LOCUS       HUMERPR                 1624 bp    mRNA    linear   HUM 08-NOV-1994
DEFINITION  Human erythropoietin receptor mRNA, complete cds.
ACCESSION   M34986
VERSION     M34986.1
KEYWORDS    erythropoietin receptor.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1624)
  AUTHORS   Ehrenman,K. and St John,T.
  TITLE     Sequence of the human erythropoietin gene
  JOURNAL   Unpublished
COMMENT     Original source text: Human cell line OCI-M1, cDNA to mRNA.
            Draft entry and computer-readable sequence for [1] kindly submitted
            by T.St.John, 07-JUN-1990.
              Author address: T.St.John
              Hutchinson Cancer Res Center
              1124 Columbia St.
              Seattle, WA
              Email: TSTJOHN@FHCRCVAX.
FEATURES             Location/Qualifiers
     source          1..1624
                     /db_xref="H-InvDB:HIT000195619"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /map="19p13.2"
     gene            1..1624
                     /gene="EPOR"
     CDS             1..1527
                     /gene="EPOR"
                     /note="erythropoietin receptor precursor"
                     /codon_start=1
                     /protein_id="AAA52401.1"
                     /db_xref="GI:182201"
                     /db_xref="GDB:G00-125-242"
                     /translation="MDHLGASLWPQVGSLCLLLAGAAWAPPPNLPDPKFESKAALLAA
                     RGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGA
                     VRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESG
                     HVVLRWLPPPETPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTF
                     AVRARMAEPSFGGFWSAWSEPVSLLTPSDLDPLILTLSLILVVILVLLTVLALLSHRR
                     ALKQKIWPGIPSPESEFEGLFTTHKGNFQLWLYQNDGCLWWSPCTPFTEDPPASLEVL
                     SERCWGTMQAVEPGTDDEGPLLEPVGSEHAQDTYLVLDKWLLPRNPPSEDLPGPGGSV
                     DIVAMDEGSEASSCSSALASKPSPEGASAASFEYTILDPSSQLLRPWTLCPELPPTPP
                     HLKYLYLVVSDSGISTDYSSGDSQGAQGGLSDGPYSNPYENSLIPAAEPLPPSYVACS
                     "
     sig_peptide     1..72
                     /gene="EPOR"
                     /note="erythropoietin receptor signal peptide"
     mat_peptide     73..1524
                     /gene="EPOR"
                     /product="erythropoietin receptor; G00-125-242"
BASE COUNT          276 a          537 c          498 g          313 t
ORIGIN      
        1 atggaccacc tcggggcgtc cctctggccc caggtcggct ccctttgtct cctgctcgct
       61 ggggccgcct gggcgccccc gcctaacctc ccggacccca agttcgagag caaagcggcc
      121 ttgctggcgg cccgggggcc cgaagagctt ctgtgcttca ccgagcggtt ggaggacttg
      181 gtgtgtttct gggaggaagc ggcgagcgct ggggtgggcc cgggcaacta cagcttctcc
      241 taccagctcg aggatgagcc atggaagctg tgtcgcctgc accaggctcc cacggctcgt
      301 ggtgcggtgc gcttctggtg ttcgctgcct acagccgaca cgtcgagctt cgtgccccta
      361 gagttgcgcg tcacagcagc ctccggcgct ccgcgatatc accgtgtcat ccacatcaat
      421 gaagtagtgc tcctagacgc ccccgtgggg ctggtggcgc ggttggctga cgagagcggc
      481 cacgtagtgt tgcgctggct cccgccgcct gagacaccca tgacgtctca catccgctac
      541 gaggtggacg tctcggccgg caacggcgca gggagcgtac agagggtgga gatcctggag
      601 ggccgcaccg agtgtgtgct gagcaacctg cggggccgga cgcgctacac cttcgccgtc
      661 cgcgcgcgta tggctgagcc gagcttcggc ggcttctgga gcgcctggtc ggagcctgtg
      721 tcgctgctga cgcctagcga cctggacccc ctcatcctga cgctctccct catcctcgtg
      781 gtcatcctgg tgctgctgac cgtgctcgcg ctgctctccc accgccgggc tctgaagcag
      841 aagatctggc ctggcatccc gagcccagag agcgagtttg aaggcctctt caccacccac
      901 aagggtaact tccagctgtg gctgtaccag aatgatggct gcctgtggtg gagcccctgc
      961 acccccttca cggaggaccc acctgcttcc ctggaagtcc tctcagagcg ctgctggggg
     1021 acgatgcagg cagtggagcc ggggacagat gatgagggcc ccctgctgga gccagtgggc
     1081 agtgagcatg cccaggatac ctatctggtg ctggacaaat ggttgctgcc ccggaacccg
     1141 cccagtgagg acctcccagg gcctggtggc agtgtggaca tagtggccat ggatgaaggc
     1201 tcagaagcat cctcctgctc atctgctttg gcctcgaagc ccagcccaga gggagcctct
     1261 gctgccagct ttgagtacac tatcctggac cccagctccc agctcttgcg tccatggaca
     1321 ctgtgccctg agctgccccc taccccaccc cacctaaagt acctgtacct tgtggtatct
     1381 gactctggca tctcaactga ctacagctca ggggactccc agggagccca agggggctta
     1441 tccgatggcc cctactccaa cccttatgag aacagcctta tcccagccgc tgagcctctg
     1501 ccccccagct atgtggcttg ctcttaggac accaggctgc agatgatcag ggatccaata
     1561 tgactcagag aaccagtgca gactcaagac ttatggaaca gggatggcga ggcctctctc
     1621 agga
//