LOCUS       HUMTGFBIG               2691 bp    mRNA    linear   HUM 14-JAN-1995
DEFINITION  Human transforming growth factor-beta induced gene product (BIGH3)
            mRNA, complete cds.
ACCESSION   M77349
VERSION     M77349.1
KEYWORDS    transforming growth factor-beta induced protein.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2691)
  AUTHORS   Skonier,J., Neubauer,M., Madisen,L., Bennett,K., Plowman,G.D. and
            Purchio,A.F.
  TITLE     cDNA cloning and sequence analysis of beta ig-h3, a novel gene
            induced in a human adenocarcinoma cell line after treatment with
            transforming growth factor-beta
  JOURNAL   DNA Cell Biol. 11 (7), 511-522 (1992)
   PUBMED   1388724
COMMENT     Original source text: Homo sapiens cDNA to mRNA.
FEATURES             Location/Qualifiers
     source          1..2691
                     /db_xref="H-InvDB:HIT000196398"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /cell_line="A549"
                     /cell_type="adenocarcinoma"
     gene            1..2691
                     /gene="BIGH3"
     CDS             48..2099
                     /gene="BIGH3"
                     /note="putative"
                     /codon_start=1
                     /product="transforming growth factor induced protein"
                     /protein_id="AAA61163.1"
                     /db_xref="GI:339568"
                     /translation="MALFVRLLALALALALGPAATLAGPAKSPYQLVLQHSRLRGRQH
                     GPNVCAVQKVIGTNRKYFTNCKQWYQRKICGKSTVISYECCPGYEKVPGEKGCPAALP
                     LSNLYETLGVVGSTTTQLYTDRTEKLRPEMEGPGSFTIFAPSNEAWASLPAEVLDSLV
                     SNVNIELLNALRYHMVGRRVLTDELKHGMTLTSMYQNSNIQIHHYPNGIVTVNCARLL
                     KADHHATNGVVHLIDKVISTITNNIQQIIEIEDTFETLRAAVAASGLNTMLEGNGQYT
                     LLAPTNEAFEKIPSETLNRILGDPEALRDLLNNHILKSAMCAEAIVAGLSVETLEGTT
                     LEVGCSGDMLTINGKAIISNKDILATNGVIHYIDELLIPDSAKTLFELAAESDVSTAI
                     DLFRQAGLGNHLSGSERLTLLAPLNSVFKDGTPPIDAHTRNLLRNHIIKDQLASKYLY
                     HGQTLETLGGKKLRVFVYRNSLCIENSCIAAHDKRGRYGTLFTMDRVLTPPMGTVMDV
                     LKGDNRFSMLVAAIQSAGLTETLNREGVYTVFAPTNEAFRALPPRERSRLLGDAKELA
                     NILKYHIGDEILVSGGIGALVRLKSLQGDKLEVSLKNNVVSVNKEPVAEPDIMATNGV
                     VHVITNVLQPPANRPQERGDELADSALEIFKQASAFSRASQRSVRLAPVYQKLLERMK
                     H"
     sig_peptide     48..92
                     /gene="BIGH3"
                     /note="putative"
     mat_peptide     93..2096
                     /gene="BIGH3"
                     /product="transforming growth factor-beta induced protein"
BASE COUNT          679 a          729 c          695 g          588 t
ORIGIN      
        1 gcttgcccgt cggtcgctag ctcgctcggt gcgcgtcgtc ccgctccatg gcgctcttcg
       61 tgcggctgct ggctctcgcc ctggctctgg ccctgggccc cgccgcgacc ctggcgggtc
      121 ccgccaagtc gccctaccag ctggtgctgc agcacagcag gctccggggc cgccagcacg
      181 gccccaacgt gtgtgctgtg cagaaggtta ttggcactaa taggaagtac ttcaccaact
      241 gcaagcagtg gtaccaaagg aaaatctgtg gcaaatcaac agtcatcagc tacgagtgct
