagatga cagataaggt gagagtaatg
      901 actaactcca aagatggctt cactgaagaa aaggcatttt aagatttttt aaaaatcttg
      961 tcagaagatc ccagaaaagt tctaattttc attagcaatt aataaagcta tacatgc
//