LOCUS       HUMVINC                 5102 bp    mRNA    linear   HUM 14-JAN-1995
DEFINITION  Human vinculin mRNA, complete cds.
ACCESSION   M33308
VERSION     M33308.1
KEYWORDS    cytoskeletal protein; vinculin.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 5102)
  AUTHORS   Weller,P.A., Ogryzko,E.P., Corben,E.B., Zhidkova,N.I., Patel,B.,
            Price,G.J., Spurr,N.K., Koteliansky,V.E. and Critchley,D.R.
  TITLE     Complete sequence of human vinculin and assignment of the gene to
            chromosome 10
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 87 (15), 5667-5671 (1990)
   PUBMED   2116004
COMMENT     Original source text: Human endothelial cells, cDNA to mRNA.
            Draft entry and computer-readable sequence for [1] kindly submitted
            by P.A.Weller, 28-MAR-1990.
FEATURES             Location/Qualifiers
     source          1..5102
                     /db_xref="H-InvDB:HIT000195504"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /map="10q22-q23"
     gene            1..5102
                     /gene="VCL"
     CDS             51..3251
                     /gene="VCL"
                     /note="vinculin"
                     /codon_start=1
                     /protein_id="AAA61283.1"
                     /db_xref="GI:340237"
                     /db_xref="GDB:G00-125-348"
                     /translation="MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPV
                     AAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSV
                     PARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTY
                     TKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNS
                     KNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAWASKDTEAMKRALASIDSK
                     LNQAKGWLRDPSASPGDAGEQAIRQILDEAGKVGELCAGKERREILGTCKMLGQMTDQ
                     VADLRARGQGSSPVAMQKAQQVSQGLDVLTAKVENAARKLEAMTNSKQSIAKKIDAAQ
                     NWLADPNGGPEGEEQIRGALAEARKIAELCDDPKERDDILRSLGEISALTSKLADLRR
                     QGKGDSPEARALAKQVATALQNLQTKTNRAVANSRPAKAAVHLEGKIEQAQRWIDNPT
                     VDDRGVGQAAIRGLVAEGHRLANVMMGPYRQDLLAKCDRVDQLTAQLADLAARGEGES
                     PQARALASQLQDSLKDLKARMQEAMTQEVSDVFSDTTTPIKLLAVAATAPPDAPNREE
                     VFDERAANFENHSGKLGATAEKAAAVGTANKSTVEGIQASVKTARELTPQVVSAARIL
                     LRNPGNQAAYEHFETMKNQWIDNVEKMTGLVDEAIDTKSLLDASEEAIKKDLDKCKVA
                     MANIQPQMLVAGATSIARRANRILLVAKREVENSEDPKFREAVKAASDELSKTISPMV
                     MDAKAVAGNISDPGLQKSFLDSGYRILGAVAKVREAFQPQEPDFPPPPPDLEQLRLTD
                     ELAPPKPPLPEGEVPPPRPPPPEEKDEEFPEQKAGEVINQPMMMAARQLHDEARKWSS
                     KGNDIIAAAKRMALLMAEMSRLVRGGSGTKRALIQCAKDIAKASDEVTRLAKEVAKQC
                     TDKRIRTNLLQVCERIPTISTQLKILSTVKATMLGRTNISDEESEQATEMLVHNAQNL
                     MQSVKETVREAEAASIKIRTDAGFTLRWVRKTPWYQ"
BASE COUNT         1379 a         1248 c         1273 g         1202 t
ORIGIN      Chromosome 10.
