LOCUS       HUMBCL2C                6030 bp    mRNA    linear   HUM 27-APR-1993
DEFINITION  Human bcl-2 mRNA.
ACCESSION   M14745
VERSION     M14745.1
KEYWORDS    c-myc proto-oncogene.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 6030)
  AUTHORS   Cleary,M.L., Smith,S.D. and Sklar,J.
  TITLE     Cloning and structural analysis of cDNAs for bcl-2 and a hybrid
            bcl-2/immunoglobulin transcript resulting from the t(14;18)
            translocation
  JOURNAL   Cell 47 (1), 19-28 (1986)
   PUBMED   2875799
COMMENT     Original source text: Human common acute lymphoblastic leukemia
            cell line cDNA to mRNA.
FEATURES             Location/Qualifiers
     source          1..6030
                     /db_xref="H-InvDB:HIT000194357"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     CDS             32..751
                     /note="bcl-2 protein"
                     /codon_start=1
                     /protein_id="AAA35591.1"
                     /db_xref="GI:179371"
                     /translation="MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAP
                     APGIFSSQPGHTPHTAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGD
                     DFSRRYRRDFAEMSRQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVE
                     SVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLK
                     TLLSLALVGACITLGAYLGHK"
BASE COUNT         1668 a         1247 c         1386 g         1729 t
ORIGIN      Chromosome 18.
        1 gttggccccc gttacttttc ctctgggaaa tatggcgcac gctgggagaa cagggtacga
       61 taaccgggag atagtgatga agtacatcca ttataagctg tcgcagaggg gctacgagtg
      121 ggatgcggga gatgtgggcg ccgcgccccc gggggccgcc cccgcgccgg gcatcttctc
      181 ctcgcagccc gggcacacgc cccatacagc cgcatcccgg gacccggtcg ccaggacctc
      241 gccgctgcag accccggctg cccccggcgc cgccgcgggg cctgcgctca gcccggtgcc
      301 acctgtggtc cacctgaccc tccgccaggc cggcgacgac ttctcccgcc gctaccgccg
      361 cgacttcgcc gagatgtcca ggcagctgca cctgacgccc ttcaccgcgc ggggacgctt
      421 tgccacggtg gtggaggagc tcttcaggga cggggtgaac tgggggagga ttgtggcctt
      481 ctttgagttc ggtggggtca tgtgtgtgga gagcgtcaac cgggagatgt cgcccctggt
      541 ggacaacatc gccctgtgga tgactgagta cctgaaccgg cacctgcaca cctggatcca
      601 ggataacgga ggctgggatg cctttgtgga actgtacggc cccagcatgc ggcctctgtt
      661 tgatttctcc tggctgtctc tgaagactct gctcagtttg gccctggtgg gagcttgcat
      721 caccctgggt gcctatctgg gccacaagtg aagtcaacat gcctgcccca aacaaatatg
      781 caaaaggttc actaaagcag tagaaataat atgcattgtc agtgatgttc catgaaacaa
      841 agctgcaggc tgtttaagaa aaaataacac acatataaac atcacacaca cagacagaca
      901 cacacacaca caacaattaa cagtcttcag gcaaaacgtc gaatcagcta tttactgcca
      961 aagggaaata tcatttattt tttacattat taagaaaaaa agatttattt atttaagaca
     1021 gtcccatcaa aactcctgtc tttggaaatc cgaccactaa ttgccaagca ccgcttcgtg
     1081 tggctccacc tggatgttct gtgcctgtaa acatagattc gctttccatg ttgttggccg
     1141 gatcaccatc tgaagagcag acggatggaa aaaggacctg atcattgggg aagctggctt
