LOCUS       HSU14407                1202 bp    mRNA    linear   HUM 21-SEP-1994
DEFINITION  Human interleukin 15 (IL15) mRNA, complete cds.
ACCESSION   U14407
VERSION     U14407.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1202)
  AUTHORS   Grabstein,K.K., Eisenman,J., Sheanebeck,K., Rauch,C.,
            Srinivasan,S., Fung,V., Beers,C., Richardson,J., Schoenborn,M.A.,
            Ahdieh,M., Johnson,L., Alderson,M.R., Watson,J.D., Anderson,D.M.
            and Giri,J.G.
  TITLE     Cloning of a T cell growth factor that interacts with the beta
            chain of the interleukin-2 receptor
  JOURNAL   Science 264 (5161), 965-968 (1994)
   PUBMED   8178155
REFERENCE   2  (bases 1 to 1202)
  AUTHORS   Anderson,D.M.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-SEP-1994) Dirk M. Anderson, Immunex Research and
            Development Corp., 51, University St., Seattle, WA 98101, USA
FEATURES             Location/Qualifiers
     source          1..1202
                     /db_xref="H-InvDB:HIT000218255"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /cell_line="IMTLH"
                     /cell_type="stromal"
                     /tissue_type="Bone marrow"
     gene            1..1202
                     /gene="IL15"
     sig_peptide     314..460
                     /gene="IL15"
                     /experiment="experimental evidence, no additional details
                     recorded"
     CDS             317..805
                     /gene="IL15"
                     /note="cytokine; T cell growth factor; secreted protein"
                     /codon_start=1
                     /product="Interleukin 15"
                     /protein_id="AAA21551.1"
                     /db_xref="GI:540099"
                     /translation="MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLP
                     KTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLES
                     GDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFIN
                     TS"
     mat_peptide     461..802
                     /gene="IL15"
                     /product="unnamed"
                     /note="putative"
     misc_feature    671..678
                     /gene="IL15"
                     /note="encodes N-glycosylation site"
     misc_feature    695..703
                     /gene="IL15"
                     /note="encodes N-glycosylation site"
     misc_feature    794..802
                     /gene="IL15"
                     /note="encodes N-glycosylation site"
BASE COUNT          355 a          219 c          249 g          379 t
ORIGIN      
        1 tgtccggcgc cccccgggag ggaactgggt ggccgcaccc tcccggctgc ggtggctgtc
       61 gccccccacc ctgcagccag gactcgatgg agaatccatt ccaatatatg gccatgtggc
      121 tctttggagc aatgttccat catgttccat gctgctgctg acgtcacatg gagcacagaa
      181 atcaatgtta gcagatagcc agcccataca agatcgtatt gtattgtagg aggcatcgtg
      241 gatggatggc tgctggaaac cccttgccat agccagctct tcttcaatac ttaaggattt
      301 accgtggctt tgagtaatga gaatttcgaa accacatttg agaagtattt ccatccagtg
      361 ctacttgtgt ttacttctaa acagtcattt tctaactgaa gctggcattc atgtcttcat
      421 tttgggctgt ttcagtgcag ggcttcctaa aacagaagcc aactgggtga atgtaataag
      481 tgatttgaaa aaaattgaag atcttattca atctatgcat attgatgcta ctttatatac
      541 ggaaagtgat gttcacccca gttgcaaagt aacagcaatg aagtgctttc tcttggagtt
      601 acaagttatt tcacttgagt ccggagatgc aagtattcat gatacagtag aaaatctgat
      661 catcctagca aacaacagtt tgtcttctaa tgggaatgta acagaatctg gatgcaaaga
      721 atgtgaggaa ctggaggaaa aaaatattaa agaatttttg cagagttttg tacatattgt
      781 ccaaatgttc atcaacactt cttgattgca attgattctt tttaaagtgt ttctgttatt
      841 aacaaacatc actctgctgc ttagacataa caaaacactc ggcatttaaa atgtgctgtc
      901 aaaacaagtt tttctgtcaa gaagatgatc agaccttgga tcagatgaac tcttagaaat
      961 gaaggcagaa aaatgtcatt gagtaatata gtgactatga acttctctca gacttacttt
     1021 actcattttt ttaatttatt attgaaattg tacatatttg tggaataatg taaaatgttg
     1081 aataaaaata tgtacaagtg ttgtttttta agttgcactg atattttacc tcttattgca
     1141 aaatagcatt tgtttaaggg tgatagtcaa attatgtatt ggtggggctg ggtaccaatg
     1201 ct
//