        1 gaattccact tctctgtcgc ccgcggttcg ccgccccgct cgccgccgcg atgccagtgt
       61 ttcatacgcg cacgatcgag agcatcctgg agccggtggc acagcagatc tcccacctgg
      121 tgataatgca cgaggagggc gaggtggacg gcaaagccat tcctgacctc accgcgcccg
      181 tggccgccgt gcaggcggcc gtcagcaacc tcgtccgggt tggaaaagag actgttcaaa
      241 ccactgagga tcagattttg aagagagata tgccaccagc atttattaag gttgagaatg
      301 cttgcaccaa gcttgtccag gcagctcaga tgcttcagtc agacccttac tcagtgcctg
      361 ctcgagatta tctaattgat gggtcaaggg gcatcctctc tggaacatca gacctgctcc
      421 ttaccttcga tgaggctgag gtccgtaaaa ttattagagt ttgcaaagga attttggaat
      481 atcttacagt ggcagaggtg gtggagacta tggaagattt ggtcacttac acaaagaatc
      541 ttgggccagg aatgactaag atggccaaga tgattgacga gagacagcag gagctcactc
      601 accaggagca ccgagtgatg ttggtgaact cgatgaacac cgtgaaagag ttgctgccag
      661 ttctcatttc agctatgaag atttttgtaa caactaaaaa ctcaaaaaac caaggcatag
      721 aggaagcttt aaaaaatcgc aattttactg tagaaaaaat gagtgctgaa attaatgaga
      781 taattcgtgt gttacaactc acctcttggg atgaagatgc ctgggccagc aaggacactg
      841 aagccatgaa gagagcattg gcctccatag actccaaact gaaccaggcc aaaggttggc
      901 tccgtgaccc tagtgcctcc ccaggggatg ctggtgagca ggccatcaga cagatcttag
      961 atgaagctgg aaaagttggt gaactctgtg caggcaaaga acgcagggag attctgggaa
     1021 cttgcaaaat gctagggcag atgactgatc aagtggctga cctccgtgcc agaggacaag
     1081 gatcctcacc ggtggccatg cagaaagctc agcaggtatc tcagggtctg gatgtgctca
     1141 cagcaaaagt ggaaaatgca gctcgcaagc tggaagccat gaccaactca aagcagagca
     1201 ttgcaaagaa gatcgatgct gctcagaact ggcttgcaga tccaaatggt ggaccggaag
     1261 gagaagagca gattcgaggt gctttggctg aagctcggaa aatagcagaa ttatgtgatg
     1321 atcctaaaga aagagatgac attctacgtt cccttgggga aatatctgct ctgacttcta
     1381 aattagcaga tctacgaaga caggggaaag gagattctcc agaggctcga gccttggcca
     1441 aacaggtggc cacggccctg cagaacctgc agaccaaaac caaccgggct gtggccaaca
     1501 gcagaccggc caaagcagct gtacaccttg agggcaagat tgagcaagca cagcggtgga
     1561 ttgataatcc cacagtggat gaccgtggag tcggtcaggc tgccatccgg gggcttgtgg
     1621 ccgaagggca tcgtctggct aatgttatga tggggcctta tcggcaagat cttctcgcca
     1681 agtgtgaccg agtggaccag ctgacagccc agctggctga cctggctgcc agaggggaag
     1741 gggagagtcc tcaggcacga gcacttgcat ctcagctcca agactcctta aaggatctaa
     1801 aagctcggat gcaggaggcc atgactcagg aagtgtcaga tgttttcagc gataccacaa
     1861 ctcccatcaa gctgttggca gtggcagcca cggcgcctcc tgatgcgcct aacagggaag
     1921 aggtatttga tgagagggca gctaactttg aaaaccattc aggaaagctt ggtgctacgg
     1981 ccgagaaggc ggctgcggtt ggtactgcta ataaatcaac agtggaaggc attcaggcct
     2041 cagtgaagac ggcccgagaa ctcacacccc aggtggtctc ggctgctcgt atcttactta
     2101 ggaaccctgg aaatcaagct gcttatgaac attttgagac catgaagaac cagtggatcg
     2161 ataatgttga aaaaatgaca gggctggtgg acgaagccat tgataccaaa tctctgttgg
     2221 atgcttcaga agaagcaatt aaaaaagacc tggacaagtg caaggtagct atggccaaca
     2281 ttcagcctca gatgctggtt gctggggcaa ccagtattgc tcgtcgggcc aaccggatcc
     2341 tgctggtggc taagagggag gtggagaatt ccgaggatcc caagttccgt gaggctgtga
     2401 aagctgcctc tgatgaattg agcaaaacca tctccccaat ggtgatggat gcaaaagctg
     2461 tggctggaaa catttccgac cctggactgc aaaagagctt cctggactca ggatatcgga
     2521 tcctgggagc tgtggccaag gtcagagaag ccttccaacc tcaggagcct gacttcccgc