     1201 tctggctgct ggaggctggg gagaaggtgt tcattcactt gcatttcttt gccctggggg
     1261 ctgtgatatt aacagaggga gggttcctgt ggggggaagt ccatgcctcc ctggcctgaa
     1321 gaagagactc tttgcatatg actcacatga tgcatacctg gtgggaggaa aagagttggg
     1381 aacttcagat ggacctagta cccactgaga tttccacgcc gaaggacagc gatgggaaaa
     1441 atgcccttaa atcataggaa agtatttttt taagctacca attgtgccga gaaaagcatt
     1501 ttagcaattt atacaatatc atccagtacc ttaagccctg attgtgtata ttcatatatt
     1561 ttggatacgc accccccaac tcccaatact ggctctgtct gagtaagaaa cagaatcctc
     1621 tggaacttga ggaagtgaac atttcggtga cttccgcatc aggaaggcta gagttaccca
     1681 gagcatcagg ccgccacaag tgcctgcttt taggagaccg aagtccgcag aacctgcctg
     1741 tgtcccagct tggaggcctg gtcctggaac tgagccgggg ccctcactgg cctcctccag
     1801 ggatgatcaa cagggcagtg tggtctccga atgtctggaa gctgatggag ctcagaattc
     1861 cactgtcaag aaagagcagt agaggggtgt ggctgggcct gtcaccctgg ggccctccag
     1921 gtaggcccgt tttcacgtgg agcatgggag ccacgaccct tcttaagaca tgtatcactg
     1981 tagagggaag gaacagaggc cctgggccct tcctatcaga aggacatggt gaaggctggg
     2041 aacgtgagga gaggcaatgg ccacggccca ttttggctgt agcacatggc acgttggctg
     2101 tgtggccttg gcccacctgt gagtttaaag caaggcttta aatgactttg gagagggtca
     2161 caaatcctaa aagaagcatt gaagtgaggt gtcatggatt aattgacccc tgtctatgga
     2221 attacatgta aaacattatc ttgtcactgt agtttggttt tatttgaaaa cctgacaaaa
     2281 aaaaagttcc aggtgtggaa tatgggggtt atctgtacat cctggggcat taaaaaaaaa
     2341 atcaatggtg gggaactata aagaagtaac aaaagaagtg acatcttcag caaataaact
     2401 aggaaatttt tttttcttcc agtttagaat cagccttgaa acattgatgg aataactctg
     2461 tggcattatt gcattatata ccatttatct gtattaactt tggaatgtac tctgttcaat
     2521 gtttaatgct gtggttgata tttcgaaagc tgctttaaaa aaatacatgc atctcagcgt
     2581 ttttttgttt ttaattgtat ttagttatgg cctatacact atttgtgagc aaaggtgatc
     2641 gttttctgtt tgagattttt atctcttgat tcttcaaaag cattctgaga aggtgagata
     2701 agccctgagt ctcagctacc taagaaaaac ctggatgtca ctggccactg aggagctttg
     2761 tttcaaccaa gtcatgtgca tttccacgtc aacagaattg tttattgtga cagttatatc
     2821 tgttgtccct ttgaccttgt ttcttgaagg tttcctcgtc cctgggcaat tccgcattta
     2881 attcatggta ttcaggatta catgcatgtt tggttaaacc catgagattc attcagttaa
     2941 aaatccagat ggcaaatgac cagcagattc aaatctatgg tggtttgacc tttagagagt
     3001 tgctttacgt ggcctgtttc aacacagacc cacccagagc cctcctgccc tccttccgcg
     3061 ggggctttct catggctgtc cttcagggtc ttcctgaaat gcagtggtgc ttacgctcca
     3121 ccaagaaagc aggaaacctg tggtatgaag ccagacctcc ccggcgggcc tcagggaaca
     3181 gaatgatcag acctttgaat gattctaatt tttaagcaaa atattatttt atgaaaggtt
     3241 tacattgtca aagtgatgaa tatggaatat ccaatcctgt gctgctatcc tgccaaaatc
     3301 attttaatgg agtcagtttg cagtatgctc cacgtggtaa gatcctccaa gctgctttag
     3361 aagtaacaat gaagaacgtg gacgctttta atataaagcc tgttttgtct tctgttgttg
     3421 ttcaaacggg attcacagag tatttgaaaa atgtatatat attaagaggt cacgggggct
     3481 aattgctggc tggctgcctt ttgctgtggg gttttgttac ctggttttaa taacagtaaa
     3541 tgtgcccagc ctcttggccc cagaactgta cagtattgtg gctgcacttg ctctaagagt
