LOCUS       HUMBCL3AA               1813 bp    mRNA    linear   HUM 31-OCT-1994
DEFINITION  Human B-cell lymphoma 3-encoded protein (bcl-3) mRNA, complete cds.
ACCESSION   M31732
VERSION     M31732.1
KEYWORDS    lymphoma 3-encoded protein.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1813)
  AUTHORS   Ohno,H., Takimoto,G. and McKeithan,T.W.
  TITLE     The candidate proto-oncogene bcl-3 is related to genes implicated
            in cell lineage determination and cell cycle control
  JOURNAL   Cell 60 (6), 991-997 (1990)
   PUBMED   2180580
COMMENT     Original source text: Human lymphocyte Louckes cell line (Burkitt's
            lymphoma), cDNA to mRNA, clone cLK2.
            Draft entry and computer-readable sequence for [1] kindly submitted
            by T.McKeithan, 30-JAN-1990.
FEATURES             Location/Qualifiers
     source          1..1813
                     /db_xref="H-InvDB:HIT000195441"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /map="19q13.1-q13.2"
     gene            1..1813
                     /gene="BCL3"
     mRNA            <1..1813
                     /gene="BCL3"
                     /product="bcl-3 mRNA"
     CDS             42..1382
                     /gene="BCL3"
                     /note="lymphoma 3-encoded protein (bcl-3)"
                     /codon_start=1
                     /protein_id="AAA51815.1"
                     /db_xref="GI:179376"
                     /db_xref="GDB:G00-120-561"
                     /translation="MDEGPVDLRTRPKAAGLPGAALPLRKRPLRAPSPEPAAPRGAAG
                     LVVPLDPLRGGCDLPAVPGPPHGLARPEALYYPGALLPLYPTRAMGSPFPLVNLPTPL
                     YPMMCPMEHPLSADIAMATRADEDGDTPLHIAVVQGNLPAVHRLVNLFQQGGRELDIY
                     NNLRQTPLHLAVITTLPSVVRLLVTAGASPMALDRHGQTAAHLACEHRSPTCLRALLD
                     SAAPGTLDLEARNYDGLTALHVAVNTECQETVQLLLERGADIDAVDIKSGRSPLIHAV
                     ENNSLSMVQLLLQHGANVNAQMYSGSSALHSASGRGLLPLVRTLVRSGADSSLKNCHN
                     DTPLMVARSRRVIDILRGKATRPASTSQPDPSPDRSANTSPESSSRLSSNGLLSASPS
                     SSPSQSPPRDPPGFPMAPPNFFLPSPSPPAFLPFAGVLRGPGRPVPPSPAPGGS"
BASE COUNT          298 a          714 c          486 g          315 t
ORIGIN      
        1 ccgtccccgg cggccccatg ccccgatgcc ccgcgggggc catggacgag gggcccgtgg
       61 acctgcgcac ccggcccaag gccgccggac tcccgggcgc cgcgctgccg ctccgcaagc
      121 gcccgctgcg cgcgccctcc ccggagcccg ccgctccccg cggcgctgcg ggccttgtcg
      181 tccccctgga ccctctgcgc ggcggctgcg acctgccggc ggtccccggg cccccccacg
      241 gcctggcccg gccggaggcg ctttactacc ccggagcctt actgcctttg taccccactc
      301 gggccatggg ctccccgttt cctctggtga acctgcctac acccctatac cccatgatgt
      361 gccccatgga acaccccctt tctgctgaca tcgccatggc cacccgtgca gatgaggacg
      421 gagacacgcc tctccatatt gctgtggtgc agggtaacct gccagctgtg caccggctgg
      481 tcaacctctt ccagcagggg ggccgggagc tcgacatcta caacaaccta cggcagacac
      541 cgctccacct ggctgtgatc accacattac cgtctgtggt ccggctcctg gtgacagctg
      601 gtgccagccc catggcgctg gaccgccatg gccagacggc cgctcacctg gcgtgcgagc
      661 accgcagccc gacctgcctg cgagccctgc tggacagcgc agctccgggc acgttggacc
      721 tggaggcccg caattatgac gggctcaccg ccctgcacgt ggcagtgaac accgagtgcc
      781 aagaaaccgt gcagctcttg ctagagcgcg gtgccgacat cgacgcagtg gacattaaga
      841 gcggccgctc cccgctcatc cacgccgtgg aaaacaacag ccttagcatg gtgcagctgc
      901 tgctgcagca cggcgccaac gtgaacgcgc aaatgtactc cggcagctcc gccctgcact
      961 cagcgtccgg ccgcgggctc ctcccgctgg tgcgcacgct ggtccgcagc ggcgctgaca
     1021 gcagcctcaa gaactgccac aacgacacgc cgctcatggt ggcgcgcagc cgcagggtca
     1081 tcgacatcct gagggggaag gccacccggc ctgcttccac ctcccagcca gacccctccc
     1141 ctgaccggag cgccaacacc tcccccgaga gcagcagccg cctcagctcc aatggtcttc
     1201 tctccgcatc accatcctcc tcaccctccc agtctccccc cagggacccc cctggattcc
     1261 ccatggctcc tcccaatttc ttccttcctt ccccatctcc acccgccttc ctgccctttg
     1321 ctggggtcct ccgaggccct ggccggccgg tgcccccctc cccagctcca ggaggcagct
     1381 gagggggatg ggggggcaga tcttggactc atgaggaggg gcccccctgc ccagaggggt
     1441 caacccttct ggaaactgtg aagatctgac ttcgcccccc ccccccccca tcttcgggac
     1501 caggatttgc acagaagcac atgcacctac ccatacaccc cctcttctga gcgtccctgt
     1561 tcccccatct cgctccctcc caggactctg accccagcat tctcaggcac cagtccctgt
     1621 ccggaatgcc acccacatct tccatttcca tgtcccctcc cagagctggt ggacccaggg
     1681 aacagccact cccctccact ctctaccaga taactgagga ggggagaggt gggccgtaac
     1741 gggcacggat cacgatgtaa attattaagc attttggttg gatttctttt gtaataaact
     1801 atttttgtac cat
//