     2581 cgcctccacc agaccttgaa caactccgac taacagatga gcttgctcct cccaaaccac
     2641 ctctgcctga aggtgaggtc cctccaccta ggcctccacc accagaggaa aaggatgaag
     2701 agttccctga gcagaaggcc ggggaggtga ttaaccagcc aatgatgatg gctgccagac
     2761 agctccatga tgaagctcgc aaatggtcca gcaagggcaa tgacatcatt gcagcagcca
     2821 agcgcatggc tctgctgatg gctgagatgt ctcggctggt aagagggggc agtggtacca
     2881 agcgggcact cattcagtgt gccaaggaca tcgccaaggc ctcagatgag gtgactcggt
     2941 tggccaagga ggttgccaag cagtgcacag ataaacggat tagaaccaac ctcttacagg
     3001 tatgtgagcg aatcccaacc ataagcaccc agctcaaaat cctgtccaca gtgaaggcca
     3061 ccatgctggg ccggaccaac atcagtgatg aggagtctga gcaggccaca gagatgctgg
     3121 ttcacaatgc ccagaacctc atgcagtctg tgaaggagac tgtgcgggaa gctgaagctg
     3181 cttcaatcaa aattcgaaca gatgctggat ttacactgcg ctgggttaga aagactccct
     3241 ggtaccagta ggcacctggc tgagcctggc tggcacagaa acctctacta aaaagaagga
     3301 aaatgatctg agtcccagga gctgcccaga gttgctggga gctgaaaaat cacatcctgg
     3361 cctggcacat cagaaaggaa tgggggcctc ttcaaattag aagacattta tactcttttt
     3421 tcatggacac tttgaaatgt gtttctgtat aaagcctgta ttctcaaaca cagttacact
     3481 tgtgcaccct ctatcccaat aggcagactg ggtttctagc ccatggactt cacataagct
     3541 cagaatccaa gtgaacacta gccagacact ctgctctgcc cttgttccct aggggacact
     3601 tccctctgtt tctctttcct tggctcccat tcactcttcc agaatcccaa gacccagggc
     3661 ccaggcaaat cagttactaa gaagaaaatt gctgtgcctc ccaaaattgt tttgagcttt
     3721 ccatgttgct gccaaccata ccttccttcc ctgggctgtg ctacctgggt ccttttcaga
     3781 agtgagcttt gctgctacag gggaaggtgg cctctgtgga gccccagcat atgggggcct
     3841 ggattcattt cctgcccttc ctcagtttaa tccttctagt ttcccacaat ataaaactgt
     3901 acttcactgt caggaagaaa tcacagaatc atatgattct gcttttacca tgcccctgag
     3961 caatgtctgt gctagggaaa ctccccgtcc catatcctgc ctcagcccgc caaggtagcc
     4021 atcccatgaa cacactgtgt cctggtgctc tctgccactg gaagggcaga gtagccaggg
     4081 tgtggccctg ccatcttccc agcagggcca ctcccggcac tccatgctta gtcactgcct
     4141 gcagaggtct gtgctgaggc cttatcattc attcttagct cttaattgtt cattttgagc
     4201 tgaaatgctg cattttaatt ttaaccaaaa catgtctcct atatcctggt ttttgtagcc
     4261 ttcctccaca tcctttctaa acaagatttt aaagacatgt aggtgtttgt tcatctgtaa
     4321 ctctaaaaga tcctttttaa attcagtcct aagaaagagg agtgcttgtc ccctaagagt
     4381 gtttaatggc aaggcagccc tgtctgaagg acacttcctg cctaagggag agtggtattt
     4441 gcagactaga attctagtgc tgctgaagat gaatcaatgg gaaatactac tcctgtaatt
     4501 cctacctccc tgcaaccaac tacaaccaag ctctctgcat ctactcccaa gtatggggtt
     4561 caagagagta atgggtttca tatttcttat caccacagta agttcctact aggcaaaatg
     4621 agagggcagt gtttcctttt tggtacttat tactgctaag tatttcccag cacatgaaac
     4681 cttatttttt ccaaagccag aaccagatga gtaaaggagt aagaaccttg cctgaacatc
     4741 cttccttccc acccatcgct gtgtgttagt tcccaacatc gaatgtgtac aacttaagtt
     4801 ggtcctttac actcaggctt tcactatttc ctttaaaatg aggatgatta ttttcaaggc
     4861 cctcagcata tttgtatagt tgcttgcctg atataaatgc aatattaatg cctttaaagt
     4921 atgaatctat gccaaagatc acttgttgtt ttactaaaga aagattactt agaggaaata
     4981 agaaaaatca tgtttgctct cccggttctt ccagtggttt gagacactgg tttacacttt
     5041 atgccggatg tgcttttctc caatatcagt gctcgagaca cagtgaagca aattaaaaaa
     5101 aa
//