     3601 agttgatgtt gcattttcct tattgttaaa aacatgttag aagcaatgaa tgtatataaa
     3661 agcctcaact agtcattttt ttctcctctt cttttttttc attatatcta attattttgc
     3721 agttgggcaa cagagaacca tccctatttt gtattgaaga gggattcaca tctgcatctt
     3781 aactgctctt tatgaatgaa aaaacagtcc tctgtatgta ctcctcttta cactggccag
     3841 ggtcagagtt aaatagagta tatgcacttt ccaaattggg gacaagggct ctaaaaaaag
     3901 ccccaaaagg agaagaacat ctgagaacct cctcggccct cccagtccct cgctgcacaa
     3961 atactccgca agagaggcca gaatgacagc tgacagggtc tatggccatc gggtcgtctc
     4021 cgaagatttg gcaggggcag aaaactctgg caggcttaag atttggaata aagtcacaga
     4081 atcaaggaag cacctcaatt tagttcaaac aagacgccaa cattctctcc acagctcact
     4141 tacctctctg tgttcagatg tggccttcca tttatatgtg atctttgttt tattagtaaa
     4201 tgcttatcat ctaaagatgt agctctggcc cagtgggaaa aattaggaag tgattataaa
     4261 tcgagaggag ttataataat caagattaaa tgtaaataat cagggcaatc ccaacacatg
     4321 tctagctttc acctccagga tctattgagt gaacagaatt gcaaatagtc tctatttgta
     4381 attgaactta tcctaaaaca aatagtttat aaatgtgaac ttaaactcta attaattcca
     4441 actgtacttt taaggcagtg gctgttttta gactttctta tcacttatag ttagtaatgt
     4501 acacctactc tatcagagaa aaacaggaaa ggctcgaaat acaagccatt ctaaggaaat
     4561 tagggagtca gttgaaattc tattctgatc ttattctgtg gtgtcttttg cagcccagac
     4621 aaatgtggtt acacactttt taagaaatac aattctacat tgtcaagctt atgaaggttc
     4681 caatcagatc tttattgtta ttcaatttgg atctttcagg gatttttttt ttaaattatt
     4741 atgggacaaa ggacatttgt tggaggggtg ggagggagga acaattttta aatataaaac
     4801 attcccaagt ttggatcagg gagttggaag ttttcagaat aaccagaact aagggtatga
     4861 aggacctgta ttggggtcga tgtgatgcct ctgcgaagaa ccttgtgtga caaatgagaa
     4921 acattttgaa gtttgtggta cgacctttag attccagaga catcagcatg gctcaaagtg
     4981 cagctccgtt tggcagtgca atggtataaa tttcaagctg gatatgtcta atgggtattt
     5041 aaacaataaa tgtgcagttt taactaacag gatatttaat gacaaccttc tggttggtag
     5101 ggacatctgt ttctaaatgt ttattatgta caatacagaa aaaaatttta taaaattaag
     5161 caatgtgaaa ctgaattgga gagtgataat acaagtcctt tagtcttacc cagtgaatca
     5221 ttctgttcca tgtctttgga caaccatgac cttggacaat catgaaatat gcatctcact
     5281 ggatgcaaag aaaatcagat ggagcatgaa tggtactgta ccggttcatc tggactgccc
     5341 cagaaaaata acttcaagca aacatcctat caacaacaag gttgttctgc ataccaagct
     5401 gagcacagaa gatgggaaca ctggtggagg atggaaaggc tcgctcaatc aagaaaattc
     5461 tgagactatt aataaataag actgtagtgt agatactgag taaatccatg cacctaaacc
     5521 ttttggaaaa tctgccgtgg gccctccaga tagctcattt cattaagttt ttccctccaa
     5581 ggtagaattt gcaagagtga cagtggattg catttctttt ggggaagctt tcttttggtg
     5641 gttttgttta ttataccttc ttaagttttc aaccaaggtt tgcttttgtt ttgagttact
     5701 ggggttattt ttgttttaaa taaaaataag tgtacaataa gtgtttttgt attgaaagct
     5761 tttgttatca agattttcat acttttacct tccatggctc tttttaagat tgatactttt
     5821 aagaggtggc tgatattctg caacactgta cacataaaaa atacggtaag gatactttac
     5881 atggttaagg taaagtaagt ctccagttgg ccaccattag ctataatggc actttgtttg
     5941 tgttgttgga aaaagtcaca ttgccattaa actttccttg tctgtctagt taatattgtg
     6001 aagaaaaata aagtacagtg tgagatactg
//