      301 gtcctggata tgaaaaggtc cctggggaga agggctgtcc agcagcccta ccactctcaa
      361 acctttacga gaccctggga gtcgttggat ccaccaccac tcagctgtac acggaccgca
      421 cggagaagct gaggcctgag atggaggggc ccggcagctt caccatcttc gcccctagca
      481 acgaggcctg ggcctccttg ccagctgaag tgctggactc cctggtcagc aatgtcaaca
      541 ttgagctgct caatgccctc cgctaccata tggtgggcag gcgagtcctg actgatgagc
      601 tgaaacacgg catgaccctc acctctatgt accagaattc caacatccag atccaccact
      661 atcctaatgg gattgtaact gtgaactgtg cccggctcct gaaagccgac caccatgcaa
      721 ccaacggggt ggtgcacctc atcgataagg tcatctccac catcaccaac aacatccagc
      781 agatcattga gatcgaggac acctttgaga cccttcgggc tgctgtggct gcatcagggc
      841 tcaacacgat gcttgaaggt aacggccagt acacgctttt ggccccgacc aatgaggcct
      901 tcgagaagat ccctagtgag actttgaacc gtatcctggg cgacccagaa gccctgagag
      961 acctgctgaa caaccacatc ttgaagtcag ctatgtgtgc tgaagccatc gttgcggggc
     1021 tgtctgtaga gaccctggag ggcacgacac tggaggtggg ctgcagcggg gacatgctca
     1081 ctatcaacgg gaaggcgatc atctccaata aagacatcct agccaccaac ggggtgatcc
     1141 actacattga tgagctactc atcccagact cagccaagac actatttgaa ttggctgcag
     1201 agtctgatgt gtccacagcc attgaccttt tcagacaagc cggcctcggc aatcatctct
     1261 ctggaagtga gcggttgacc ctcctggctc ccctgaattc tgtattcaaa gatggaaccc
     1321 ctccaattga tgcccataca aggaatttgc ttcggaacca cataattaaa gaccagctgg
     1381 cctctaagta tctgtaccat ggacagaccc tggaaactct gggcggcaaa aaactgagag
     1441 tttttgttta tcgtaatagc ctctgcattg agaacagctg catcgcggcc cacgacaaga
     1501 gggggaggta cgggaccctg ttcacgatgg accgggtgct gaccccccca atggggactg
     1561 tcatggatgt cctgaaggga gacaatcgct ttagcatgct ggtagctgcc atccagtctg
     1621 caggactgac ggagaccctc aaccgggaag gagtctacac agtctttgct cccacaaatg
     1681 aagccttccg agccctgcca ccaagagaac ggagcagact cttgggagat gccaaggaac
     1741 ttgccaacat cctgaaatac cacattggtg atgaaatcct ggttagcgga ggcatcgggg
     1801 ccctggtgcg gctaaagtct ctccaaggtg acaagctgga agtcagcttg aaaaacaatg
     1861 tggtgagtgt caacaaggag cctgttgccg agcctgacat catggccaca aatggcgtgg
     1921 tccatgtcat caccaatgtt ctgcagcctc cagccaacag acctcaggaa agaggggatg
     1981 aacttgcaga ctctgcgctt gagatcttca aacaagcatc agcgttttcc agggcttccc
     2041 agaggtctgt gcgactagcc cctgtctatc aaaagttatt agagaggatg aagcattagc
     2101 ttgaagcact acaggaggaa tgcaccacgg cagctctccg ccaatttctc tcagatttcc
     2161 acagagactg tttgaatgtt ttcaaaacca agtatcacac tttaatgtac atgggccgca
     2221 ccataatgag atgtgagcct tgtgcatgtg ggggaggagg gagagagatg tactttttaa
     2281 atcatgttcc ccctaaacat ggctgttaac ccactgcatg cagaaacttg gatgtcactg
     2341 cctgacattc acttccagag aggacctatc ccaaatgtgg aattgactgc ctatgccaag
     2401 tccctggaaa aggagcttca gtattgtggg gctcataaaa catgaatcaa gcaatccagc
     2461 ctcatgggaa gtcctggcac agtttttgta aagcccttgc acagctggag aaatggcatc
     2521 attataagct atgagttgaa atgttctgtc aaatgtgtct cacatctaca cgtggcttgg
     2581 aggcttttat ggggccctgt ccaggtagaa aagaaatggt atgtagagct tagatttccc
     2641 tattgtgaca gagccatggt gtgtttgtaa taataaaacc aaagaaacat a
//